HHsearch alignment for GI: 254780777 and conserved domain: cd04253

>cd04253 AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMPK)-Pf, the mostly archaeal uridine monophosphate kinase (uridylate kinase) enzymes that catalyze UMP phosphorylation and play a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway). The UMP kinase of Pyrococcus furiosus (Pf) is known to function as a homohexamer, with GTP and UTP being allosteric effectors. Like other related enzymes (carbamate kinase, aspartokinase, and N-acetylglutamate kinase) the E. coli and most bacterial UMPKs have a conserved, N-terminal, lysine residue proposed to function in the catalysis of the phosphoryl group transfer, whereas most archaeal UMPKs (this CD) appear to lack this residue and the Pyrococcus furiosus structure has an additional Mg ion bound to the ATP molecule which is proposed to function as the catalysis instead. Members of thi
Probab=100.00  E-value=4.6e-42  Score=279.00  Aligned_cols=212  Identities=30%  Similarity=0.446  Sum_probs=169.5

Q ss_pred             EEEEEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             99999400368538877708999999999999999769909998236541023344203777754024678888898999
Q gi|254780777|r    8 RVLLKVSGEALAGISGFGVDIDSVNRICADIAEVYAKGIEIGIVVGGGNIFRGSQVVAENYLLCERSTVDSMGMLSTVIN   87 (242)
Q Consensus         8 rIViKiGGSsL~~~~~~~~~~~~i~~ia~~I~~~~~~g~~vviV~sg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   87 (242)
T Consensus         1 RIViKiGgs~l~~~~----~~~~i~~la~~i~~l~-~~~~~iiVvggG~~ar~~~~~~~~~-~~~~~~~~~~g~~~t~~n   74 (221)
T cd04253           1 RIVISLGGSVLAPEK----DADFIKEYANVLRKIS-DGHKVAVVVGGGRLAREYISVARKL-GASEAFLDEIGIMATRLN   74 (221)
T ss_pred             CEEEEEEHHHCCCCC----CHHHHHHHHHHHHHHH-CCCEEEEEECCCHHHHHHHHHHHHC-CCCHHHHHHHHHHHHHHH
T ss_conf             979996077707998----8799999999999997-5996999987777887699999985-978999999999999999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHCCHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHCHHHHHHCCCC
Q ss_conf             99999999761886411340010024566543210000110011111246556777621578888864164466514754
Q gi|254780777|r   88 ALALDLALRKINVPTVILSSIFMPQVCEVFSCRNAVSYLSQGKVVIFSGGTGNAFLTTDSAAALRASEIGADVILKGTQV  167 (242)
Q Consensus        88 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~D~~a~~ia~~~~ad~l~i~tdv  167 (242)
T Consensus        75 a~~l~~~~~~~~~~~~-------------~~~~~~~~~l~~~~i~v~~g~--~p~~ttD~laa~vA~~i~Ad~li~ltdV  139 (221)
T cd04253          75 ARLLIAALGDAYPPVP-------------TSYEEALEAMFTGKIVVMGGT--EPGQSTDAVAALLAERLGADLLINATNV  139 (221)
T ss_pred             HHHHHHHHHCCCCCCC-------------CCHHHHHHHHHCCCEEEEECC--CCCCCCCHHHHHHHHHHCCCEEEEEECC
T ss_conf             9999997404587664-------------659999999974986999478--8988867999999998298747886435


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCHHHHHHC---------CCCCCCHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCCCCCE
Q ss_conf             3512343223444444441159999855---------9981409999999974996999518985479999779987824
Q gi|254780777|r  168 DGVYSADPRVHASSTRFDSLTYNQFIEK---------GLKVMDCASVVLARDCSIPIIVFSIHSPGGIWGGLSGIGRSTI  238 (242)
Q Consensus       168 dGiyt~dP~~~~~ak~i~~is~~e~l~~---------G~~v~~~~A~~~a~~~gI~v~I~ng~~~~~i~~~l~Ge~~GT~  238 (242)
T Consensus       140 dGvY~~DP~~~~~Ak~i~~is~~el~~~~~~~~~~~g~~~~~d~~Aa~~a~~~gi~~~I~nG~~~~~i~~~l~Ge~vGTl  219 (221)
T cd04253         140 DGVYSKDPRKDPDAKKFDRLSADELIDIVGKSSWKAGSNEPFDPLAAKIIERSGIKTIVVDGRDPENLERALKGEFVGTI  219 (221)
T ss_pred             CCCCCCCCCCCCCCEECCCCCHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHCCCCCCEE
T ss_conf             87557898779987788658899999883567756898764799999999987998899869997589999779999716


Q ss_pred             EC
Q ss_conf             66
Q gi|254780777|r  239 IS  240 (242)
Q Consensus       239 I~  240 (242)
T Consensus       220 I~  221 (221)
T cd04253         220 IE  221 (221)
T ss_pred             EC
T ss_conf             69