RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780777|ref|YP_003065190.1| uridylate kinase [Candidatus Liberibacter asiaticus str. psy62] (242 letters) >gnl|CDD|58620 cd04254, AAK_UMPK-PyrH-Ec, UMP kinase (UMPK)-Ec, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway). The UMP kinase of E. coli (Ec) is known to function as a homohexamer, with GTP and UTP being allosteric effectors. Like other related enzymes (carbamate kinase, aspartokinase, and N-acetylglutamate kinase) the E. coli and most bacterial and chloroplast UMPKs (this CD) have a conserved, N-terminal, lysine residue proposed to function in the catalysis of the phosphoryl group transfer, whereas most archaeal UMPKs appear to lack this residue and the Pyrococcus furiosus structure has an additional Mg ion bound to the ATP molecule which is proposed to function as the catalysis instead. Members of this CD belong to the Amino Acid Kinase Superfamily (AAK).. Length = 231 Score = 295 bits (758), Expect = 5e-81 Identities = 127/234 (54%), Positives = 168/234 (71%), Gaps = 3/234 (1%) Query: 7 KRVLLKVSGEALAGISGFGVDIDSVNRICADIAEVYAKGIEIGIVVGGGNIFRGSQVVAE 66 KRVLLK+SGEALAG +GFG+D + +NRI +I EV G+E+ IVVGGGNIFRG+ Sbjct: 1 KRVLLKLSGEALAGENGFGIDPEVLNRIAREIKEVVDLGVEVAIVVGGGNIFRGASAAEA 60 Query: 67 NYLLCERSTVDSMGMLSTVINALALDLALRKINVPTVILSSIFMPQVCEVFSCRNAVSYL 126 +R+T D MGML+TVINALAL AL + V T ++S+I M V E + R A+ +L Sbjct: 61 GM---DRATADYMGMLATVINALALQDALESLGVKTRVMSAIPMQGVAEPYIRRRAIRHL 117 Query: 127 SQGKVVIFSGGTGNAFLTTDSAAALRASEIGADVILKGTQVDGVYSADPRVHASSTRFDS 186 +G+VVIF+GGTGN F TTD+AAALRA EI ADVILK T+VDGVY ADP+ + ++ R+D Sbjct: 118 EKGRVVIFAGGTGNPFFTTDTAAALRAIEINADVILKATKVDGVYDADPKKNPNAKRYDH 177 Query: 187 LTYNQFIEKGLKVMDCASVVLARDCSIPIIVFSIHSPGGIWGGLSGIGRSTIIS 240 LTY++ + KGLKVMD + L RD ++PI+VF+I+ PG + + G G T+IS Sbjct: 178 LTYDEVLSKGLKVMDATAFTLCRDNNLPIVVFNINEPGNLLKAVKGEGVGTLIS 231 >gnl|CDD|30874 COG0528, PyrH, Uridylate kinase [Nucleotide transport and metabolism]. Length = 238 Score = 269 bits (690), Expect = 4e-73 Identities = 123/237 (51%), Positives = 163/237 (68%), Gaps = 4/237 (1%) Query: 6 YKRVLLKVSGEALAGISGFGVDIDSVNRICADIAEVYAKGIEIGIVVGGGNIFRGSQVVA 65 Y R+LLK+SGEALAG GFG+D + ++RI +I E+ G+E+ +VVGGGNI RG A Sbjct: 5 YMRILLKLSGEALAGEQGFGIDPEVLDRIANEIKELVDLGVEVAVVVGGGNIARGYIGAA 64 Query: 66 ENYLLCERSTVDSMGMLSTVINALALDLALRKINVPTVILSSIFMPQVCEVFSCRNAVSY 125 +R T D MGML+TV+NALAL AL ++ V T + S+I MPQV E +S R A+ + Sbjct: 65 AGM---DRVTADYMGMLATVMNALALQDALERLGVDTRVQSAIAMPQVAEPYSRREAIRH 121 Query: 126 LSQGKVVIFSGGTGNAFLTTDSAAALRASEIGADVILKGT-QVDGVYSADPRVHASSTRF 184 L +G+VVIF GGTGN TTD+AAALRA EI ADV+LK T +VDGVY ADP+ + ++ Sbjct: 122 LEKGRVVIFGGGTGNPGFTTDTAAALRAEEIEADVLLKATNKVDGVYDADPKKDPDAKKY 181 Query: 185 DSLTYNQFIEKGLKVMDCASVVLARDCSIPIIVFSIHSPGGIWGGLSGIGRSTIISG 241 D+LTY++ ++ GLKVMD + LARD IPIIVF+I+ PG + L G TI+ Sbjct: 182 DTLTYDEVLKIGLKVMDPTAFSLARDNGIPIIVFNINKPGNLKRALKGEEVGTIVEP 238 >gnl|CDD|58605 cd04239, AAK_UMPK-like, AAK_UMPK-like: UMP kinase (UMPK)-like, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis. Regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway). The UMP kinases of E. coli (Ec) and Pyrococcus furiosus (Pf) are known to function as homohexamers, with GTP and UTP being allosteric effectors. Like other related enzymes (carbamate kinase, aspartokinase, and N-acetylglutamate kinase) the E. coli and most bacterial UMPKs have a conserved, N-terminal, lysine residue proposed to function in the catalysis of the phosphoryl group transfer, whereas most archaeal UMPKs appear to lack this residue and the Pyrococcus furiosus structure has an additional Mg ion bound to the ATP molecule which is proposed to function as the catalysis instead. Also included in this CD are the alpha and beta subunits of the Mo storage protein (MosA and MosB) characterized as an alpha4-beta4 octamer containing an ATP-dependent, polynuclear molybdenum-oxide cluster. These and related sequences in this CD are members of the Amino Acid Kinase Superfamily (AAK).. Length = 229 Score = 255 bits (653), Expect = 9e-69 Identities = 114/233 (48%), Positives = 155/233 (66%), Gaps = 4/233 (1%) Query: 8 RVLLKVSGEALAGISGFGVDIDSVNRICADIAEVYAKGIEIGIVVGGGNIFRGSQVVAEN 67 R++LK+SGEALAG G G+D + + I +I EV G+E+ IVVGGGNI RG A Sbjct: 1 RIVLKLSGEALAG-EGGGIDPEVLKEIAREIKEVVDLGVEVAIVVGGGNIARGYIAAARG 59 Query: 68 YLLCERSTVDSMGMLSTVINALALDLALRKINVPTVILSSIFMPQVCEVFSCRNAVSYLS 127 R+T D +GML+TV+NALAL AL K+ V T ++S+I M V E + R A+ +L Sbjct: 60 M---PRATADYIGMLATVMNALALQDALEKLGVKTRVMSAIPMQGVAEPYIRRRAIRHLE 116 Query: 128 QGKVVIFSGGTGNAFLTTDSAAALRASEIGADVILKGTQVDGVYSADPRVHASSTRFDSL 187 +G++VIF GGTGN TTD+AAALRA EIGADV+LK T VDGVY ADP+ + + ++D + Sbjct: 117 KGRIVIFGGGTGNPGFTTDTAAALRAEEIGADVLLKATNVDGVYDADPKKNPDAKKYDRI 176 Query: 188 TYNQFIEKGLKVMDCASVVLARDCSIPIIVFSIHSPGGIWGGLSGIGRSTIIS 240 +Y++ ++KGLKVMD ++ L R IPIIVF+ PG + L G T+I Sbjct: 177 SYDELLKKGLKVMDATALTLCRRNKIPIIVFNGLKPGNLLRALKGEHVGTLIE 229 >gnl|CDD|144336 pfam00696, AA_kinase, Amino acid kinase family. This family includes kinases that phosphorylate a variety of amino acid substrates, as well as uridylate kinase and carbamate kinase. This family includes: Aspartokinase EC:2.7.2.4. Acetylglutamate kinase EC:2.7.2.8. Glutamate 5-kinase EC:2.7.2.11. Uridylate kinase EC:2.7.4.-. Carbamate kinase EC:2.7.2.2. Length = 230 Score = 95.9 bits (239), Expect = 9e-21 Identities = 64/237 (27%), Positives = 108/237 (45%), Gaps = 31/237 (13%) Query: 7 KRVLLKVSGEALAGISGFGVDIDSVNRICADIAEVYAKGIEIGIVVGGGNIFRGSQVVAE 66 KR+++K+ G +L D D++ RI +IA + GI++ +V GGG Sbjct: 1 KRIVIKLGGSSLT-------DEDAIKRIAEEIALLSELGIKVVVVSGGGGFTDKLLAAYG 53 Query: 67 NYL-LCERSTVDSMGMLSTVINALALDL---ALRKINVPTV--ILSSIFMPQVCEVFSCR 120 + R T + G++ A LD+ A ++ V +LS + V + Sbjct: 54 IAEKIGLRVTAGATGLIIEAALAGLLDIVVSAGERLGARAVALLLSDGGIGAVRLDANDT 113 Query: 121 NAVS-YLSQGKVVIFSGGTGN---------AFLTTDSAAALRASEIGADVILKGTQVDGV 170 A+ L +G V + +G G ++D+ AAL A +GAD ++ T VDGV Sbjct: 114 EAIKELLEEGVVPVITGFGGENDTGETTTLGRGSSDTLAALLAEALGADKLIILTDVDGV 173 Query: 171 YSADPRVHASSTRFDSLTYNQFIE--------KGLKVMDCASVVLARDCSIPIIVFS 219 Y+ADPR + L+Y++ E G+KV D A++ AR IP+++ + Sbjct: 174 YTADPRKVPDAKLIPELSYDEAEELLAAGDGTGGMKVKDPAALKAARRGGIPVVIVN 230 >gnl|CDD|58619 cd04253, AAK_UMPK-PyrH-Pf, AAK_UMPK-PyrH-Pf: UMP kinase (UMPK)-Pf, the mostly archaeal uridine monophosphate kinase (uridylate kinase) enzymes that catalyze UMP phosphorylation and play a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway). The UMP kinase of Pyrococcus furiosus (Pf) is known to function as a homohexamer, with GTP and UTP being allosteric effectors. Like other related enzymes (carbamate kinase, aspartokinase, and N-acetylglutamate kinase) the E. coli and most bacterial UMPKs have a conserved, N-terminal, lysine residue proposed to function in the catalysis of the phosphoryl group transfer, whereas most archaeal UMPKs (this CD) appear to lack this residue and the Pyrococcus furiosus structure has an additional Mg ion bound to the ATP molecule which is proposed to function as the catalysis instead. Members of this CD belong to the Amino Acid Kinase Superfamily (AAK).. Length = 221 Score = 95.7 bits (238), Expect = 1e-20 Identities = 68/241 (28%), Positives = 106/241 (43%), Gaps = 30/241 (12%) Query: 8 RVLLKVSGEALAGISGFGVDIDSVNRICADIAEVYAKGIEIGIVVGGGNIFRGSQVVAEN 67 R+++ + G LA D D + A++ + G ++ +VVGGG + R VA Sbjct: 1 RIVISLGGSVLAP----EKDADFIKEY-ANVLRKISDGHKVAVVVGGGRLAREYISVARK 55 Query: 68 YLLCERSTVDSMGMLSTVINALALDLALRKINVPTVILSSIFMPQVCEVFSCRNAVSYLS 127 E + +D +G+++T +NA L AL P S A+ + Sbjct: 56 LGASE-AFLDEIGIMATRLNARLLIAALGDAYPPVPT-------------SYEEALEAMF 101 Query: 128 QGKVVIFSGGTGNAFLTTDSAAALRASEIGADVILKGTQVDGVYSADPRVHASSTRFDSL 187 GK+V+ GGT +TD+ AAL A +GAD+++ T VDGVYS DPR + +FD L Sbjct: 102 TGKIVV-MGGTEPGQ-STDAVAALLAERLGADLLINATNVDGVYSKDPRKDPDAKKFDRL 159 Query: 188 TYNQFIE--------KGLKV-MDCASVVLARDCSIPIIVFSIHSPGGIWGGLSGIGRSTI 238 + ++ I+ G D + + I IV P + L G TI Sbjct: 160 SADELIDIVGKSSWKAGSNEPFDPLAAKIIERSGIKTIVVDGRDPENLERALKGEFVGTI 219 Query: 239 I 239 I Sbjct: 220 I 220 >gnl|CDD|58599 cd02115, AAK, Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK). The AAK superfamily includes kinases that phosphorylate a variety of amino acid substrates. These kinases catalyze the formation of phosphoric anhydrides, generally with a carboxylate, and use ATP as the source of the phosphoryl group; are involved in amino acid biosynthesis. Some of these kinases control the process via allosteric feed-back inhibition.. Length = 248 Score = 73.5 bits (180), Expect = 5e-14 Identities = 52/256 (20%), Positives = 93/256 (36%), Gaps = 34/256 (13%) Query: 10 LLKVSGEALAGISGFGVDIDSVNRICADIAEVYAKGIEIGIVVGGGNIFRGSQVVAENYL 69 ++K G +++ + + + + ++ ++G + +V G G + L Sbjct: 1 VIKFGGSSVS-------SEERLRNLARILVKLASEGGRVVVVHGAGPQITDELLAHGELL 53 Query: 70 LCERS------TVDSMGMLSTVINALALDLALRKINVPTVILS---------SIFMPQVC 114 R D++ + ++ L + AL + + V L + Sbjct: 54 GYARGLRITDRETDALAAMGEGMSNLLIAAALEQHGIKAVPLDLTQAGFASPNQGHVGKI 113 Query: 115 EVFSCRNAVSYLSQGKVVIFSGGTG--------NAFLTTDSAAALRASEIGADVILKGTQ 166 S S L G + I SG G +DS AAL A+ + AD ++ T Sbjct: 114 TKVSTDRLKSLLENGILPILSGFGGTDEKETGTLGRGGSDSTAALLAAALKADRLVILTD 173 Query: 167 VDGVYSADPRVHASSTRFDSLTY---NQFIEKGLKVMDCASVVLARDCSIPIIVFSIHSP 223 VDGVY+ADPR + LTY + G V+ + A IP+ + + Sbjct: 174 VDGVYTADPRKVPDAKLLSELTYEEAAELAYAGAMVLKPKAADPAARAGIPVRIANT-EN 232 Query: 224 GGIWGGLSGIGRSTII 239 G + G T+I Sbjct: 233 PGALALFTPDGGGTLI 248 >gnl|CDD|58612 cd04246, AAK_AK-DapG-like, AAK_AK-DapG-like: Amino Acid Kinase Superfamily (AAK), AK-DapG-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional enzymes found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species, as well as, the catalytic AK domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related isoenzymes. In Bacillus subtilis, the regulation of the diaminopimelate-lysine biosynthetic pathway involves dual control by diaminopimelate and lysine, effected through separate diaminopimelate- and lysine-sensitive aspartokinase isoenzymes. The role of the AKI isoenzyme is most likely to provide a constant level of aspartyl-beta-phosphate for the biosynthesis of diaminopimelate for peptidoglycan synthesis and dipicolinate during sporulation. The B. subtilis 168 AKII is induced by methionine, and repressed and inhibited by lysine. In Corynebacterium glutamicum and other various Gram-positive bacteria, the DAP-lysine pathway is feedback regulated by the concerted action of lysine and threonine. Also included in this CD are the aspartokinases of the extreme thermophile, Thermus thermophilus HB27, the Gram-negative obligate methylotroph, Methylophilus methylotrophus AS1, and those single aspartokinase isoenzyme types found in Pseudomonas, C. glutamicum, and Amycolatopsis lactamdurans. The B. subtilis AKI is tetrameric consisting of two alpha and two beta subunits; the alpha (43 kD) and beta (17 kD) subunit formed by two in-phase overlapping genes. The alpha subunit contains the AK catalytic domain and two ACT domains. The beta subunit contains two ACT domains. The B. subtilis 168 AKII aspartokinase is also described as tetrameric consisting of two alpha and two beta subunits. Some archeal aspartokinases in this group lack recognizable ACT domains.. Length = 239 Score = 70.9 bits (174), Expect = 3e-13 Identities = 37/113 (32%), Positives = 58/113 (51%), Gaps = 12/113 (10%) Query: 124 SYLSQGKVVI---FSGGTGNAFLTT------DSAAALRASEIGADVILKGTQVDGVYSAD 174 L +G VV+ F G + +TT D+ A A+ + AD T VDGVY+AD Sbjct: 121 EALEEGDVVVVAGFQGVNEDGEITTLGRGGSDTTAVALAAALKADRCEIYTDVDGVYTAD 180 Query: 175 PRVHASSTRFDSLTYNQFIE---KGLKVMDCASVVLARDCSIPIIVFSIHSPG 224 PR+ + + D ++Y++ +E G KV+ SV LA+ ++P+ V S S Sbjct: 181 PRIVPKARKLDVISYDEMLEMASLGAKVLHPRSVELAKKYNVPLRVRSSFSEN 233 >gnl|CDD|58627 cd04261, AAK_AKii-LysC-BS, AAK_AKii-LysC-BS: Amino Acid Kinase Superfamily (AAK), AKii; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related sequences. In B. subtilis 168, the regulation of the diaminopimelate (Dap)-lysine biosynthetic pathway involves dual control by Dap and lysine, effected through separate Dap- and lysine-sensitive aspartokinase isoenzymes. The B. subtilis 168 AKII is induced by methionine, and repressed and inhibited by lysine. Although Corynebacterium glutamicum is known to contain a single aspartokinase isoenzyme type, both the succinylase and dehydrogenase variant pathways of DAP-lysine synthesis operate simultaneously in this organism. In this organism and other various Gram-positive bacteria, the DAP-lysine pathway is feedback regulated by the concerted action of lysine and theronine. Also included in this CD are the aspartokinases of the extreme thermophile, Thermus thermophilus HB27, the Gram-negative obligate methylotroph, Methylophilus methylotrophus AS1, and those single aspartokinases found in Pseudomons, C. glutamicum, and Amycolatopsis lactamdurans. B. subtilis 168 AKII, and the C. glutamicum, Streptomyces clavuligerus and A. lactamdurans aspartokinases are described as tetramers consisting of two alpha and two beta subunits; the alpha (44 kD) and beta (18 kD) subunits formed by two in-phase overlapping polypeptides.. Length = 239 Score = 68.6 bits (168), Expect = 1e-12 Identities = 39/113 (34%), Positives = 59/113 (52%), Gaps = 12/113 (10%) Query: 124 SYLSQGKVVI---FSGGTGNAFLTT------DSAAALRASEIGADVILKGTQVDGVYSAD 174 L +G VVI F G + +TT D++A A+ +GAD T VDGVY+AD Sbjct: 121 ELLEEGDVVIVAGFQGINEDGDITTLGRGGSDTSAVALAAALGADRCEIYTDVDGVYTAD 180 Query: 175 PRVHASSTRFDSLTYNQFIE---KGLKVMDCASVVLARDCSIPIIVFSIHSPG 224 PR+ + + D ++Y++ +E G KV+ SV LA+ +P+ V S S Sbjct: 181 PRIVPKARKLDEISYDEMLEMASLGAKVLHPRSVELAKKYGVPLRVLSSFSEE 233 >gnl|CDD|30873 COG0527, LysC, Aspartokinases [Amino acid transport and metabolism]. Length = 447 Score = 59.2 bits (143), Expect = 1e-09 Identities = 37/126 (29%), Positives = 61/126 (48%), Gaps = 12/126 (9%) Query: 112 QVCEVFSCRNAVSYLSQGKVVI---FSGGTGNAFLTT------DSAAALRASEIGADVIL 162 ++ + S R + L +GKV + F G + TT D +AA A+ +GAD + Sbjct: 157 RILDEDSERRLLRLLEEGKVPVVAGFQGINEDGETTTLGRGGSDYSAAALAAALGADEVE 216 Query: 163 KGTQVDGVYSADPRVHASSTRFDSLTYNQFIE---KGLKVMDCASVVLARDCSIPIIVFS 219 T VDGVY+ADPR+ + ++Y + +E G KV+ +V A IP+ + + Sbjct: 217 IWTDVDGVYTADPRIVPDARLLPEISYEEALELAYLGAKVLHPRAVEPAMRSGIPLRIKN 276 Query: 220 IHSPGG 225 +P Sbjct: 277 TFNPDA 282 >gnl|CDD|58600 cd04234, AAK_AK, AAK_AK: Amino Acid Kinase Superfamily (AAK), Aspartokinase (AK); this CD includes the N-terminal catalytic domain of aspartokinase (4-L-aspartate-4-phosphotransferase;). AK is the first enzyme in the biosynthetic pathway of the aspartate family of amino acids (lysine, threonine, methionine, and isoleucine) and the bacterial cell wall component, meso-diaminopimelate. It also catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP. One mechanism for the regulation of this pathway is by the production of several isoenzymes of aspartokinase with different repressors and allosteric inhibitors. Pairs of ACT domains are proposed to specifically bind amino acids leading to allosteric regulation of the enzyme. In Escherichia coli, three different aspartokinase isoenzymes are regulated specifically by lysine, methionine, and threonine. AK-HSDHI (ThrA) and AK-HSDHII (MetL) are bifunctional enzymes that consist of an N-terminal AK and a C-terminal homoserine dehydrogenase (HSDH). ThrA and MetL are involved in threonine and methionine biosynthesis, respectively. The third isoenzyme, AKIII (LysC), is monofunctional and is involved in lysine synthesis. The three Bacillus subtilis isoenzymes, AKI (DapG), AKII (LysC), and AKIII (YclM), are feedback-inhibited by meso-diaminopimelate, lysine, and lysine plus threonine, respectively. The E. coli lysine-sensitive AK is described as a homodimer, whereas, the B. subtilis lysine-sensitive AK is described as a heterodimeric complex of alpha- and beta- subunits that are formed from two in-frame overlapping genes. A single AK enzyme type has been described in Pseudomonas, Amycolatopsis, and Corynebacterium. The fungal aspartate pathway is regulated at the AK step, with L-Thr being an allosteric inhibitor of the Saccharomyces cerevisiae AK (Hom3). At least two distinct AK isoenzymes can occur in higher plants, one is a monofunctional lysine-sensitive isoenzyme, which is involved in the overall regulation of the pathway and can be synergistically inhibited by S-adenosylmethionine. The other isoenzyme is a bifunctional, threonine-sensitive AK-HSDH protein. Also included in this CD is the catalytic domain of the Methylomicrobium alcaliphilum ectoine AK, the first enzyme of the ectoine biosynthetic pathway, found in this bacterium, and several other halophilic/halotolerant bacteria.. Length = 227 Score = 58.6 bits (142), Expect = 2e-09 Identities = 36/109 (33%), Positives = 57/109 (52%), Gaps = 12/109 (11%) Query: 127 SQGKVVI---FSGGTGNAFLTT------DSAAALRASEIGADVILKGTQVDGVYSADPRV 177 GKV + F G + +TT D +AA A+ +GAD + T VDG+Y+ADPR+ Sbjct: 111 EIGKVPVVTGFIGRNEDGEITTLGRGGSDYSAAALAAALGADEVEIWTDVDGIYTADPRI 170 Query: 178 HASSTRFDSLTYNQFIE---KGLKVMDCASVVLARDCSIPIIVFSIHSP 223 + ++Y++ +E G KV+ +V AR +IPI V + +P Sbjct: 171 VPEARLIPEISYDEALELAYFGAKVLHPRAVEPARKANIPIRVKNTFNP 219 >gnl|CDD|58626 cd04260, AAK_AKi-DapG-BS, AAK_AKi-DapG-BS: Amino Acid Kinase Superfamily (AAK), AKi-DapG; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional class enzyme found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species. In Bacillus subtilis, the regulation of the diaminopimelate-lysine biosynthetic pathway involves dual control by diaminopimelate and lysine, effected through separate diaminopimelate- and lysine-sensitive aspartokinase isoenzymes. AKI activity is invariant during the exponential and stationary phases of growth and is not altered by addition of amino acids to the growth medium. The role of this isoenzyme is most likely to provide a constant level of aspartyl-beta-phosphate for the biosynthesis of diaminopimelate for peptidoglycan synthesis and dipicolinate during sporulation. The B. subtilis AKI is tetrameric consisting of two alpha and two beta subunits; the alpha (43 kD) and beta (17 kD) subunit formed by two in-phase overlapping genes. The alpha subunit contains the AK catalytic domain and two ACT domains. The beta subunit contains two ACT domains.. Length = 244 Score = 53.4 bits (128), Expect = 6e-08 Identities = 37/112 (33%), Positives = 58/112 (51%), Gaps = 12/112 (10%) Query: 124 SYLSQGKVVI---FSGGTGNAFLTT------DSAAALRASEIGADVILKGTQVDGVYSAD 174 S L +G VV+ F G T + +TT D+ AA + + A+ + T VDG+ +AD Sbjct: 126 SALKEGDVVVVAGFQGVTEDGEVTTLGRGGSDTTAAALGAALNAEYVEIYTDVDGIMTAD 185 Query: 175 PRVHASSTRFDSLTYN---QFIEKGLKVMDCASVVLARDCSIPIIVFSIHSP 223 PRV ++ D ++YN Q +G KV+ +V +A +IPI + S S Sbjct: 186 PRVVPNARILDVVSYNEVFQMAHQGAKVIHPRAVEIAMQANIPIRIRSTMSE 237 >gnl|CDD|58609 cd04243, AAK_AK-HSDH-like, AAK_AK-HSDH-like: Amino Acid Kinase Superfamily (AAK), AK-HSDH-like; this family includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK- homoserine dehydrogenase (HSDH). These aspartokinases are found in such bacteria as E. coli (AKI-HSDHI, ThrA and AKII-HSDHII, MetL) and in higher plants (Z. mays AK-HSDH). AK and HSDH are the first and third enzymes in the biosynthetic pathway of the aspartate family of amino acids. AK catalyzes the phosphorylation of Asp to P-aspartyl phosphate. HSDH catalyzes the NADPH-dependent conversion of Asp 3-semialdehyde to homoserine. ThrA and MetL are involved in threonine and methionine biosynthesis, respectively. In E. coli, ThrA is subject to allosteric regulation by the end product L-threonine and the native enzyme is reported to be tetrameric. As with bacteria, plant AK and HSDH are feedback inhibited by pathway end products. Maize AK-HSDH is a Thr-sensitive 180-kD enzyme. Arabidopsis AK-HSDH is an alanine-activated, threonine-sensitive enzyme whose ACT domains, located C-terminal to the AK catalytic domain, were shown to be involved in allosteric activation. Also included in this CD is the catalytic domain of the aspartokinase (AK) of the lysine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme (LysC) found in some bacteria such as E. coli. In E. coli, LysC is reported to be a homodimer of 50 kD subunits. Also included in this CD is the catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK - DAP decarboxylase (DapDC) found in some bacteria. DapDC, which is the lysA gene product, catalyzes the decarboxylation of DAP to lysine.. Length = 293 Score = 49.8 bits (119), Expect = 7e-07 Identities = 34/109 (31%), Positives = 54/109 (49%), Gaps = 12/109 (11%) Query: 127 SQGKVVI---FSGGTGNAFLTT------DSAAALRASEIGADVILKGTQVDGVYSADPRV 177 GKVV+ F + TT D +AAL A+ + A+ + T VDGVY+ADPR Sbjct: 177 EHGKVVVTQGFIASNEDGETTTLGRGGSDYSAALLAALLDAEEVEIWTDVDGVYTADPRK 236 Query: 178 HASSTRFDSLTYNQFIEK---GLKVMDCASVVLARDCSIPIIVFSIHSP 223 + L+Y++ +E G KV+ ++ A +IPI + + +P Sbjct: 237 VPDARLLKELSYDEAMELAYFGAKVLHPRTIQPAIRKNIPIFIKNTFNP 285 >gnl|CDD|58624 cd04258, AAK_AKiii-LysC-EC, AAK_AKiii-LysC-EC: Amino Acid Kinase Superfamily (AAK), AKiii-LysC-EC: this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKIII. AKIII is a monofunctional class enzyme (LysC) found in some bacteria such as E. coli. Aspartokinase is the first enzyme in the aspartate metabolic pathway and catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP. In E. coli, LysC is reported to be a homodimer of 50 kD subunits.. Length = 292 Score = 49.5 bits (118), Expect = 8e-07 Identities = 44/168 (26%), Positives = 76/168 (45%), Gaps = 22/168 (13%) Query: 82 LSTVINALAL---DLALRKINVPTVILS-SIF---MPQVCEVF-SCRNAVSYLSQGKVVI 133 +S+++ + AL + +V TV+ + S F P + + + L G VV+ Sbjct: 123 MSSLLFSEALREQGVPAEWFDVRTVLRTDSRFGRAAPDLNALAELAAKLLKPLLAGTVVV 182 Query: 134 ---FSGGTGNAFLTT------DSAAALRASEIGADVILKGTQVDGVYSADPRVHASSTRF 184 F G T TT D +AAL A + A+ + T V G+Y+ DPR+ ++ Sbjct: 183 TQGFIGSTEKGRTTTLGRGGSDYSAALLAEALHAEELQIWTDVAGIYTTDPRICPAARAI 242 Query: 185 DSLTYNQFIEK---GLKVMDCASVVLARDCSIPIIVFSIHSP--GGIW 227 +++ + E G KV+ A+++ A +IP+ V S P GG Sbjct: 243 KEISFAEAAEMATFGAKVLHPATLLPAIRKNIPVFVGSSKDPEAGGTL 290 >gnl|CDD|58623 cd04257, AAK_AK-HSDH, AAK_AK-HSDH: Amino Acid Kinase Superfamily (AAK), AK-HSDH; this CD includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK - homoserine dehydrogenase (HSDH). These aspartokinases are found in bacteria (E. coli AKI-HSDHI, ThrA and E. coli AKII-HSDHII, MetL) and higher plants (Z. mays AK-HSDH). AK and HSDH are the first and third enzymes in the biosynthetic pathway of the aspartate family of amino acids. AK catalyzes the phosphorylation of Asp to P-aspartyl phosphate. HSDH catalyzes the NADPH-dependent conversion of Asp 3-semialdehyde to homoserine. ThrA and MetL are involved in threonine and methionine biosynthesis, respectively. In E. coli, ThrA is subject to allosteric regulation by the end product L-threonine and the native enzyme is reported to be tetrameric. As with bacteria, plant AK and HSDH are feedback inhibited by pathway end products. Maize AK-HSDH is a Thr-sensitive 180-kD enzyme. Arabidopsis AK-HSDH is an alanine-activated, threonine-sensitive enzyme whose ACT domains, located C-terminal to the AK catalytic domain, were shown to be involved in allosteric activation.. Length = 294 Score = 47.5 bits (113), Expect = 4e-06 Identities = 35/111 (31%), Positives = 55/111 (49%), Gaps = 12/111 (10%) Query: 125 YLSQGKVVI---FSGGTGNAFLTT------DSAAALRASEIGADVILKGTQVDGVYSADP 175 + S GKV++ F TT D +AA+ A+ + AD + T VDGVYSADP Sbjct: 176 FSSNGKVIVVTGFIASNPQGETTTLGRNGSDYSAAILAALLDADQVEIWTDVDGVYSADP 235 Query: 176 RVHASSTRFDSLTYNQFIEK---GLKVMDCASVVLARDCSIPIIVFSIHSP 223 R + SL+Y + +E G KV+ ++ +IPI++ + +P Sbjct: 236 RKVKDARLLPSLSYQEAMELSYFGAKVLHPKTIQPVAKKNIPILIKNTFNP 286 >gnl|CDD|58610 cd04244, AAK_AK-LysC-like, AAK_AK-LysC-like: Amino Acid Kinase Superfamily (AAK), AK-LysC-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive AK isoenzyme found in higher plants. The lysine-sensitive AK isoenzyme is a monofunctional protein. It is involved in the overall regulation of the aspartate pathway and can be synergistically inhibited by S-adenosylmethionine. Also included in this CD is an uncharacterized LysC-like AK found in Euryarchaeota and some bacteria. AK catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP.. Length = 298 Score = 45.3 bits (107), Expect = 1e-05 Identities = 30/99 (30%), Positives = 48/99 (48%), Gaps = 9/99 (9%) Query: 134 FSGGTGNAFLTT------DSAAALRASEIGADVILKGTQVDGVYSADPRVHASSTRFDSL 187 F G T + +TT D +A + + + AD I VDGV +ADPR+ + L Sbjct: 192 FIGATEDGAITTLGRGGSDYSATIIGAALDADEIWIWKDVDGVMTADPRIVPEARTIPRL 251 Query: 188 TYNQFIEK---GLKVMDCASVVLARDCSIPIIVFSIHSP 223 +Y + +E G KV+ +V A + IP+ V + +P Sbjct: 252 SYAEAMELAYFGAKVLHPRTVEPAMEKGIPVRVKNTFNP 290 >gnl|CDD|58611 cd04245, AAK_AKiii-YclM-BS, AAK_AKiii-YclM-BS: Amino Acid Kinase Superfamily (AAK), AKiii-YclM-BS; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme found in Bacilli (Bacillus subtilis YclM) and Clostridia species. Aspartokinase is the first enzyme in the aspartate metabolic pathway and catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP. In Bacillus subtilis (BS), YclM is reported to be a single polypeptide of 50 kD. The Bacillus subtilis 168 AKIII is induced by lysine and repressed by threonine, and it is synergistically inhibited by lysine and threonine.. Length = 288 Score = 44.5 bits (105), Expect = 2e-05 Identities = 29/102 (28%), Positives = 47/102 (46%), Gaps = 9/102 (8%) Query: 125 YLSQGKVVIFSGGTGNAFLTTDSAAALRASEIGADVILKGTQVDGVYSADPRVHASSTRF 184 Y G + FS G +D A+ A AD+ T VDG+Y+A+PR+ A+ Sbjct: 185 YSKNGDIKTFSRGG------SDITGAILARGFQADLYENFTDVDGIYAANPRIVANPKPI 238 Query: 185 DSLTYNQFIE---KGLKVMDCASVVLARDCSIPIIVFSIHSP 223 +TY + E G V +++ A + IPI + + + P Sbjct: 239 SEMTYREMRELSYAGFSVFHDEALIPAIEAGIPINIKNTNHP 280 >gnl|CDD|35677 KOG0456, KOG0456, KOG0456, Aspartate kinase [Amino acid transport and metabolism]. Length = 559 Score = 43.1 bits (101), Expect = 8e-05 Identities = 24/84 (28%), Positives = 41/84 (48%), Gaps = 3/84 (3%) Query: 145 TDSAAALRASEIGADVILKGTQVDGVYSADPRVHASSTRFDSLTYNQFIE---KGLKVMD 201 +D A +G D I VDGV + DPR++ + LT+++ E G +V+ Sbjct: 285 SDLTATTIGKALGLDEIQVWKDVDGVLTCDPRIYPGARLVPYLTFDEAAELAYFGAQVLH 344 Query: 202 CASVVLARDCSIPIIVFSIHSPGG 225 S+ AR+ IP+ V + ++P Sbjct: 345 PFSMRPAREGRIPVRVKNSYNPTA 368 >gnl|CDD|58625 cd04259, AAK_AK-DapDC, AAK_AK-DapDC: Amino Acid Kinase Superfamily (AAK), AK-DapDC; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the bifunctional enzyme AK - DAP decarboxylase (DapDC) found in some bacteria. Aspartokinase is the first enzyme in the aspartate metabolic pathway, catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP. DapDC, which is the lysA gene product, catalyzes the decarboxylation of DAP to lysine.. Length = 295 Score = 41.9 bits (98), Expect = 1e-04 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 3/82 (3%) Query: 145 TDSAAALRASEIGADVILKGTQVDGVYSADPRVHASSTRFDSLTYNQFIE---KGLKVMD 201 +D++AA A+++ A T V G+++A+P + L Y++ E G KV+ Sbjct: 206 SDTSAAYFAAKLQAARCEIWTDVPGLFTANPHEVPHARLLKRLDYDEAQEIATMGAKVLH 265 Query: 202 CASVVLARDCSIPIIVFSIHSP 223 + AR +IP++V S P Sbjct: 266 PRCIPPARRANIPMVVRSTERP 287 >gnl|CDD|30612 COG0263, ProB, Glutamate 5-kinase [Amino acid transport and metabolism]. Length = 369 Score = 38.7 bits (90), Expect = 0.002 Identities = 42/193 (21%), Positives = 84/193 (43%), Gaps = 12/193 (6%) Query: 5 PYKRVLLKVSGEALAGISGFGVDIDSVNRICADIAEVYAKGIEIGIVVGGGNIFRGSQVV 64 +R+++K+ +L +G G+D + + +A ++ G E+ ++V G I G + Sbjct: 5 SARRIVVKIGSSSLTDGTG-GLDRSKLEELVRQVAALHKAGHEV-VLVSSGAIAAGRTRL 62 Query: 65 ---AENYLLCERSTVDSMGMLSTVINALALDLALRKINVPTVILSSIFMPQVCEVFSCRN 121 L E+ ++G ++ A I V ++L+ + RN Sbjct: 63 GLPKRPKTLAEKQAAAAVGQ-VRLMQLYEELFARYGIKVGQILLTRDDFSDRRRYLNARN 121 Query: 122 AVSYLSQGKVV-IFSGGTGNA-----FLTTDSAAALRASEIGADVILKGTQVDGVYSADP 175 +S L + VV I + A F D+ +AL A +GAD+++ + +DG+Y A+P Sbjct: 122 TLSALLELGVVPIINENDTVATEEIKFGDNDTLSALVAILVGADLLVLLSDIDGLYDANP 181 Query: 176 RVHASSTRFDSLT 188 R + + + Sbjct: 182 RTNPDAKLIPEVE 194 >gnl|CDD|31796 COG1608, COG1608, Predicted archaeal kinase [General function prediction only]. Length = 252 Score = 37.2 bits (86), Expect = 0.004 Identities = 55/255 (21%), Positives = 93/255 (36%), Gaps = 27/255 (10%) Query: 9 VLLKVSGEALAGISGFG-VDIDSVNRICADIAEVYAKGIEIGIVVGGGNIFRGSQVVAEN 67 ++LK+ G + V D + RI +I+ E IVV GG F G E Sbjct: 3 IILKLGGSVITDKDKPRTVREDRLRRIAREIS---NGKPEKLIVVHGGGSF-GHPAAKEF 58 Query: 68 YLLCERSTVDSMGMLSTVINALALDLALRKINVPTVILSSIFMPQVCEVFSCRNAVSY-- 125 L ++ + +G T + L L+ + + + + +P F+ R +Y Sbjct: 59 GLEGLKNYLSPLGFSLTHLAMLELNSIVVDALLDAGVRAVSVVPISFSTFNGRILYTYLE 118 Query: 126 -----LSQGKV------VIFSGGTGNAFLTTDSAAALRASEIGADVILKGTQVDGVYSAD 174 L +G V V+ G ++ D A E+ D ++ T VDGVY D Sbjct: 119 AIKDALEKGFVPVLYGDVVPDDDNGYEIISGDDIVLHLAKELKPDRVIFLTDVDGVYDRD 178 Query: 175 PRVHASSTRFDSLTYNQFIEK--------GLKVMDCASVVLARDCSIPIIVFSIHSPGGI 226 P + + + G+ A + +AR + +F+ + P I Sbjct: 179 PGKVPDARLLSEIEGRVALGGSGGTDVTGGIAKKLEALLEIARYGK-EVYIFNGNKPENI 237 Query: 227 WGGLSGIGRSTIISG 241 + L G T I G Sbjct: 238 YRALRGENVGTRIDG 252 >gnl|CDD|58608 cd04242, AAK_G5K_ProB, AAK_G5K_ProB: Glutamate-5-kinase (G5K) catalyzes glutamate-dependent ATP cleavage; G5K transfers the terminal phosphoryl group of ATP to the gamma-carboxyl group of glutamate, in the first and controlling step of proline (and, in mammals, ornithine) biosynthesis. G5K is subject to feedback allosteric inhibition by proline or ornithine. In microorganisms and plants, proline plays an important role as an osmoprotectant and, in mammals, ornithine biosynthesis is crucial for proper ammonia detoxification, since a G5K mutation has been shown to cause human hyperammonaemia. Microbial G5K generally consists of two domains: a catalytic G5K domain and one PUA (pseudo uridine synthases and archaeosine-specific transglycosylases) domain, and some lack the PUA domain. G5K requires free Mg for activity, it is tetrameric, and it aggregates to higher forms in a proline-dependent way. G5K lacking the PUA domain remains tetrameric, active, and proline-inhibitable, but the Mg requirement and the proline-triggered aggregation are greatly diminished and abolished, respectively, and more proline is needed for inhibition. Although plant and animal G5Ks are part of a bifunctional polypeptide, delta 1-pyrroline-5-carboxylate synthetase (P5CS), composed of an N-terminal G5K (ProB) and a C-terminal glutamyl 5- phosphate reductase (G5PR; ProA); bacterial and yeast G5Ks are monofunctional single-polypeptide enzymes. In this CD, all three domain architectures are present: G5K, G5K+PUA, and G5K+G5PR.. Length = 251 Score = 36.6 bits (85), Expect = 0.006 Identities = 12/40 (30%), Positives = 22/40 (55%) Query: 146 DSAAALRASEIGADVILKGTQVDGVYSADPRVHASSTRFD 185 D +AL A + AD+++ + VDG+Y +PR + + Sbjct: 145 DRLSALVAGLVNADLLILLSDVDGLYDKNPRENPDAKLIP 184 Score = 26.2 bits (58), Expect = 7.5 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Query: 8 RVLLKVSGEALAGISGFGVDIDSVNRICADIAEVYAKGIEIGIVVGG 54 R+++KV L G G+D+ + + IAE+ +G E+ +V G Sbjct: 1 RIVVKVGSSLLTDEDG-GLDLGRLASLVEQIAELRNQGKEVILVSSG 46 >gnl|CDD|30895 COG0549, ArcC, Carbamate kinase [Amino acid transport and metabolism]. Length = 312 Score = 36.4 bits (84), Expect = 0.007 Identities = 22/59 (37%), Positives = 29/59 (49%), Gaps = 13/59 (22%) Query: 126 LSQGKVVIFSGGTG-------------NAFLTTDSAAALRASEIGADVILKGTQVDGVY 171 L G VVI +GG G A + D A+AL A +I AD+++ T VD VY Sbjct: 181 LESGHVVIAAGGGGIPVVEEGAGLQGVEAVIDKDLASALLAEQIDADLLIILTDVDAVY 239 >gnl|CDD|58621 cd04255, AAK_UMPK-MosAB, AAK_UMPK-MosAB: This CD includes the alpha and beta subunits of the Mo storage protein (MosA and MosB) which are related to uridine monophosphate kinase (UMPK) enzymes that catalyze the phosphorylation of UMP by ATP, yielding UDP, and playing a key role in pyrimidine nucleotide biosynthesis. The Mo storage protein from the nitrogen-fixing bacterium, Azotobacter vinelandii, is characterized as an alpha4-beta4 octamer containing a polynuclear molybdenum-oxide cluster which is ATP-dependent to bind Mo and pH-dependent to release Mo. These and related bacterial sequences in this CD are members of the Amino Acid Kinase Superfamily (AAK).. Length = 262 Score = 36.4 bits (84), Expect = 0.007 Identities = 28/131 (21%), Positives = 51/131 (38%), Gaps = 16/131 (12%) Query: 125 YLSQGKVVIFSGGTGNAFLT------------TDSAAALRASEIGADVILKGTQVDGVYS 172 +L G+ + SG TD A L A IGA ++ DG+Y+ Sbjct: 131 FLKAGRAPVISGMPPYGLWEHPAEEGRIPPHRTDVGAFLLAEVIGARNLIFVKDEDGLYT 190 Query: 173 ADPRVHASSTRFDSLTYNQFIEKGLK--VMD--CASVVLARDCSIPIIVFSIHSPGGIWG 228 ADP+ + + ++ + ++K L V++ ++ + + + PG + Sbjct: 191 ADPKKNKKAEFIPEISAAELLKKDLDDLVLERPVLDLLQNARHVKEVQIVNGLVPGNLTR 250 Query: 229 GLSGIGRSTII 239 L G TII Sbjct: 251 ALRGEHVGTII 261 >gnl|CDD|58601 cd04235, AAK_CK, AAK_CK: Carbamate kinase (CK) catalyzes both the ATP-phosphorylation of carbamate and carbamoyl phosphate (CP) utilization with the production of ATP from ADP and CP. Both CK (this CD) and nonhomologous CP synthetase synthesize carbamoyl phosphate, an essential precursor of arginine and pyrimidine bases, in the presence of ATP, bicarbonate, and ammonia. CK is a homodimer of 33 kDa subunits and is a member of the Amino Acid Kinase Superfamily (AAK).. Length = 308 Score = 35.9 bits (83), Expect = 0.012 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 13/59 (22%) Query: 126 LSQGKVVIFSGGTG-------------NAFLTTDSAAALRASEIGADVILKGTQVDGVY 171 + G +VI +GG G A + D A+AL A EI AD+++ T VD VY Sbjct: 178 VDNGVIVIAAGGGGIPVVREGGGLKGVEAVIDKDLASALLAEEINADLLVILTDVDNVY 236 >gnl|CDD|58607 cd04241, AAK_FomA-like, AAK_FomA-like: This CD includes a fosfomycin biosynthetic gene product, FomA, and similar proteins found in a wide range of organisms. Together, the fomA and fomB genes in the fosfomycin biosynthetic gene cluster of Streptomyces wedmorensis confer high-level fosfomycin resistance. FomA and FomB proteins converted fosfomycin to fosfomycin monophosphate and fosfomycin diphosphate in the presence of ATP and a magnesium ion, indicating that FomA and FomB catalyzed phosphorylations of fosfomycin and fosfomycin monophosphate, respectively. FomA and related sequences in this CD are members of the Amino Acid Kinase Superfamily (AAK).. Length = 252 Score = 35.2 bits (81), Expect = 0.016 Identities = 53/261 (20%), Positives = 94/261 (36%), Gaps = 38/261 (14%) Query: 8 RVLLKVSGEALAGIS-GFGVDIDSVNRICADIAEVYAKGIEIGIVVGGGNIFRGSQVVAE 66 ++LK+ G + + +++ RI ++AE A ++ +V GGG+ G E Sbjct: 1 MIILKLGGSVITDKDRPETIREENLERIARELAE--AIDEKLVLVHGGGSF--GHPKAKE 56 Query: 67 NYLLCERSTVDSMGMLSTVINALALDL----ALRKINVPTVIL--SSIFMPQVCEVFSCR 120 L + + G+ T L L+ AL + VP V + SS F+ + + S Sbjct: 57 YGLPDGDGSFSAEGVAETHEAMLELNSIVVDALLEAGVPAVSVPPSSFFVTENGRIVSFD 116 Query: 121 NAV--SYLSQGKV------VIFSGGTGNAFLTTDSAAALRASEIGADVILKGTQVDGVYS 172 V L +G V V+ G G L+ D A + + ++ T VDGVY Sbjct: 117 LEVIKELLDRGFVPVLHGDVVLDEGGGITILSGDDIVVELAKALKPERVIFLTDVDGVYD 176 Query: 173 ADP-------RVHASSTRFDSLTYNQF-------IEKGLKVMDCASVVLARDCSIPIIVF 218 P + S + ++ + + I + +F Sbjct: 177 KPPPDAKLIPEIDVGSLEDILAALGSAGTDVTGGMAGKIEEL-----LELARRGIEVYIF 231 Query: 219 SIHSPGGIWGGLSGIGRSTII 239 + P ++ L G T I Sbjct: 232 NGDKPENLYRALLGNFIGTRI 252 >gnl|CDD|58606 cd04240, AAK_UC, AAK_UC: Uncharacterized (UC) amino acid kinase-like proteins found mainly in archaea and a few bacteria. Sequences in this CD are members of the Amino Acid Kinase (AAK) superfamily.. Length = 203 Score = 32.6 bits (74), Expect = 0.11 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 4/47 (8%) Query: 144 TTDSAAALRASEIGADVILKGTQVDGVYSADPR----VHASSTRFDS 186 T+DS AA A ++GA ++ T VDG+Y D + + A+ ++ Sbjct: 115 TSDSIAAWLAKKLGAKRLVIVTDVDGIYEKDGKLVNEIAAAELLGET 161 >gnl|CDD|58622 cd04256, AAK_P5CS_ProBA, AAK_P5CS_ProBA: Glutamate-5-kinase (G5K) domain of the bifunctional delta 1-pyrroline-5-carboxylate synthetase (P5CS), composed of an N-terminal G5K (ProB) and a C-terminal glutamyl 5- phosphate reductase (G5PR, ProA), the first and second enzyme catalyzing proline (and, in mammals, ornithine) biosynthesis. G5K transfers the terminal phosphoryl group of ATP to the gamma-carboxyl group of glutamate, and is subject to feedback allosteric inhibition by proline or ornithine. In plants, proline plays an important role as an osmoprotectant and, in mammals, ornithine biosynthesis is crucial for proper ammonia detoxification, since a G5K mutation has been shown to cause human hyperammonaemia.. Length = 284 Score = 31.4 bits (71), Expect = 0.24 Identities = 13/31 (41%), Positives = 19/31 (61%) Query: 146 DSAAALRASEIGADVILKGTQVDGVYSADPR 176 DS AA A E+ AD+++ + VDG+Y P Sbjct: 181 DSLAARLAVELKADLLILLSDVDGLYDGPPG 211 >gnl|CDD|58613 cd04247, AAK_AK-Hom3, AAK_AK-Hom3: Amino Acid Kinase Superfamily (AAK), AK-Hom3; this CD includes the N-terminal catalytic domain of the aspartokinase HOM3, a monofunctional class enzyme found in Saccharomyces cerevisiae and other related AK domains. Aspartokinase, the first enzyme in the aspartate metabolic pathway, catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP, and in fungi, is responsible for the production of threonine, isoleucine and methionine. S. cerevisiae has a single aspartokinase isoenzyme type, which is regulated by feedback, allosteric inhibition by L-threonine. Recent studies show that the allosteric transition triggered by binding of threonine to AK involves a large change in the conformation of the native hexameric enzyme that is converted to an inactive one of different shape and substantially smaller hydrodynamic size.. Length = 306 Score = 31.1 bits (70), Expect = 0.26 Identities = 17/44 (38%), Positives = 26/44 (59%) Query: 145 TDSAAALRASEIGADVILKGTQVDGVYSADPRVHASSTRFDSLT 188 TD AAL A + AD + +VDG+++ADPR ++ S+T Sbjct: 215 TDLCAALCAVGLNADELQIWKEVDGIFTADPRKVPTARLLPSIT 258 >gnl|CDD|32237 COG2054, COG2054, Uncharacterized archaeal kinase related to aspartokinases, uridylate kinases [General function prediction only]. Length = 212 Score = 30.7 bits (69), Expect = 0.34 Identities = 14/33 (42%), Positives = 22/33 (66%) Query: 143 LTTDSAAALRASEIGADVILKGTQVDGVYSADP 175 +T+DS + A++ GA ++K T VDG+Y DP Sbjct: 116 VTSDSISVWIAAKAGATEVVKATDVDGIYEEDP 148 >gnl|CDD|147361 pfam05141, DIT1_PvcA, Pyoverdine/dityrosine biosynthesis protein. This family includes DIT1 that is involved in synthesising dityrosine. Dityrosine is a sporulation-specific component of the yeast ascospore wall that is essential for the resistance of the spores to adverse environmental conditions. Pseudomonas aeruginosa PvcA is involved in the biosynthesis of pyoverdine. Length = 274 Score = 30.7 bits (70), Expect = 0.35 Identities = 12/37 (32%), Positives = 17/37 (45%), Gaps = 8/37 (21%) Query: 15 GEALAGISGFGVDIDSVNRICADIAEVYAKGIEIGIV 51 E LA ++ +N +C I VY G +I IV Sbjct: 37 AEELA--------LERLNGLCERIQAVYPPGAKITIV 65 >gnl|CDD|36369 KOG1154, KOG1154, KOG1154, Gamma-glutamyl kinase [Amino acid transport and metabolism]. Length = 285 Score = 30.3 bits (68), Expect = 0.43 Identities = 14/30 (46%), Positives = 22/30 (73%) Query: 146 DSAAALRASEIGADVILKGTQVDGVYSADP 175 DS AA+ A+EI AD+++ + VDG+Y+ P Sbjct: 170 DSLAAILAAEIKADLLILLSDVDGLYTGPP 199 >gnl|CDD|145897 pfam02989, DUF228, Lyme disease proteins of unknown function. Length = 184 Score = 28.0 bits (62), Expect = 2.5 Identities = 33/113 (29%), Positives = 46/113 (40%), Gaps = 8/113 (7%) Query: 2 SDFPYKR-VLLKVSGEALAGISGFGVDIDSVNRICADIAEVYAKGIEIGIVVG--GGNIF 58 FPYKR V L V L +G G D+ V C DI E + I G + Sbjct: 68 KGFPYKRGVKLVVKETELQVEAGGGDDLYGV---CVDIDEFSKTATVVPITNNFEGYLVA 124 Query: 59 RGSQVVAENYLLCERSTV--DSMGMLSTVINALALDLALRKINVPTVILSSIF 109 + + A + L + V G T INA+AL AL N ++ ++F Sbjct: 125 KNKSIKAGDKLDFNKDGVLEKVTGANKTTINAIALSDALEISNDVFLVKVAVF 177 >gnl|CDD|36660 KOG1447, KOG1447, KOG1447, GTP-specific succinyl-CoA synthetase, beta subunit [Energy production and conversion]. Length = 412 Score = 27.7 bits (61), Expect = 2.8 Identities = 22/94 (23%), Positives = 41/94 (43%), Gaps = 16/94 (17%) Query: 128 QGKVVIFSGGTGNAFLTTDSAAALRASE--IGADVILKGTQVDGVYSADPRVHASSTRFD 185 +GK V +G G +T D L+ ++ IG + K T +GV + + A + Sbjct: 73 RGKGVFNNGLKGGVHITKDKNVVLQLAKQMIGYRLATKQTPKEGV-KVNKVMVAEALDIS 131 Query: 186 SLTYNQFIEKGLKVMDCASVVLARDCSIPIIVFS 219 TY ++++ R+C+ P++V S Sbjct: 132 RETY-------------LAILMDRECNGPVLVAS 152 >gnl|CDD|111283 pfam02374, ArsA_ATPase, Anion-transporting ATPase. This Pfam family represents a conserved domain, which is sometimes repeated, in an anion-transporting ATPase. The ATPase is involved in the removal of arsenate, antimonite, and arsenate from the cell. Length = 304 Score = 26.9 bits (60), Expect = 4.5 Identities = 22/55 (40%), Positives = 26/55 (47%), Gaps = 10/55 (18%) Query: 132 VIFSGGTGNAFLTTDSAA-ALRASEIGADVILKGTQVDGVYSADPRVHASSTRFD 185 IF GG G TT S A A+R SE G V+L S DP H+ S F+ Sbjct: 3 WIFFGGKGGVGKTTVSCATAVRLSEQGKKVLL--------VSTDP-AHSLSDSFN 48 >gnl|CDD|73214 cd00550, ArsA_ATPase, Oxyanion-translocating ATPase (ArsA). This ATPase is involved in transport of arsenite, antimonite or other oxyanions across biological membranes in all three kingdoms of life. ArsA contains a highly conserved AAA motif present in the AAA+ ATPase superfamily associated with a variety of cellular activities. To form a functional ATP-driven pump, ArsA interacts with the permease ArsB, which is a channel-forming integral membrane protein. One of the most interesting features of ArsA is the allosteric activation by its transport substrates. A divalent cation, typically Mg2+, is required for its enzymatic activity.. Length = 254 Score = 26.8 bits (59), Expect = 6.1 Identities = 17/35 (48%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Query: 132 VIFSGGTGNAFLTTDSAA-ALRASEIGADVILKGT 165 IF GG G TT SAA A+R +E G V+L T Sbjct: 2 YIFFGGKGGVGKTTISAATAVRLAEQGKKVLLVST 36 >gnl|CDD|32379 COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]. Length = 211 Score = 26.5 bits (58), Expect = 6.4 Identities = 26/98 (26%), Positives = 39/98 (39%), Gaps = 10/98 (10%) Query: 90 ALDLALRKINVPTVILSSIFMPQVCEVFSCRNAVSYLSQGKVVIFSGGTGNAFLTTDSAA 149 ALDLA P V+L + MP + + + + + KVV+ + D A Sbjct: 38 ALDLAREL--KPDVVLLDLSMPGMDGLEALKQLRARGPDIKVVVLTAH-------DDPAY 88 Query: 150 ALRASEIGAD-VILKGTQVDGVYSADPRVHASSTRFDS 186 +RA GAD +LK + + A V A T Sbjct: 89 VIRALRAGADGYLLKDASPEELVEAIRAVAAGGTYLPP 126 >gnl|CDD|58617 cd04251, AAK_NAGK-UC, AAK_NAGK-UC: N-Acetyl-L-glutamate kinase - uncharacterized (NAGK-UC). This domain is similar to Escherichia coli and Pseudomonas aeruginosa NAGKs which catalyze the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of microbial arginine biosynthesis. These uncharacterized domain sequences are found in some bacteria (Deinococci and Chloroflexi) and archea and belong to the Amino Acid Kinase Superfamily (AAK).. Length = 257 Score = 26.4 bits (58), Expect = 6.6 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Query: 146 DSAAALRASEIGADVILKGTQVDGVYSADPRVHASSTRFDSLTYNQFIEKGLK 198 D AAA A+ + A+ ++ T V+G+Y D RV T D+ + + G+K Sbjct: 167 DRAAAAIAAALKAERLILLTDVEGLY-LDGRVIERITVSDAESLLEKAGGGMK 218 >gnl|CDD|34452 COG4843, COG4843, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 179 Score = 26.4 bits (58), Expect = 8.1 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Query: 16 EALAGISGFGVDIDSVNRICADIAEVYAKGIEIGIVVG 53 E + + G + +D+++ I IA YA G IGI+VG Sbjct: 44 EMIVYVVGLSLVLDNLDNIANVIA--YAVGFGIGIIVG 79 >gnl|CDD|147169 pfam04869, Uso1_p115_head, Uso1 / p115 like vesicle tethering protein, head region. Also known as General vesicular transport factor, Transcytosis associated protein (TAP) and Vesicle docking protein, this myosin-shaped molecule consists of an N-terminal globular head region, a coiled-coil tail which mediates dimerization, and a short C-terminal acidic region. p115 tethers COP1 vesicles to the Golgi by binding the coiled coil proteins giantin (on the vesicles) and GM130 (on the Golgi), via its C-terminal acidic region. It is required for intercisternal transport in the golgi stack. This family consists of part of the head region. The head region is highly conserved, but its function is unknown. It does not seem to be essential for vesicle tethering. The N-terminal part of the head region, not within this family, contains context-detected Armadillo/beta-catenin-like repeats (pfam00514). Length = 306 Score = 26.1 bits (58), Expect = 8.4 Identities = 6/30 (20%), Positives = 11/30 (36%) Query: 97 KINVPTVILSSIFMPQVCEVFSCRNAVSYL 126 + V +L+ + + F R A Y Sbjct: 30 PVPVIVALLNWMLNENSVQPFDLRCAALYC 59 >gnl|CDD|143509 cd06842, PLPDE_III_Y4yA_like, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Y4yA. This subfamily is composed of the hypothetical Rhizobium sp. protein Y4yA and similar uncharacterized bacterial proteins. These proteins are homologous to eukaryotic ornithine decarboxylase (ODC) and diaminopimelate decarboxylase (DapDC). ODC and DapDC are fold type III PLP-dependent enzymes that contain an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain, similar to bacterial alanine racemases. ODC participates in the formation of putrescine by catalyzing the decarboxylation of ornithine, the first step in polyamine biosynthesis. DapDC participates in the last step of lysine biosynthesis, the conversion of meso-2,6-diaminoheptanedioate to L-lysine. Proteins in this subfamily may function as PLP-dependent decarboxylases. Length = 423 Score = 26.1 bits (58), Expect = 8.9 Identities = 10/41 (24%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Query: 8 RVLLKVSGEALAGISGFGVDIDSVNRICADIAEVYAKGIEI 48 RVLL++S + S FG+ V +A+ + + + Sbjct: 130 RVLLRLSPFPASLPSRFGMPAAEVRTALERLAQ-LRERVRL 169 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.321 0.138 0.395 Gapped Lambda K H 0.267 0.0773 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,785,366 Number of extensions: 143973 Number of successful extensions: 500 Number of sequences better than 10.0: 1 Number of HSP's gapped: 482 Number of HSP's successfully gapped: 58 Length of query: 242 Length of database: 6,263,737 Length adjustment: 91 Effective length of query: 151 Effective length of database: 4,297,318 Effective search space: 648895018 Effective search space used: 648895018 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 56 (25.3 bits)