RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780778|ref|YP_003065191.1| elongation factor Ts [Candidatus Liberibacter asiaticus str. psy62] (296 letters) >d1tfea_ d.43.1.1 (A:) Elongation factor Ts (EF-Ts), dimerisation domain {Thermus thermophilus [TaxId: 274]} Length = 142 Score = 100 bits (249), Expect = 2e-22 Identities = 42/145 (28%), Positives = 73/145 (50%), Gaps = 8/145 (5%) Query: 149 SEGVISSYLHASPSEGLGSIGVLVALQSSAE---DKELLSAIGEKIAVHVMLASPSVISV 205 EG+I Y+H + +GVLV L + EL + + +A+H+ + +P +S Sbjct: 2 REGIIGHYIHHN-----QRVGVLVELNCETDFVARNELFQNLAKDLAMHIAMMNPRYVSA 56 Query: 206 QMLDPSIVANKRAHYMTEALDSGKSGNIVEKIVNGKMQSFCKECVLLHQGFVVDPSKTVS 265 + + + +R Y+ AL+ GK I EKI G+++ + +E VLL Q FV D V Sbjct: 57 EEIPAEELEKERQIYIQAALNEGKPQQIAEKIAEGRLKKYLEEVVLLEQPFVKDDKVKVK 116 Query: 266 DFLKESEKSIGASIEVVGVSHFVVG 290 + ++++ IG +I V F +G Sbjct: 117 ELIQQAIAKIGENIVVRRFCRFELG 141 Score = 26.6 bits (58), Expect = 3.0 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Query: 58 SEGLIGI-ARDGYKKASIVEVNVETDSLAKNTDFQSLVSNIA 98 EG+IG + +VE+N ETD +A+N FQ+L ++A Sbjct: 2 REGIIGHYIHHNQRVGVLVELNCETDFVARNELFQNLAKDLA 43 >d1efub2 d.43.1.1 (B:140-282) Elongation factor Ts (EF-Ts), dimerisation domain {Escherichia coli [TaxId: 562]} Length = 143 Score = 78.5 bits (193), Expect = 7e-16 Identities = 50/148 (33%), Positives = 70/148 (47%), Gaps = 22/148 (14%) Query: 152 VISSYLHASPSEGLGSIGVLVALQSSAEDKELLSAIGEKIAVHVMLASPSVISVQMLDPS 211 V+ SY H IGVLVA + + E+ + + IA+HV + P I + + Sbjct: 2 VLGSYQHG------ARIGVLVAAKGADEE------LVKHIAMHVAASKPEFIKPEDVSAE 49 Query: 212 IVANKRAHYMTEALDSGKSGNIVEKIVNGKMQSFCKECVLLHQGFVVDPSKTVSDFLKES 271 +V + + A+ SGK I EK+V G+M+ F E L Q FV++PSKTV LKE Sbjct: 50 VVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKKFTGEVSLTGQPFVMEPSKTVGQLLKE- 108 Query: 272 EKSIGASIEVVGVSHFVVG----KENDD 295 + EV G F VG K D Sbjct: 109 -----HNAEVTGFIRFEVGEGIEKVETD 131 >d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]} Length = 54 Score = 75.8 bits (187), Expect = 4e-15 Identities = 30/53 (56%), Positives = 41/53 (77%) Query: 2 SKVSAVAVKELRGKTGAGIMDCKNALLEAKGDSELAIDILRTKGAMAASKREG 54 ++++A VKELR +TGAG+MDCK AL EA GD ELAI+ +R GA+ A+K+ G Sbjct: 1 AEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSGAIKAAKKAG 53 >d1xb2b2 d.43.1.1 (B:112-222) Elongation factor Ts (EF-Ts), dimerisation domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 111 Score = 74.7 bits (183), Expect = 9e-15 Identities = 33/111 (29%), Positives = 51/111 (45%), Gaps = 16/111 (14%) Query: 54 GRKVSEGLIGIARDGYKKASIVEVNVETDSLAKNTDFQSLVSNIAGIALSTDGSLDNVLA 113 GRK EGLIG+ ++G +VEVN ETD +++N FQ LV +A L +L + L+ Sbjct: 1 GRKTKEGLIGLLQEG-DTTVLVEVNCETDFVSRNLKFQQLVQQVALGTLLHCQNLKDQLS 59 Query: 114 MP---------------FDHSGITVGDGIKQQIAITGECIKLRRSALLCVS 149 ++ D + I GE + L+R+A + V Sbjct: 60 TYSKGFLNSSELSELPAGPEREGSLKDQLALAIGKLGENMILKRAAWVKVP 110 >d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 52 Score = 73.9 bits (182), Expect = 2e-14 Identities = 24/47 (51%), Positives = 33/47 (70%) Query: 9 VKELRGKTGAGIMDCKNALLEAKGDSELAIDILRTKGAMAASKREGR 55 +K+LR TGAG+MD K AL +A D E A+ +LR +GAM A+K+ R Sbjct: 6 IKKLREATGAGMMDVKRALEDAGWDEEKAVQLLRERGAMKAAKKADR 52 >d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 56 Score = 72.7 bits (179), Expect = 3e-14 Identities = 16/54 (29%), Positives = 23/54 (42%) Query: 2 SKVSAVAVKELRGKTGAGIMDCKNALLEAKGDSELAIDILRTKGAMAASKREGR 55 S S + +LR KTG ++CK AL GD + A L + + R Sbjct: 1 SASSKELLMKLRRKTGYSFINCKKALETCGGDLKQAESWLHKQAQKEGWSKAAR 54 >d1efub4 d.43.1.1 (B:55-139) Elongation factor Ts (EF-Ts), dimerisation domain {Escherichia coli [TaxId: 562]} Length = 85 Score = 67.2 bits (164), Expect = 2e-12 Identities = 26/89 (29%), Positives = 42/89 (47%), Gaps = 8/89 (8%) Query: 58 SEGLIGIARDGYKKASIVEVNVETDSLAKNTDFQSLVSNIAGIALSTDGSLDNVLAMPFD 117 ++G+I DG I+EVN +TD +AK+ FQ+ + A++ + VL F+ Sbjct: 3 ADGVIKTKIDG-NYGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGKITDVEVLKAQFE 61 Query: 118 HSGITVGDGIKQQIAITGECIKLRRSALL 146 + +A GE I +RR A L Sbjct: 62 -------EERVALVAKIGENINIRRVAAL 83 >d1xb2b3 d.43.1.1 (B:223-331) Elongation factor Ts (EF-Ts), dimerisation domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 109 Score = 52.2 bits (125), Expect = 5e-08 Identities = 27/146 (18%), Positives = 49/146 (33%), Gaps = 46/146 (31%) Query: 151 GVISSYLHASPSEG------LGSIGVLVALQSSAEDKELLSAIGEKIAVHVMLASPSVIS 204 + SY+H + LG G LV ++S K L+ +G ++ HV+ +P + Sbjct: 2 FYVGSYVHGAMHSPSLHNLVLGKYGALVICETSE-LKANLADLGRRLGQHVVGMAPLSVG 60 Query: 205 VQMLDPSIVANKRAHYMTEALDSGKSGNIVEKIVNGKMQSFCKECVLLHQGFVVDPSKTV 264 +P E +L Q +++DPS T+ Sbjct: 61 SLDDEPGGE---------------------------------AETKMLSQPYLLDPSITL 87 Query: 265 SDFLKESEKSIGASIEVVGVSHFVVG 290 +++ + VV F G Sbjct: 88 GQYVQP------HGVSVVDFVRFECG 107 >d2j01t1 b.34.5.6 (T:1-138) Ribosomal protein L19 {Thermus thermophilus [TaxId: 274]} Length = 138 Score = 27.3 bits (60), Expect = 1.8 Identities = 5/50 (10%), Positives = 16/50 (32%), Gaps = 2/50 (4%) Query: 188 GEKIAVHVMLASPSVISVQMLDPSIVANKRAHYMTEALDSGKSGNIVEKI 237 G + L SP + + ++ + +++ S + + Sbjct: 69 GVGVERIFPLHSPLIQKIDIVQRGRARRAKLYFIRNL--SDREIRRKLRA 116 >d1w36c1 c.37.1.19 (C:1-347) Exodeoxyribonuclease V gamma chain (RecC), N-terminal domain {Escherichia coli [TaxId: 562]} Length = 347 Score = 26.9 bits (59), Expect = 2.0 Identities = 6/20 (30%), Positives = 13/20 (65%) Query: 182 ELLSAIGEKIAVHVMLASPS 201 + L A+G+ I +H++ +P Sbjct: 225 QALQALGKHIEIHLLFTNPC 244 >d2fyga1 g.86.1.1 (A:6-128) Nonstructural protein 10, NSP10 {SARS coronavirus [TaxId: 227859]} Length = 123 Score = 26.0 bits (57), Expect = 4.5 Identities = 10/33 (30%), Positives = 17/33 (51%) Query: 250 VLLHQGFVVDPSKTVSDFLKESEKSIGASIEVV 282 VL F VDP+K D+L + I ++++ Sbjct: 8 VLSFCAFAVDPAKAYKDYLASGGQPITNCVKML 40 >d1wj0a_ g.72.1.1 (A:) Squamosa-promoter binding-like protein 12, DNA-binding domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 58 Score = 25.1 bits (55), Expect = 6.8 Identities = 8/18 (44%), Positives = 11/18 (61%) Query: 236 KIVNGKMQSFCKECVLLH 253 +V G MQ FC++C H Sbjct: 35 ALVGGIMQRFCQQCSRFH 52 >d1cg5a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]} Length = 141 Score = 25.0 bits (54), Expect = 7.3 Identities = 4/19 (21%), Positives = 11/19 (57%) Query: 177 SAEDKELLSAIGEKIAVHV 195 S+++K+ + +G I + Sbjct: 3 SSQNKKAIEELGNLIKANA 21 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.313 0.131 0.351 Gapped Lambda K H 0.267 0.0567 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 974,751 Number of extensions: 41782 Number of successful extensions: 108 Number of sequences better than 10.0: 1 Number of HSP's gapped: 99 Number of HSP's successfully gapped: 18 Length of query: 296 Length of database: 2,407,596 Length adjustment: 85 Effective length of query: 211 Effective length of database: 1,240,546 Effective search space: 261755206 Effective search space used: 261755206 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 53 (24.6 bits)