BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780780|ref|YP_003065193.1| histidine triad (HIT) protein [Candidatus Liberibacter asiaticus str. psy62] (155 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780780|ref|YP_003065193.1| histidine triad (HIT) protein [Candidatus Liberibacter asiaticus str. psy62] Length = 155 Score = 318 bits (815), Expect = 3e-89, Method: Compositional matrix adjust. Identities = 155/155 (100%), Positives = 155/155 (100%) Query: 1 MKEKSSTHYDNQNIFIKIIRNETNACRVYEDDILLAIMDIMPRNPGHVLIIPKSRIRDIF 60 MKEKSSTHYDNQNIFIKIIRNETNACRVYEDDILLAIMDIMPRNPGHVLIIPKSRIRDIF Sbjct: 1 MKEKSSTHYDNQNIFIKIIRNETNACRVYEDDILLAIMDIMPRNPGHVLIIPKSRIRDIF 60 Query: 61 EAPPEILSQIAFLIKKIAIACKSAFQADGIQILQFNGHAAGQTVPHLHFHVIPCKNGDNA 120 EAPPEILSQIAFLIKKIAIACKSAFQADGIQILQFNGHAAGQTVPHLHFHVIPCKNGDNA Sbjct: 61 EAPPEILSQIAFLIKKIAIACKSAFQADGIQILQFNGHAAGQTVPHLHFHVIPCKNGDNA 120 Query: 121 SHTNIHPTQKIENFAKLEINAQKIRKELQNFLKTT 155 SHTNIHPTQKIENFAKLEINAQKIRKELQNFLKTT Sbjct: 121 SHTNIHPTQKIENFAKLEINAQKIRKELQNFLKTT 155 >gi|254780767|ref|YP_003065180.1| lipid-A-disaccharide synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 383 Score = 25.0 bits (53), Expect = 0.64, Method: Compositional matrix adjust. Identities = 11/35 (31%), Positives = 21/35 (60%) Query: 42 PRNPGHVLIIPKSRIRDIFEAPPEILSQIAFLIKK 76 P +L++P SR ++I++ P S +A L+K+ Sbjct: 189 PSQWKKILLLPGSRAQEIYKILPFFESAVASLVKR 223 >gi|254780602|ref|YP_003065015.1| aspartate aminotransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 400 Score = 23.5 bits (49), Expect = 2.0, Method: Compositional matrix adjust. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 5/34 (14%) Query: 28 VYEDDILLAIMDIMPRNPGHVLIIPKSRIRDIFE 61 VY + L A+ D++ RNP HV II DI+E Sbjct: 180 VYSQNRLRALADVLVRNP-HVHIISD----DIYE 208 >gi|254780879|ref|YP_003065292.1| hypothetical protein CLIBASIA_03880 [Candidatus Liberibacter asiaticus str. psy62] Length = 652 Score = 23.5 bits (49), Expect = 2.1, Method: Compositional matrix adjust. Identities = 12/36 (33%), Positives = 17/36 (47%) Query: 77 IAIACKSAFQADGIQILQFNGHAAGQTVPHLHFHVI 112 IA K+ QI+ + G T PHLH+ +I Sbjct: 565 IAKNIKAGTAVKQGQIIGWIGTTGLSTGPHLHYELI 600 >gi|254780251|ref|YP_003064664.1| 50S ribosomal protein L14 [Candidatus Liberibacter asiaticus str. psy62] Length = 122 Score = 23.1 bits (48), Expect = 2.5, Method: Compositional matrix adjust. Identities = 7/29 (24%), Positives = 17/29 (58%) Query: 16 IKIIRNETNACRVYEDDILLAIMDIMPRN 44 IK++ C D +++A+ +++PR+ Sbjct: 22 IKVLGGSKRKCASIGDTVVVAVKEVIPRS 50 >gi|255764476|ref|YP_003065238.2| two-component sensor histidine kinase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 792 Score = 21.6 bits (44), Expect = 6.7, Method: Composition-based stats. Identities = 9/22 (40%), Positives = 14/22 (63%) Query: 130 KIENFAKLEINAQKIRKELQNF 151 K ++ KL +K+RKE Q+F Sbjct: 120 KFHHYIKLSKATEKLRKEGQSF 141 >gi|254780821|ref|YP_003065234.1| FolC bifunctional protein [Candidatus Liberibacter asiaticus str. psy62] Length = 429 Score = 21.6 bits (44), Expect = 6.9, Method: Compositional matrix adjust. Identities = 13/40 (32%), Positives = 20/40 (50%) Query: 48 VLIIPKSRIRDIFEAPPEILSQIAFLIKKIAIACKSAFQA 87 V +I + R R P++L Q A + A+AC S +A Sbjct: 353 VSLICRGRERQSISITPKVLMQEAKKLGFQAMACSSMIEA 392 >gi|254780945|ref|YP_003065358.1| ATP-dependent DNA helicase RecG [Candidatus Liberibacter asiaticus str. psy62] Length = 700 Score = 21.2 bits (43), Expect = 9.9, Method: Compositional matrix adjust. Identities = 10/27 (37%), Positives = 16/27 (59%) Query: 43 RNPGHVLIIPKSRIRDIFEAPPEILSQ 69 R P +IIP +RI ++ E +LS+ Sbjct: 455 RKPIKTVIIPINRIDEVIERLKVVLSE 481 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.323 0.137 0.402 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 100,027 Number of Sequences: 1233 Number of extensions: 3765 Number of successful extensions: 13 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 9 length of query: 155 length of database: 328,796 effective HSP length: 67 effective length of query: 88 effective length of database: 246,185 effective search space: 21664280 effective search space used: 21664280 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 35 (18.1 bits)