>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase; InterPro: IPR005664 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway. Additionally, several important metabolic intermediates are produced by these reactions, such as diaminopimelic acid, an essential component of bacterial cell wall biosynthesis, and dipicolinic acid, which is involved in sporulation in Gram-positive bacteria. Members of the animal kingdom do not posses this pathway and must therefore acquire these essential amino acids through their diet. Research into improving the metabolic flux through this pathway has the potential to increase the yield of the essential amino acids in important crops, thus improving their nutritional value. Additionally, since the enzymes are not present in animals, inhibitors of them are promising targets for the development of novel antibiotics and herbicides. For more information see . The lysine/diaminopimelic acid branch of the aspartate pathway produces the essential amino acid lysine via the intermediate meso-diaminopimelic acid (meso-DAP), which is also a vital cell wall component in Gram-negative bacteria . The production of dihydropicolinate from aspartate-semialdehyde controls flux into the lysine/diaminopimelic acid pathway. Three variants of this pathway exist, differing in how tetrahydropicolinate (formed by reduction of dihydropicolinate) is metabolised to meso-DAP. One variant, the most commonly found one in archaea and bacteria, uses primarily succinyl intermediates, while a second variant, found only in Bacillus, utilises primarily acetyl intermediates. In the third variant, found in some Gram-positive bacteria, a dehydrogenase converts tetrahydropicolinate directly to meso-DAP. In all variants meso-DAP is subsequently converted to lysine by a decarboxylase, or, in Gram-negative bacteria, assimilated into the cell wall. Evidence exists that a fourth, currently unknown, variant of this pathway may function in plants . 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase (also known as tetrahydrodipicolinate N-succinyltransferase or DapD) is part of the succinyl route of of lysine/DAP biosynthesis. The DapD protein is a homotrimer is a trimeric enzyme with each monomer composed of three domain: an N-terminal helical domain, a distinctive left-handed parallel beta-helix (LBH) domain, and a predominantly beta C-terminal domain , . The LBH structure is encoded by an imperfect tandem-repeated hexapeptide sequence. Each trimer contains three independent active sites, always occuring at the boundary of two subunits, and formed by residues from one N-terminal domain, one C-terminal domain and two adjacent LBH domains.; GO: 0016757 transferase activity transferring glycosyl groups, 0009089 lysine biosynthetic process via diaminopimelate.

Probab=100.00 E-value=0 Score=787.74 Aligned_cols=270 Identities=57% Similarity=1.009 Sum_probs=261.1 Q ss_pred HHHHHHHHHHHHHHHCCCC--CCHHHHHHHHHHHHHHHCCCEEEEEECCCCCEEEEHHHHHHHHHEEECCCCEEEECCCC Q ss_conf 9999999997505316824--41789999999999730793799887599968860788623222064267447624776 Q gi|254780781|r 7 TLEEIIDSFFEESNSKNES--IPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNG 84 (285) Q Consensus 7 ~L~~~Ie~awe~r~~l~~~--~~~~~~~aI~~~I~~LD~G~iRVAEk~~nG~W~VNeWvKKAILL~Fri~~~~~i~~g~~ 84 (285) T Consensus 1 ~l~~~IE~Af~~~~~I~~d~~~~~~~k~~~~~~I~~L~~G~lRVaEk~g~~~W~v~~W~KKAvLL~F~~~~~~~~~~~-- 78 (275) T TIGR00965 1 SLQNIIETAFEIRAEITPDSSKLIKLKEAVNESIASLDSGILRVAEKLGGGQWKVNEWVKKAVLLSFRITDNQVLNDA-- 78 (275) T ss_pred CHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCEEHHHHHHEEEEEEEEECHHHHHHCC-- T ss_conf 923578898875642375433416899999999986328827876650698221355651012233441102311067-- Q ss_pred CCCHHHCCCCCC-CCCCHHHHHHCCCCCCCCCEECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCEEEECCCCE Q ss_conf 420110177532-3652023442475102543103564006651462010302353367720156612322047306868 Q gi|254780781|r 85 YSTWWDKIPAKF-DDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVH 163 (285) Q Consensus 85 ~~~~~DKvp~Kf-~~~~~~~f~~~g~rv~P~a~vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vh 163 (285) T Consensus 79 ~~~yfDKV~~KFpAD~d~~~Fk~~g~R~VPgA~vR~G~fiAkNvVlMPSyvNIGAYvDEGtMvDTWATvGSCAQIGKNvH 158 (275) T TIGR00965 79 VNKYFDKVPTKFPADYDENEFKEAGFRKVPGAIVRRGTFIAKNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVH 158 (275) T ss_pred CCCCCCCCCCCCCCCCCHHHHHHCCCCCCCHHHEECCCEEEEEEEECCCEEECCCEEECCCEECCHHHHCCHHHHCCCEE T ss_conf 53201257887888765678864666548743600573577523775552101367516860100122300322066257 Q ss_pred EECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECCC Q ss_conf 81232112100577656448725847821857846888458856630046527833687158814644549987896056 Q gi|254780781|r 164 ISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243 (285) Q Consensus 164 I~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg~ 243 (285) T Consensus 159 lSGG~GIGGVLEPLQA~P~IIEDNCFiGARSEi~EGVIVEEGSVISMGVfIG~STkI~~R~TGEI~~GRvPA~SVVVsG~ 238 (275) T TIGR00965 159 LSGGVGIGGVLEPLQAKPTIIEDNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIVDRDTGEIIYGRVPAGSVVVSGI 238 (275) T ss_pred EECCCCCCCCCCCCCCCCEEEECCCEECCCEEEEEEEEECCCCEEEEEEEECCCCEEEECCCCEEEECCCCCEEEEECCC T ss_conf 51783316524633578758824760046113562079716858884068556016885366717655135602797177 Q ss_pred CCC-CCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHHC Q ss_conf 445-5677665776446727989612024668889987511 Q gi|254780781|r 244 YPS-INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283 (285) Q Consensus 244 ~~~-~~~~~~~~~~~~~cavi~~~~d~~t~~k~~ln~~lR~ 283 (285) T Consensus 239 lPsp~~G~-----~sLYC~VIVK~VD~~TRgKvsiN~LLR~ 274 (275) T TIGR00965 239 LPSPKDGK-----YSLYCAVIVKKVDAKTRGKVSINELLRT 274 (275) T ss_pred CCCCCCCC-----CCCEEEEEEECCCCCCCCCCCHHHHHCC T ss_conf 88755679-----6414899987116766752015655204

HHsearch alignment for GI: 254780781 and conserved domain: TIGR00965