>TIGR01173 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPro: IPR005882 N-Acetylglucosamine-1-PO(4) uridyltransferase (GlmU, 2.7.7.23 from EC) is a trimeric bifunctional enzyme that catalyzes the last two sequential reactions in the de novo biosynthetic pathway for UDP-GlcNAc. The X-ray crystal structure of Escherichia coli GlmU in complex with UDP-GlcNAc and CoA has been determined to 2.1 A resolution and reveals a two-domain architecture that is responsible for these two reactions . The C-terminal domain is responsible for the CoA-dependent acetylation of Glc-1-PO(4) to GlcNAc-1-PO(4) and displays the longest left-handed parallel beta-helix observed to date. The acetyltransferase active site defined by the binding site for CoA makes use of residues from all three subunits and is positioned beneath an open cavity large enough to accommodate the Glc-1-PO(4) acetyl acceptor. The N-terminal domain catalyzes uridyl transfer from UTP to GlcNAc-1-PO(4) to form the final products UDP-GlcNAc and pyrophosphate. This domain is composed of a central seven-stranded beta-sheet surrounded by six alpha-helices in a Rossmann fold-like topology. ; GO: 0003977 UDP-N-acetylglucosamine diphosphorylase activity, 0009103 lipopolysaccharide biosynthetic process.

Probab=99.91 E-value=8.9e-25 Score=172.28 Aligned_cols=122 Identities=28% Similarity=0.428 Sum_probs=108.4 Q ss_pred HHCCCCCCCCCEECCCCCCCCCCEEECCEEEC-CCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEE Q ss_conf 42475102543103564006651462010302-35336772015661232204730686881232112100577656448 Q gi|254780781|r 105 EKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNM-GAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183 (285) Q Consensus 105 ~~~g~rv~P~a~vr~ga~Ig~g~vimp~~Vni-GA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pvi 183 (285) T Consensus 326 ig~~~~vGPFArLRP~~~L~~~~hi-GNFVE~Kna~iG~gsKA~HLsYlGD-AeiG~~vNiGAGtIT-cNYDG~nK~~T~ 402 (461) T TIGR01173 326 IGEGCDVGPFARLRPGSVLGAGVHI-GNFVEVKNARIGEGSKAGHLSYLGD-AEIGSNVNIGAGTIT-CNYDGVNKHKTI 402 (461) T ss_pred ECCCCEECCCCCCCCCCHHHCCCEE-EEEEEEECCEECCCCCCCCCCEEEE-EEECCCCEECCEEEE-EECCCCCCCCCE T ss_conf 6156402773001864321177816-0258652476188644231433320-250796003231689-932796220348 Q ss_pred ECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECC Q ss_conf 725847821857846888458856630046527833687158814644549 Q gi|254780781|r 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVP 234 (285) Q Consensus 184 IeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP 234 (285) T Consensus 403 IGd~VFiGSnt~LVAPV~iG~gA~iaAGstvt~-----DVp~g~La~~R~~ 448 (461) T TIGR01173 403 IGDGVFIGSNTQLVAPVKIGDGATIAAGSTVTK-----DVPEGALAIARAR 448 (461) T ss_pred ECCCCEECCCCEEECCEEECCCCEECCCCEEEC-----CCCCCCCEEECCC T ss_conf 648878776760455439438118712414802-----3488852662455

HHsearch alignment for GI: 254780781 and conserved domain: TIGR01173