RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780781|ref|YP_003065194.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase [Candidatus Liberibacter asiaticus str. psy62] (285 letters) >gnl|CDD|32354 COG2171, DapD, Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism]. Length = 271 Score = 278 bits (712), Expect = 1e-75 Identities = 122/283 (43%), Positives = 160/283 (56%), Gaps = 19/283 (6%) Query: 6 STLEEIIDSFFEESNSKNESIP--QDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63 + +EII+ FEE + I D+ +AV L R+A + W T +W+ Sbjct: 2 QSAQEIIELAFEERKAVRTVIYVLDDLPEAVADAYLRLHLLSHRVAEPHIDNLWGTFEWL 61 Query: 64 KKAILLSFQINPTKIISDGN-GYSTWWDKIPAKF-DDWKTKDFEKHNFRIIPGTIVRHSA 121 KKA+LL F +++ G ++DK+ + F RI+PG IVR A Sbjct: 62 KKAVLLGFGPCDLELLEAGRLRIRGYYDKVDSVDKAPRMLDYFVPEGVRIVPGAIVRLGA 121 Query: 122 YIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180 YI V+MP SFVN+GA GEG+M+D ++VGSCAQ+GKN HI GG IGGVLEP+Q Sbjct: 122 YIAKGTVVMPESFVNIGAGTGEGTMVDGRASVGSCAQVGKNSHIGGGASIGGVLEPLQAN 181 Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240 P II DNC IGA SE+VEG I+ +G V+ GVFI + TKI DR G + + SVVV Sbjct: 182 PVIIGDNCLIGANSEVVEGVIVGDGCVVAAGVFITQDTKIYDRVAGRV------AGSVVV 235 Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283 G+ P G LYCA I+K+VD KT+ KT IN LLR Sbjct: 236 AGTLP--------GGLSLYCASIVKQVDAKTKGKTEINELLRT 270 >gnl|CDD|100041 cd03350, LbH_THP_succinylT, 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA. It is the committed step in the succinylase pathway by which bacteria synthesize L-lysine and meso-diaminopimelate, a component of peptidoglycan. The enzyme is homotrimeric and each subunit contains an N-terminal region with alpha helices and hairpin loops, as well as a C-terminal region with a left-handed parallel alpha-helix (LbH) structural motif encoded by hexapeptide repeat motifs.. Length = 139 Score = 221 bits (565), Expect = 2e-58 Identities = 87/139 (62%), Positives = 106/139 (76%), Gaps = 1/139 (0%) Query: 108 NFRIIPGTIVRHSAYIGPKAVLM-PSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISG 166 R+ PG I+R A+IGP AVLM PS+VN+GAY+ EG+M+D+W+TVGSCAQIGKNVH+S Sbjct: 1 GRRVPPGAIIRDGAFIGPGAVLMMPSYVNIGAYVDEGTMVDSWATVGSCAQIGKNVHLSA 60 Query: 167 GVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTG 226 G IGGVLEP+Q P IIED+ FIGA E+VEG I+ +G+VL GV + +ST I DR TG Sbjct: 61 GAVIGGVLEPLQATPVIIEDDVFIGANCEVVEGVIVGKGAVLAAGVVLTQSTPIYDRETG 120 Query: 227 EITYGEVPSYSVVVPGSYP 245 EI YG VP SVVV GS P Sbjct: 121 EIYYGRVPPGSVVVAGSLP 139 >gnl|CDD|100038 cd00208, LbetaH, Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity, however, some subfamilies in this hierarchy also show activities related to ion transport or translation initiation. Many are trimeric in their active forms.. Length = 78 Score = 79.6 bits (197), Expect = 9e-16 Identities = 29/78 (37%), Positives = 39/78 (50%) Query: 138 AYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIV 197 +IGEG I + + IG NV+I G IG P + PTII DN IGA + I Sbjct: 1 VFIGEGVKIHPKAVIRGPVVIGDNVNIGPGAVIGAATGPNEKNPTIIGDNVEIGANAVIH 60 Query: 198 EGCIIREGSVLGMGVFIG 215 G I + +V+G G + Sbjct: 61 GGVKIGDNAVIGAGAVVT 78 >gnl|CDD|100050 cd03360, LbH_AT_putative, Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain. The alignment contains 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity. A few members are identified as NeuD, a sialic acid (Sia) O-acetyltransferase that is required for Sia synthesis and surface polysaccharide sialylation.. Length = 197 Score = 63.7 bits (156), Expect = 5e-11 Identities = 38/126 (30%), Positives = 59/126 (46%), Gaps = 15/126 (11%) Query: 100 KTKDFEKHNFRII----PGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTVGS 154 + +R P +V SA IG V+M + +N A IG+ +I+T + +G Sbjct: 72 LAEKLLAAGYRFATLIHPSAVVSPSAVIGEGCVIMAGAVINPDARIGDNVIINTGAVIGH 131 Query: 155 CAQIGKNVHISGGVGI-GGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVF 213 IG VHI+ GV + GGV I + FIGA + I++G I G+++G G Sbjct: 132 DCVIGDFVHIAPGVVLSGGV---------TIGEGAFIGAGATIIQGVTIGAGAIIGAGAV 182 Query: 214 IGKSTK 219 + K Sbjct: 183 VTKDVP 188 >gnl|CDD|100053 cd04647, LbH_MAT_like, Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins. MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively while GAT specifically acetylates galactopyranosides. XAT catalyzes the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others. XATs are implicated in inactivating xenobiotics leading to xenobiotic resistance in patients. Members of this family contain a a left-handed parallel beta-helix (LbH) domain with at least 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). They are trimeric in their active form.. Length = 109 Score = 54.8 bits (133), Expect = 2e-08 Identities = 30/113 (26%), Positives = 45/113 (39%), Gaps = 30/113 (26%) Query: 139 YIGEGSMIDTWSTVGSCAQIGKNVHISGGVGI-----------GGVLEPIQTGPTIIEDN 187 YIG G +I + IG NV I V I + + + + P +I D+ Sbjct: 9 YIGPGCVISAGGGI----TIGDNVLIGPNVTIYDHNHDIDDPERPIEQGVTSAPIVIGDD 64 Query: 188 CFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240 +IGA I+ G I +G+V+G G + K VP S+V Sbjct: 65 VWIGANVVILPGVTIGDGAVVGAGSVVTKD---------------VPPNSIVA 102 >gnl|CDD|31246 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl]. Length = 338 Score = 52.2 bits (125), Expect = 1e-07 Identities = 34/107 (31%), Positives = 46/107 (42%), Gaps = 9/107 (8%) Query: 115 TIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVL 174 +A I P AV+ P+ A IG+ I +G+ IG+NV I G IG Sbjct: 94 RPFNPAAGIHPTAVIDPT-----ATIGKNVSIGPNVVIGAGVVIGENVVIGAGAVIG--- 145 Query: 175 EPIQTGP-TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKI 220 E ++ G T+I N I I II G+V+G F T I Sbjct: 146 ENVKIGDGTVIHPNVTIYHNVVIGNNVIIHSGAVIGADGFGYAGTAI 192 Score = 50.7 bits (121), Expect = 5e-07 Identities = 31/150 (20%), Positives = 45/150 (30%), Gaps = 34/150 (22%) Query: 108 NFRIIPGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISG 166 N I P ++ IG V+ + + IG+G++I T+ IG NV I Sbjct: 117 NVSIGPNVVIGAGVVIGENVVIGAGAVIGENVKIGDGTVIHPNVTIYHNVVIGNNVIIHS 176 Query: 167 GVGIGG---VLEPIQTGP------------------------------TIIEDNCFIGAR 193 G IG G T+I + I Sbjct: 177 GAVIGADGFGYAGTAIGWVKIPQIGRVIIGDDVEIGANTTIDRGALDDTVIGEGVKIDNL 236 Query: 194 SEIVEGCIIREGSVLGMGVFIGKSTKIIDR 223 +I I E ++ V I S KI Sbjct: 237 VQIGHNVRIGEHCIIAGQVGIAGSVKIGKY 266 Score = 41.4 bits (97), Expect = 3e-04 Identities = 28/90 (31%), Positives = 39/90 (43%), Gaps = 14/90 (15%) Query: 134 VNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGAR 193 N A I ++ID +T+G IG NV I GV IG +N IGA Sbjct: 96 FNPAAGIHPTAVIDPTATIGKNVSIGPNVVIGAGVVIG--------------ENVVIGAG 141 Query: 194 SEIVEGCIIREGSVLGMGVFIGKSTKIIDR 223 + I E I +G+V+ V I + I + Sbjct: 142 AVIGENVKIGDGTVIHPNVTIYHNVVIGNN 171 Score = 39.9 bits (93), Expect = 0.001 Identities = 23/57 (40%), Positives = 27/57 (47%), Gaps = 8/57 (14%) Query: 140 IGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEI 196 IGE +I + +IGK V I G VGI G LE I D IGARS + Sbjct: 245 IGEHCIIAGQVGIAGSVKIGKYVIIGGQVGIAGHLE--------IGDGVTIGARSGV 293 Score = 32.6 bits (74), Expect = 0.12 Identities = 21/84 (25%), Positives = 29/84 (34%), Gaps = 10/84 (11%) Query: 140 IGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEG 199 I G++ DT +G +I V I V IG II I +I + Sbjct: 217 IDRGALDDT--VIGEGVKIDNLVQIGHNVRIGE--------HCIIAGQVGIAGSVKIGKY 266 Query: 200 CIIREGSVLGMGVFIGKSTKIIDR 223 II + + IG I R Sbjct: 267 VIIGGQVGIAGHLEIGDGVTIGAR 290 >gnl|CDD|36674 KOG1461, KOG1461, KOG1461, Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis]. Length = 673 Score = 51.1 bits (122), Expect = 3e-07 Identities = 40/132 (30%), Positives = 60/132 (45%), Gaps = 11/132 (8%) Query: 94 AKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVG 153 F +T E+ N P ++ HS +G V+ G IG GS I S +G Sbjct: 301 INFSGNQTFSLERRNIYKSPDVVLSHSVIVGANVVI-----GAGTKIGSGSKISN-SVIG 354 Query: 154 SCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVF 213 + +IG NV I V I I D+ I +I EG I++ GSVLG GV Sbjct: 355 ANCRIGSNVRIKNSFIWNNVT--IGDNCRI--DHAIICDDVKIGEGAILKPGSVLGFGVV 410 Query: 214 IGKSTKIIDRNT 225 +G++ ++ +N+ Sbjct: 411 VGRN-FVLPKNS 421 >gnl|CDD|100054 cd04649, LbH_THP_succinylT_putative, Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH. THP succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA. It is the committed step in the succinylase pathway by which bacteria synthesize L-lysine and meso-diaminopimelate, a component of peptidoglycan. The enzyme is trimeric and displays the left-handed parallel alpha-helix (LbH) structural motif encoded by the hexapeptide repeat motif.. Length = 147 Score = 49.3 bits (118), Expect = 1e-06 Identities = 30/114 (26%), Positives = 46/114 (40%), Gaps = 5/114 (4%) Query: 108 NFRIIPGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISG 166 RI VR AY+ +M FVN A M++ + S +GK + G Sbjct: 1 GVRIADADRVRLGAYLAEGTTVMHEGFVNFNAGTLGNCMVE--GRISSGVIVGKGSDVGG 58 Query: 167 GVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKI 220 G I G L I C +GA S I G + + ++ G+++ TK+ Sbjct: 59 GASIMGTLSGGGNNVISIGKRCLLGANSGI--GISLGDNCIVEAGLYVTAGTKV 110 >gnl|CDD|100045 cd03354, LbH_SAT, Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine. This reaction represents a key metabolic point of regulation for the cysteine biosynthetic pathway due to its feedback inhibition by cysteine. The enzyme is a 175 kDa homohexamer, composed of a dimer of homotrimers. Each subunit contains an N-terminal alpha helical region and a C-terminal left-handed beta-helix (LbH) subdomain with 5 turns, each containing a hexapeptide repeat motif characteristic of the acyltransferase superfamily of enzymes. The trimer interface mainly involves the C-terminal LbH subdomain while the dimer (of trimers) interface is mediated by the N-terminal alpha helical subdomain.. Length = 101 Score = 48.2 bits (116), Expect = 3e-06 Identities = 32/106 (30%), Positives = 43/106 (40%), Gaps = 17/106 (16%) Query: 137 GAYIGEGSMIDTWSTV--GSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARS 194 GA IG G ID + + G A IG N I GV +GG + I DN IGA + Sbjct: 8 GAKIGPGLFIDHGTGIVIGETAVIGDNCTIYQGVTLGGKGKGGGKRHPTIGDNVVIGAGA 67 Query: 195 EIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240 +I+ I + +G + K VP+ S VV Sbjct: 68 KILGNITIGDNVKIGANAVVTKD---------------VPANSTVV 98 >gnl|CDD|100039 cd00710, LbH_gamma_CA, Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. They are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three distinct groups of carbonic anhydrases - alpha, beta and gamma - which show no significant sequence identity or structural similarity. Gamma CAs are homotrimeric enzymes, with each subunit containing a left-handed parallel beta helix (LbH) structural domain.. Length = 167 Score = 46.8 bits (112), Expect = 7e-06 Identities = 39/135 (28%), Positives = 61/135 (45%), Gaps = 28/135 (20%) Query: 116 IVRHSAYIGPKAVLMPSF-VNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVL 174 ++ SAY+ P AV++ + ++G G+ I + G+ IG NV+I GV I L Sbjct: 4 VIDPSAYVHPTAVVIGDVIIGDNVFVGPGASIR--ADEGTPIIIGANVNIQDGVVIHA-L 60 Query: 175 EP---------------IQTGPTIIEDNCFIGARS-----EIVEGCIIREGS-VLGMGVF 213 E I GP I DNCFIG RS ++ + C+I + V G+ + Sbjct: 61 EGYSVWIGKNVSIAHGAIVHGPAYIGDNCFIGFRSVVFNAKVGDNCVIGHNAVVDGVEIP 120 Query: 214 IGK---STKIIDRNT 225 G+ + +I T Sbjct: 121 PGRYVPAGAVITSQT 135 >gnl|CDD|31401 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis]. Length = 358 Score = 45.7 bits (108), Expect = 1e-05 Identities = 36/139 (25%), Positives = 46/139 (33%), Gaps = 28/139 (20%) Query: 89 WDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDT 148 D + A + P I+R + IGP IG G+ I Sbjct: 225 EDLLEANELLLRGDGKSPLGPIEEPVVIIRSAYIIGP------------VVIGPGAKIGP 272 Query: 149 WSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVL 208 + +G IG+ V I GV I II DN IG S I S++ Sbjct: 273 GALIGPYTVIGEGVTIGNGVEIKNS---------IIMDNVVIGHGSYI-------GDSII 316 Query: 209 GMGVFIGKSTKIIDRNTGE 227 G IG S I D G Sbjct: 317 GENCKIGASLIIGDVVIGI 335 >gnl|CDD|100049 cd03359, LbH_Dynactin_5, Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport. Dynactin is a heterocomplex of at least eight subunits, including a 150,000-MW protein called Glued, the actin-capping protein Arp1, and dynamatin. In vitro binding experiments show that dynactin enhances dynein-dependent motility, possibly through interaction with microtubules and vesicles. Subunit p25 is part of the pointed-end subcomplex in dynactin that also includes p26, p27, and Arp11. This subcomplex interacts with membranous cargoes. p25 and p27 contain imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X), indicating a left-handed parallel beta helix (LbH) structural domain. Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity.. Length = 161 Score = 44.9 bits (107), Expect = 3e-05 Identities = 26/107 (24%), Positives = 40/107 (37%), Gaps = 41/107 (38%) Query: 115 TIVRHSAYIGPKAVLMPSF-----------VNMGAY--IGEGSMIDTWSTVGSCAQIGKN 161 +I R+ + V+ P F +++G Y IGE ++ + AQIG Sbjct: 44 SIGRYC-ILSEGCVIRPPFKKFSKGVAFFPLHIGDYVFIGENCVV-------NAAQIGSY 95 Query: 162 VHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVL 208 VHI NC IG R I + I +G+V+ Sbjct: 96 VHI--------------------GKNCVIGRRCIIKDCVKILDGTVV 122 >gnl|CDD|31007 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only]. Length = 176 Score = 44.8 bits (106), Expect = 3e-05 Identities = 30/135 (22%), Positives = 49/135 (36%), Gaps = 18/135 (13%) Query: 97 DDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAY----IGEGSMIDTWSTV 152 + + + F + P V IG + P V G IG + I + Sbjct: 7 YEGLSPKIDPTAF-VAPSATVIGDVRIGAGVSIWPGAVLRGDVEPIRIGARTNIQDGVVI 65 Query: 153 ----GSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVL 208 G IG +V I G + G I DN IG + +++G +I +GS++ Sbjct: 66 HADPGYPVTIGDDVTIGHGAVVHGC---------TIGDNVLIGMGATVLDGAVIGDGSIV 116 Query: 209 GMGVFIGKSTKIIDR 223 G G + +I Sbjct: 117 GAGALVTPGKEIPGG 131 >gnl|CDD|31247 COG1045, CysE, Serine acetyltransferase [Amino acid transport and metabolism]. Length = 194 Score = 44.5 bits (105), Expect = 3e-05 Identities = 34/110 (30%), Positives = 50/110 (45%), Gaps = 19/110 (17%) Query: 134 VNMGAYIGEGSMID--TWSTVGSCAQIGKNVHISGGVGIGGV-LEPIQTGPTIIEDNCFI 190 ++ GA IG G ID T +G A IG +V I GV +GG E + PT I + +I Sbjct: 70 IHPGAKIGRGLFIDHGTGVVIGETAVIGDDVTIYHGVTLGGTGKESGKRHPT-IGNGVYI 128 Query: 191 GARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240 GA ++I+ I + + +G G + K VP + VV Sbjct: 129 GAGAKILGNIEIGDNAKIGAGSVVLKD---------------VPPNATVV 163 >gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc. This constitutes the third step in the lipid A biosynthetic pathway in Gram-negative bacteria. LpxD is a homotrimer, with each subunit consisting of a novel combination of an N-terminal uridine-binding domain, a core lipid-binding left-handed parallel beta helix (LbH) domain, and a C-terminal alpha-helical extension. The LbH domain contains 9 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).. Length = 205 Score = 44.3 bits (106), Expect = 3e-05 Identities = 35/133 (26%), Positives = 51/133 (38%), Gaps = 22/133 (16%) Query: 110 RIIPGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGV 168 I P ++ IG V+ P + G IG+ +I T+ IG V I G Sbjct: 9 SIGPNAVIGEGVVIGDGVVIGPGVVIGDGVVIGDDCVIHPNVTIYEGCIIGDRVIIHSGA 68 Query: 169 GIG----------GVLEPI-QTGPTIIEDNCFIGARSEI----VEGCIIREGSVL----- 208 IG G I Q G II D+ IGA + I + +I +G+ + Sbjct: 69 VIGSDGFGFAPDGGGWVKIPQLGGVIIGDDVEIGANTTIDRGALGDTVIGDGTKIDNLVQ 128 Query: 209 -GMGVFIGKSTKI 220 V IG++ I Sbjct: 129 IAHNVRIGENCLI 141 Score = 40.9 bits (97), Expect = 5e-04 Identities = 29/79 (36%), Positives = 36/79 (45%), Gaps = 10/79 (12%) Query: 138 AYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIG-GVLEPIQTGPTIIEDNCFIGARSEI 196 A IGE I + +G IG V I GV IG GV +I D+C I I Sbjct: 2 AKIGENVSIGPNAVIGEGVVIGDGVVIGPGVVIGDGV---------VIGDDCVIHPNVTI 52 Query: 197 VEGCIIREGSVLGMGVFIG 215 EGCII + ++ G IG Sbjct: 53 YEGCIIGDRVIIHSGAVIG 71 Score = 39.7 bits (94), Expect = 0.001 Identities = 19/62 (30%), Positives = 26/62 (41%), Gaps = 4/62 (6%) Query: 156 AQIGKNVHISGGVGIGGVLEPIQTGP-TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFI 214 A+IG+NV I IG E + G +I IG I + C+I + G I Sbjct: 2 AKIGENVSIGPNAVIG---EGVVIGDGVVIGPGVVIGDGVVIGDDCVIHPNVTIYEGCII 58 Query: 215 GK 216 G Sbjct: 59 GD 60 Score = 35.1 bits (82), Expect = 0.025 Identities = 23/70 (32%), Positives = 28/70 (40%), Gaps = 10/70 (14%) Query: 140 IGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEG 199 IGE +I + IG NV I G VGI G L I D IGA S + Sbjct: 135 IGENCLIAAQVGIAGSTTIGDNVIIGGQVGIAGHLT--------IGDGVVIGAGSGVTS- 185 Query: 200 CIIREGSVLG 209 I+ G + Sbjct: 186 -IVPPGEYVS 194 Score = 34.3 bits (80), Expect = 0.041 Identities = 16/38 (42%), Positives = 21/38 (55%) Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKI 220 I +N IG + I EG +I +G V+G GV IG I Sbjct: 3 KIGENVSIGPNAVIGEGVVIGDGVVIGPGVVIGDGVVI 40 >gnl|CDD|39947 KOG4750, KOG4750, KOG4750, Serine O-acetyltransferase [Amino acid transport and metabolism]. Length = 269 Score = 44.3 bits (104), Expect = 4e-05 Identities = 28/82 (34%), Positives = 39/82 (47%), Gaps = 2/82 (2%) Query: 137 GAYIGEGSMID--TWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARS 194 A IG+G ++D T +G A +G NV I V +GG + I DN IGA Sbjct: 154 AAKIGKGILLDHATGVVIGETAVVGDNVSILHPVTLGGTGKGSGDRHPKIGDNVLIGAGV 213 Query: 195 EIVEGCIIREGSVLGMGVFIGK 216 I+ I EG+V+ G + K Sbjct: 214 TILGNVTIGEGAVIAAGSVVLK 235 >gnl|CDD|100061 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon). eIF2B is important for regenerating GTP-bound eIF2 during the initiation process. This event is obligatory for eIF2 to bind initiator methionyl-tRNA, forming the ternary initiation complex. The eIF-2B epsilon subunit contains an N-terminal domain that resembles a dinucleotide-binding Rossmann fold, a central LbH domain containing 4 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X), and a C-terminal domain of unknown function that is present in eIF-4 gamma, eIF-5, and eIF-2B epsilon. The epsilon and gamma subunits form the catalytic subcomplex of eIF-2B, which binds eIF2 and catalyzes guanine nucleotide exchange.. Length = 79 Score = 44.1 bits (105), Expect = 5e-05 Identities = 29/83 (34%), Positives = 40/83 (48%), Gaps = 5/83 (6%) Query: 134 VNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGAR 193 + G IGEG+ I S +G +IGKNV I V I+ G TI + + Sbjct: 2 IGRGTSIGEGTTI-KNSVIGRNCKIGKNVVIDNSYIWDDVT--IEDGCTI--HHSIVADG 56 Query: 194 SEIVEGCIIREGSVLGMGVFIGK 216 + I +GC I GS++ GV IG Sbjct: 57 AVIGKGCTIPPGSLISFGVVIGD 79 >gnl|CDD|31400 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane]. Length = 460 Score = 42.1 bits (99), Expect = 2e-04 Identities = 40/122 (32%), Positives = 59/122 (48%), Gaps = 14/122 (11%) Query: 107 HNFRIIPGTIVRHSAYIGPKAVLMP-----------SFVNM-GAYIGEGSMIDTWSTVGS 154 + +I G+ V A +GP A L P +FV + A IG+GS + +G Sbjct: 313 KAYSVIEGSTVGEGATVGPFARLRPGAVLGADVHIGNFVEVKKATIGKGSKAGHLTYLGD 372 Query: 155 CAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFI 214 A+IG+NV+I G I + TII DN FIG+ S++V I +G+ + G I Sbjct: 373 -AEIGENVNIGAGT-ITCNYDGKNKFKTIIGDNVFIGSNSQLVAPVTIGDGATIAAGSTI 430 Query: 215 GK 216 K Sbjct: 431 TK 432 Score = 38.6 bits (90), Expect = 0.002 Identities = 34/128 (26%), Positives = 59/128 (46%), Gaps = 16/128 (12%) Query: 106 KHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHIS 165 N I PG++++ S IG AV+ V G+ +GEG+ + ++ + A +G +VHI Sbjct: 290 GDNVVIGPGSVIKDSV-IGDNAVIKAYSVIEGSTVGEGATVGPFARLRPGAVLGADVHIG 348 Query: 166 GGVGIGGVLEPIQTGP-----TIIEDNCFIGARSEIVEGCII-------REGSVLGMGVF 213 V + I G T + D IG I G I + +++G VF Sbjct: 349 NFVEVKKA--TIGKGSKAGHLTYLGD-AEIGENVNIGAGTITCNYDGKNKFKTIIGDNVF 405 Query: 214 IGKSTKII 221 IG +++++ Sbjct: 406 IGSNSQLV 413 Score = 27.4 bits (61), Expect = 4.2 Identities = 16/60 (26%), Positives = 24/60 (40%), Gaps = 9/60 (15%) Query: 161 NVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKI 220 +I G V IG +IE N + + I + +I GSV+ IG + I Sbjct: 262 TTYIRGDVEIGR--------DVVIEPNVILEGNTVIGDNVVIGPGSVI-KDSVIGDNAVI 312 >gnl|CDD|100060 cd05636, LbH_G1P_TT_C_like, Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains. Members in this family are predicted to be glucose-1-phosphate thymidylyltransferases, which are involved in the dTDP-L-rhamnose biosynthetic pathway. Glucose-1-phosphate thymidylyltransferase catalyzes the synthesis of deoxy-thymidine di-phosphate (dTDP)-L-rhamnose, an important component of the cell wall of many microorganisms. The C-terminal LbH domain contains multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity.. Length = 163 Score = 39.9 bits (94), Expect = 8e-04 Identities = 21/67 (31%), Positives = 27/67 (40%), Gaps = 12/67 (17%) Query: 156 AQIGKNVHISGGVGI--GGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVF 213 I V I G + G +E GP II C IG IR +VLG G Sbjct: 12 VTIKGPVWIGEGAIVRSGAYIE----GPVIIGKGCEIGP------NAYIRGYTVLGDGCV 61 Query: 214 IGKSTKI 220 +G S ++ Sbjct: 62 VGNSVEV 68 Score = 34.9 bits (81), Expect = 0.030 Identities = 25/93 (26%), Positives = 38/93 (40%), Gaps = 20/93 (21%) Query: 139 YIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVE 198 +IGEG+++ + + + IGK I I G T++ D C +G E+ Sbjct: 19 WIGEGAIVRSGAYIEGPVIIGKGCEIGPNAYI--------RGYTVLGDGCVVGNSVEVKN 70 Query: 199 GCIIREG-----------SVLGMGVFIGKSTKI 220 II +G SVLG V +G T Sbjct: 71 -SIIMDGTKVPHLNYVGDSVLGENVNLGAGTIT 102 Score = 28.7 bits (65), Expect = 1.7 Identities = 13/37 (35%), Positives = 19/37 (51%) Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKI 220 +E+ I I EG I+R G+ + V IGK +I Sbjct: 8 VEEGVTIKGPVWIGEGAIVRSGAYIEGPVIIGKGCEI 44 >gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase. It is a bifunctional bacterial enzyme that catalyzes two consecutive steps in the formation of UDP-N-acetylglucosamine (UDP-GlcNAc), an important precursor in bacterial cell wall formation. The two enzymatic activities, uridyltransferase and acetyltransferase, are carried out by two independent domains. The C-terminal LbH domain possesses the acetyltransferase activity. It catalyzes the CoA-dependent acetylation of GlcN-1-phosphate to GlcNAc-1-phosphate. The LbH domain contains 10 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X. The acetyltransferase active site is located at the interface between two subunits of the active LbH trimer.. Length = 193 Score = 39.7 bits (94), Expect = 0.001 Identities = 39/123 (31%), Positives = 57/123 (46%), Gaps = 28/123 (22%) Query: 107 HNFRIIPGTIVRHSAYIGPKAVLMP-----------SFVNM-GAYIGEGSMIDTWSTVGS 154 +I G ++ + A +GP A L P +FV + + IGEGS + S +G Sbjct: 60 KASSVIEGAVIGNGATVGPFAHLRPGTVLGEGVHIGNFVEIKKSTIGEGSKANHLSYLGD 119 Query: 155 CAQIGKNVHISGGVGI----GGVLEPIQTGPTIIEDNCFIGARSEIV------EGCIIRE 204 A+IG+ V+I G I GV T+I DN FIG+ S++V +G I Sbjct: 120 -AEIGEGVNIGAGT-ITCNYDGV----NKHRTVIGDNVFIGSNSQLVAPVTIGDGATIAA 173 Query: 205 GSV 207 GS Sbjct: 174 GST 176 Score = 37.8 bits (89), Expect = 0.003 Identities = 27/86 (31%), Positives = 35/86 (40%), Gaps = 16/86 (18%) Query: 145 MIDTWSTVGSCAQIGKNVHISGGVGIGG--VLEPIQT-GPTIIEDNCFIGARSEIVEGCI 201 ID +G I V + G IG V+ P + I D I A S ++EG + Sbjct: 11 YIDGDVEIGVDVVIDPGVILEGKTVIGEDCVIGPNCVIKDSTIGDGVVIKASS-VIEGAV 69 Query: 202 I------------REGSVLGMGVFIG 215 I R G+VLG GV IG Sbjct: 70 IGNGATVGPFAHLRPGTVLGEGVHIG 95 Score = 32.4 bits (75), Expect = 0.16 Identities = 9/39 (23%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Query: 182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKI 220 +I+ + ++ I E C+I V+ IG I Sbjct: 22 VVIDPGVILEGKTVIGEDCVIGPNCVIK-DSTIGDGVVI 59 Score = 28.5 bits (65), Expect = 2.0 Identities = 13/41 (31%), Positives = 19/41 (46%) Query: 182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIID 222 T I+ + IG I G I+ +V+G IG + I D Sbjct: 10 TYIDGDVEIGVDVVIDPGVILEGKTVIGEDCVIGPNCVIKD 50 >gnl|CDD|100051 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E. coli paaY protein, and similar proteins. CAs are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. They are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three evolutionary distinct groups - alpha, beta and gamma carbonic anhydrases - which show no significant sequence identity or structural similarity. Gamma CAs are trimeric enzymes with left-handed parallel beta helix (LbH) structural domain.. Length = 153 Score = 39.3 bits (93), Expect = 0.001 Identities = 29/85 (34%), Positives = 40/85 (47%), Gaps = 13/85 (15%) Query: 140 IGEGSMIDTWSTV----GSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSE 195 IGE + I S + G IG NV + G G VL G TI DNC IG + Sbjct: 41 IGERTNIQDGSVLHVDPGYPTIIGDNVTV----GHGAVLH----GCTI-GDNCLIGMGAI 91 Query: 196 IVEGCIIREGSVLGMGVFIGKSTKI 220 I++G +I +GS++ G + I Sbjct: 92 ILDGAVIGKGSIVAAGSLVPPGKVI 116 Score = 32.8 bits (76), Expect = 0.10 Identities = 17/79 (21%), Positives = 31/79 (39%), Gaps = 15/79 (18%) Query: 140 IGEGSMIDTWS----TVGSCAQIGKNVHISGG-------VGIGGVLEPIQTGPTIIEDNC 188 I +GS++ +G +G + G +G+G + I G +I Sbjct: 47 IQDGSVLHVDPGYPTIIGDNVTVGHGAVLHGCTIGDNCLIGMGAI---ILDG-AVIGKGS 102 Query: 189 FIGARSEIVEGCIIREGSV 207 + A S + G +I GS+ Sbjct: 103 IVAAGSLVPPGKVIPPGSL 121 >gnl|CDD|31245 COG1043, LpxA, Acyl-[acyl carrier protein]. Length = 260 Score = 38.6 bits (90), Expect = 0.002 Identities = 27/117 (23%), Positives = 41/117 (35%), Gaps = 17/117 (14%) Query: 119 HSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQ 178 A I P A++ P GA IGE I + +G +IG + V + G I Sbjct: 2 KMAKIHPTAIIEP-----GAEIGEDVKIGPFCIIGPNVEIGDGTVLKSHVVVEGHTT-IG 55 Query: 179 TGPTII---------EDNCFIGARSEIV--EGCIIREGSVLGMGVFIGKSTKIIDRN 224 I +D + G + ++ + IRE + G G I N Sbjct: 56 RNNRIFPFASIGEDPQDLKYKGEPTRLIIGDNNTIREFVTIHRGTVQGGGVTRIGDN 112 Score = 33.6 bits (77), Expect = 0.069 Identities = 39/166 (23%), Positives = 61/166 (36%), Gaps = 36/166 (21%) Query: 72 QINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMP 131 +I+PT II G A+ + + +I P I+ + IG VL Sbjct: 5 KIHPTAIIEPG-----------AEIGE---------DVKIGPFCIIGPNVEIGDGTVLKS 44 Query: 132 SFVNMGA-YIGEGSMIDTWSTVGSCAQ------------IGKNVHISGGVGIG-GVLEPI 177 V G IG + I ++++G Q IG N I V I G ++ Sbjct: 45 HVVVEGHTTIGRNNRIFPFASIGEDPQDLKYKGEPTRLIIGDNNTIREFVTIHRGTVQGG 104 Query: 178 QTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDR 223 G T I DN I A + + C+I +L + ++ D Sbjct: 105 --GVTRIGDNNLIMAYAHVAHDCVIGNNCILANNATLAGHVEVGDY 148 Score = 29.8 bits (67), Expect = 0.83 Identities = 20/114 (17%), Positives = 41/114 (35%), Gaps = 25/114 (21%) Query: 140 IGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEG 199 IG+ ++I ++ V IG N ++ + G +E + D IG S + + Sbjct: 109 IGDNNLIMAYAHVAHDCVIGNNCILANNATLAGHVE--------VGDYAIIGGLSAVHQF 160 Query: 200 CIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV--PGSYPSINLKG 251 I +++G + + +VP Y + +N+ G Sbjct: 161 VRIGAHAMIGGLSAVSQ---------------DVPPYVIASGNHARLRGLNIVG 199 >gnl|CDD|100048 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain. WcxM is thought to be bifunctional, catalyzing both the isomerization and transacetylation reactions of keto-hexoses. It contains an N-terminal LbH domain responsible for the transacetylation function and a C-terminal isomerase domain. The LbH domain contains imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X), typical of enzymes with acyltransferase activity.. Length = 119 Score = 37.1 bits (87), Expect = 0.006 Identities = 21/91 (23%), Positives = 33/91 (36%), Gaps = 19/91 (20%) Query: 140 IGEGSMIDTWSTVGSCAQIGKNVHISGGVGIG-------------------GVLEPIQTG 180 IG I+ +G +I NV I GV I + + Sbjct: 7 IGTNVFIENDVKIGDNVKIQSNVSIYEGVTIEDDVFIGPNVVFTNDLYPRSKIYRKWELK 66 Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMG 211 T ++ IGA + I+ G I E +++G G Sbjct: 67 GTTVKRGASIGANATILPGVTIGEYALVGAG 97 Score = 32.5 bits (75), Expect = 0.12 Identities = 17/58 (29%), Positives = 21/58 (36%), Gaps = 14/58 (24%) Query: 158 IGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIG 215 IG N I V IE++ IG +I I EG + VFIG Sbjct: 1 IGDNCIIGTNV--------------FIENDVKIGDNVKIQSNVSIYEGVTIEDDVFIG 44 Score = 26.7 bits (60), Expect = 7.3 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 5/35 (14%) Query: 112 IPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMI 146 + GT V+ A IG A ++P G IGE +++ Sbjct: 65 LKGTTVKRGASIGANATILP-----GVTIGEYALV 94 >gnl|CDD|100063 cd05825, LbH_wcaF_like, wcaF-like: This group is composed of the protein product of the E. coli wcaF gene and similar proteins. WcaF is part of the gene cluster responsible for the biosynthesis of the extracellular polysaccharide colanic acid. The wcaF protein is predicted to contain a left-handed parallel beta-helix (LbH) domain encoded by imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity. Many are trimeric in their active forms.. Length = 107 Score = 36.8 bits (86), Expect = 0.006 Identities = 25/90 (27%), Positives = 38/90 (42%), Gaps = 13/90 (14%) Query: 131 PSFVNMGAY--IGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGG-------VLEPIQTGP 181 P + +G IGEG I + V IG + IS G + P+ T P Sbjct: 1 PWNLTIGDNSWIGEGVWIYNLAPV----TIGSDACISQGAYLCTGSHDYRSPAFPLITAP 56 Query: 182 TIIEDNCFIGARSEIVEGCIIREGSVLGMG 211 +I D ++ A + + G I EG+V+G Sbjct: 57 IVIGDGAWVAAEAFVGPGVTIGEGAVVGAR 86 Score = 26.4 bits (59), Expect = 8.7 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 6/53 (11%) Query: 101 TKDFEKHNFRIIPGTIVRHSAYIGPKA-VLMPSFVNMGAYIGEGSMIDTWSTV 152 + D+ F +I IV IG A V +FV G IGEG+++ S V Sbjct: 42 SHDYRSPAFPLITAPIV-----IGDGAWVAAEAFVGPGVTIGEGAVVGARSVV 89 >gnl|CDD|30459 COG0110, WbbJ, Acetyltransferase (isoleucine patch superfamily) [General function prediction only]. Length = 190 Score = 35.3 bits (80), Expect = 0.020 Identities = 24/74 (32%), Positives = 34/74 (45%), Gaps = 1/74 (1%) Query: 138 AYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIV 197 +GEG I VG I N H G + + GP I ++ +IGA + I+ Sbjct: 82 ILVGEGITIGDNVVVGPNVTIYTNSHP-GDFVTANIGALVGAGPVTIGEDVWIGAGAVIL 140 Query: 198 EGCIIREGSVLGMG 211 G I EG+V+G G Sbjct: 141 PGVTIGEGAVIGAG 154 >gnl|CDD|36675 KOG1462, KOG1462, KOG1462, Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis]. Length = 433 Score = 34.5 bits (79), Expect = 0.030 Identities = 33/129 (25%), Positives = 53/129 (41%), Gaps = 21/129 (16%) Query: 113 PGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKN-VHISGGVGIG 171 P ++ AYI P L + +Y+ E + + S A+ KN V VG Sbjct: 276 PDDRIKCYAYILPTESLFVRANTLLSYM-EINRDKKLKKLCSEAKFVKNYVKKVALVGAD 334 Query: 172 GVLEP-IQTGP------TIIEDNCFIGARSEIV-----------EGCIIREGSVLGMGVF 213 ++ Q G ++I NC IG R ++ +G I E S++GMG Sbjct: 335 SIVGDNTQIGENSNIKRSVIGSNCDIGERVKVANSILMDNVVVGDGVNI-ENSIIGMGAQ 393 Query: 214 IGKSTKIID 222 IG +K+ + Sbjct: 394 IGSGSKLKN 402 >gnl|CDD|100042 cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc. It is the first enzyme in the lipid A biosynthetic pathway and is also referred to as LpxA. Lipid A is essential for the growth of Escherichia coli and related bacteria. It is also essential for maintaining the integrity of the outer membrane. UDP-GlcNAc acyltransferase is a homotrimer of left-handed parallel beta helix (LbH) subunits. Each subunit contains an N-terminal LbH region with 9 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X), and a C-terminal alpha-helical region.. Length = 254 Score = 34.3 bits (80), Expect = 0.035 Identities = 23/76 (30%), Positives = 31/76 (40%), Gaps = 20/76 (26%) Query: 145 MIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIRE 204 MI + V A+IG+NV I GP C IG EI +G +I Sbjct: 1 MIHPTAIVDPGAKIGENVEI---------------GP-----FCVIGPNVEIGDGTVIGS 40 Query: 205 GSVLGMGVFIGKSTKI 220 V+ IGK+ +I Sbjct: 41 HVVIDGPTTIGKNNRI 56 Score = 33.9 bits (79), Expect = 0.046 Identities = 30/124 (24%), Positives = 40/124 (32%), Gaps = 38/124 (30%) Query: 120 SAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQT 179 +A + P A IGE I + +G +IG I V I Sbjct: 5 TAIVDPGAK-----------IGENVEIGPFCVIGPNVEIGDGTVIGSHVVI--------D 45 Query: 180 GPTIIEDNCFI----------------GARS--EIVEGCIIREGSVLGMGVFIGKS-TKI 220 GPT I N I G + EI + IRE + G G T+I Sbjct: 46 GPTTIGKNNRIFPFASIGEAPQDLKYKGEPTRLEIGDNNTIREFVTIHRGTAQGGGVTRI 105 Query: 221 IDRN 224 + N Sbjct: 106 GNNN 109 Score = 29.3 bits (67), Expect = 1.2 Identities = 24/115 (20%), Positives = 40/115 (34%), Gaps = 27/115 (23%) Query: 140 IGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGG-VLEPIQTGPTIIEDNCFIGARSEIVE 198 IG +++ + V IG NV ++ + G V I D IG S + + Sbjct: 105 IGNNNLLMAYVHVAHDCVIGNNVILANNATLAGHV---------EIGDYAIIGGLSAVHQ 155 Query: 199 GCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV--PGSYPSINLKG 251 C I G +G + ++ +VP Y + +NL G Sbjct: 156 FCRI------GRHAMVGGGSGVV---------QDVPPYVIAAGNRARLRGLNLVG 195 >gnl|CDD|100047 cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).. Length = 169 Score = 33.9 bits (79), Expect = 0.052 Identities = 22/83 (26%), Positives = 34/83 (40%), Gaps = 8/83 (9%) Query: 133 FVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGG---VGIGGVLEPIQTG-PTIIEDNC 188 + N I + + + T+G IG NV I + ++ P I DN Sbjct: 70 YANFNCTILDVAPV----TIGDNVLIGPNVQIYTAGHPLDPEERNRGLEYAKPITIGDNV 125 Query: 189 FIGARSEIVEGCIIREGSVLGMG 211 +IG I+ G I + SV+G G Sbjct: 126 WIGGGVIILPGVTIGDNSVIGAG 148 >gnl|CDD|36536 KOG1322, KOG1322, KOG1322, GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis]. Length = 371 Score = 33.3 bits (76), Expect = 0.069 Identities = 19/90 (21%), Positives = 34/90 (37%), Gaps = 6/90 (6%) Query: 107 HNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYI-----GEGSMIDTWSTVGSCAQIGKN 161 N I P + + +L + + I G I W+ + A +GKN Sbjct: 281 PNVVIGPRVRIEDGVRLQDSTILGADYYETHSEISSSIVGWNVPIGIWARIDKNAVLGKN 340 Query: 162 VHISGGVGI-GGVLEPIQTGPTIIEDNCFI 190 V ++ + G PI++G T++ I Sbjct: 341 VIVADEDYVNEGSGLPIKSGITVVLKPAII 370 Score = 27.9 bits (62), Expect = 2.9 Identities = 19/81 (23%), Positives = 30/81 (37%), Gaps = 4/81 (4%) Query: 134 VNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGAR 193 V+ A IGE I +G +I V + +G +T I + +G Sbjct: 267 VDSIASIGENCSIGPNVVIGPRVRIEDGVRLQDSTILGADY--YETHSEI--SSSIVGWN 322 Query: 194 SEIVEGCIIREGSVLGMGVFI 214 I I + +VLG V + Sbjct: 323 VPIGIWARIDKNAVLGKNVIV 343 Score = 27.5 bits (61), Expect = 4.0 Identities = 12/47 (25%), Positives = 19/47 (40%) Query: 176 PIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIID 222 P + I N + + + I E C I V+G V I ++ D Sbjct: 253 PRLLPGSKIVGNVLVDSIASIGENCSIGPNVVIGPRVRIEDGVRLQD 299 >gnl|CDD|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma. Most members of this family contains an N-terminal catalytic domain that resembles a dinucleotide-binding Rossmann fold, followed by a LbH fold domain with at least 4 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). eIF-2B epsilon contains an additional domain of unknown function at the C-terminus. Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity.. Length = 79 Score = 31.8 bits (73), Expect = 0.22 Identities = 24/83 (28%), Positives = 31/83 (37%), Gaps = 16/83 (19%) Query: 120 SAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQT 179 S IG A++ S + IG+G I S + IG N I Sbjct: 5 STVIGENAIIKNSVIGDNVRIGDGVTITN-SILMDNVTIGANSVIVD------------- 50 Query: 180 GPTIIEDNCFIGARSEIVEGCII 202 +II DN IG +V CII Sbjct: 51 --SIIGDNAVIGENVRVVNLCII 71 Score = 26.8 bits (60), Expect = 7.0 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Query: 111 IIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGI 170 II +++ + IG + S + IG S+I S +G A IG+NV + I Sbjct: 13 IIKNSVIGDNVRIGDGVTITNSILMDNVTIGANSVI-VDSIIGDNAVIGENVRVVNLCII 71 Query: 171 G 171 G Sbjct: 72 G 72 >gnl|CDD|100056 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase. It catalyzes the first committed and rate-limiting step in starch biosynthesis in plants and glycogen biosynthesis in bacteria. It is the enzymatic site for regulation of storage polysaccharide accumulation in plants and bacteria. The enzyme is a homotetramer, with each subunit containing an N-terminal catalytic domain that resembles a dinucleotide-binding Rossmann fold and a C-terminal LbH fold domain with at 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). The LbH domain is involved in cooperative allosteric regulation and oligomerization.. Length = 104 Score = 30.9 bits (71), Expect = 0.40 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 4/34 (11%) Query: 193 RSEIVEGCIIREG----SVLGMGVFIGKSTKIID 222 S + EGCII G SVL GV +G + + D Sbjct: 12 NSLVSEGCIISGGTVENSVLFRGVRVGSGSVVED 45 Score = 27.0 bits (61), Expect = 6.2 Identities = 24/78 (30%), Positives = 32/78 (41%), Gaps = 19/78 (24%) Query: 110 RIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVG 169 R+ G++V S V+MP IG ++I A I KNV I GV Sbjct: 36 RVGSGSVVEDS-------VIMP-----NVGIGRNAVIR-------RAIIDKNVVIPDGVV 76 Query: 170 IGGVLEPIQTGPTIIEDN 187 IGG E + + ED Sbjct: 77 IGGDPEEDRARFYVTEDG 94 >gnl|CDD|100040 cd03349, LbH_XAT, Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others. Members of this class of enzymes include Enterococcus faecium streptogramin A acetyltransferase and Pseudomonas aeruginosa chloramphenicol acetyltransferase. They contain repeated copies of a six-residue hexapeptide repeat sequence motif (X-[STAV]-X-[LIV]-[GAED]-X) and adopt a left-handed parallel beta helix (LbH) structure. The active enzyme is a trimer with CoA and substrate binding sites at the interface of two separate LbH subunits. XATs are implicated in inactivating xenobiotics leading to xenobiotic resistance in patients.. Length = 145 Score = 31.0 bits (71), Expect = 0.43 Identities = 26/134 (19%), Positives = 46/134 (34%), Gaps = 43/134 (32%) Query: 133 FVNMGA--YIGEG--SMIDTWSTVGSCAQIGKNVHISGG--------------VGIGGVL 174 +++G Y + ++G I V I G + G Sbjct: 1 NISVGDYSYGSGPDCDVGGDKLSIGKFCSIAPGVKIGLGGNHPTDWVSTYPFYIFGGEWE 60 Query: 175 EPIQ------TGPTIIEDNCFIGARSEIVEGCIIREGSVLGMG--VFIGKSTKIIDRNTG 226 + + G II ++ +IG + I+ G I +G+V+ G V TK Sbjct: 61 DDAKFDDWPSKGDVIIGNDVWIGHGATILPGVTIGDGAVIAAGAVV-----TK------- 108 Query: 227 EITYGEVPSYSVVV 240 +VP Y++V Sbjct: 109 -----DVPPYAIVG 117 >gnl|CDD|100058 cd04745, LbH_paaY_like, paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E. coli paaY gene, which is part of the paa gene cluster responsible for phenylacetic acid degradation. Proteins in this group are expected to adopt the left-handed parallel beta-helix (LbH) structure. They contain imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Similarity to gamma carbonic anhydrase and Ferripyochelin Binding Protein (FBP) may suggest metal binding capacity.. Length = 155 Score = 30.8 bits (70), Expect = 0.43 Identities = 26/100 (26%), Positives = 40/100 (40%), Gaps = 25/100 (25%) Query: 111 IIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGI 170 +I I+ + YIGP A L F G ++ + A + N I G G Sbjct: 15 LIGDVIIGKNCYIGPHASLRGDF---------GRIV-----IRDGANVQDNCVIHGFPGQ 60 Query: 171 GGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGM 210 T++E+N IG I+ GC I +++GM Sbjct: 61 D----------TVLEENGHIG-HGAILHGCTIGRNALVGM 89 >gnl|CDD|111866 pfam03022, MRJP, Major royal jelly protein. Royal jelly is the food of queen bee larvae, and is responsible for the high reproductive ability of the queen. Major royal jelly proteins make up around 90% of larval jelly proteins. This family also the sequence-related yellow protein of drosophila which controls pigmentation of the adult cuticle and larval mouth parts. Length = 285 Score = 30.4 bits (69), Expect = 0.63 Identities = 27/111 (24%), Positives = 43/111 (38%), Gaps = 20/111 (18%) Query: 18 ESNSKNESIPQDVKD----AVQSTLDLLDRG---IIRIASRDDNGHWNTHQWIKKAILLS 70 E+N N + +D KD QST +D + ++ G WNT +A L Sbjct: 166 ETNWGNNAQYEDFKDLGDRNTQSTALAVDPNGVLFFGLVGQNAVGCWNTSTPYSRANLGV 225 Query: 71 FQINPTKIIS------DGNGYSTWW---DKIPAKFDDWKTKDFEKHNFRII 112 N + D Y W +++ KF D+++ NFRI+ Sbjct: 226 VARNSDTLQFPSDLKIDKEEY--LWVLSNRMQ-KFLYNDL-DYDEVNFRIL 272 >gnl|CDD|34410 COG4801, COG4801, Predicted acyltransferase [General function prediction only]. Length = 277 Score = 28.7 bits (64), Expect = 1.6 Identities = 16/35 (45%), Positives = 17/35 (48%) Query: 138 AYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGG 172 AYIGE S I TV IG +V I GG G Sbjct: 75 AYIGEFSSIKGKLTVIGDLDIGADVIIEGGFVAKG 109 >gnl|CDD|30653 COG0305, DnaB, Replicative DNA helicase [DNA replication, recombination, and repair]. Length = 435 Score = 28.6 bits (64), Expect = 1.7 Identities = 7/36 (19%), Positives = 16/36 (44%) Query: 8 LEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDR 43 L+ F+ + KN + D ++ T+D ++ Sbjct: 134 LDAAEKKIFDVAERKNSEDFVHIGDLLKETMDEIEA 169 >gnl|CDD|100057 cd04652, LbH_eIF2B_gamma_C, eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon). eIF2B is important for regenerating GTP-bound eIF2 during the initiation process. This event is obligatory for eIF2 to bind initiator methionyl-tRNA, forming the ternary initiation complex. The eIF-2B gamma subunit contains an N-terminal domain that resembles a dinucleotide-binding Rossmann fold and a C-terminal LbH domain with 4 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). The epsilon and gamma subunits form the catalytic subcomplex of eIF-2B, which binds eIF2 and catalyzes guanine nucleotide exchange.. Length = 81 Score = 28.7 bits (65), Expect = 2.1 Identities = 26/94 (27%), Positives = 35/94 (37%), Gaps = 30/94 (31%) Query: 150 STVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLG 209 S +G+ +IGK V I+ V + V IED C +E CII G Sbjct: 17 SVIGANCKIGKRVKITNCVIMDNV---------TIEDGC-------TLENCII------G 54 Query: 210 MGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243 G IG+ K + V S V G+ Sbjct: 55 NGAVIGEKCK--------LKDCLVGSGYRVEAGT 80 >gnl|CDD|100059 cd05635, LbH_unknown, Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity.. Length = 101 Score = 28.4 bits (64), Expect = 2.4 Identities = 13/46 (28%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Query: 108 NFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVG 153 + I P ++ YIGP + V MGA I + I +G Sbjct: 17 DAVIEPFAVIEGPVYIGPGSR-----VKMGARIYGNTTIGPTCKIG 57 >gnl|CDD|146886 pfam04465, DUF499, Protein of unknown function (DUF499). Family of uncharacterized hypothetical prokaryotic proteins. Length = 1025 Score = 28.3 bits (63), Expect = 2.5 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 7 TLEEIIDSFFE-ESNSKNESIPQDVKDAVQ 35 T E+I +E E+ KN +P D+KDA++ Sbjct: 366 TPEDIARGVYEPETFEKNNWLPVDIKDALE 395 >gnl|CDD|30797 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism]. Length = 393 Score = 27.8 bits (62), Expect = 3.4 Identities = 25/99 (25%), Positives = 35/99 (35%), Gaps = 23/99 (23%) Query: 140 IGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEG 199 + G +I TV + + + V I G I +N I EI EG Sbjct: 299 VAGGCIIS--GTVENSV-LFRGVRIGKGSVI---------------ENSVIMPDVEIGEG 340 Query: 200 CIIR-----EGSVLGMGVFIGKSTKIIDRNTGEITYGEV 233 ++R + V+G GV IG DR G V Sbjct: 341 AVLRRAIIDKNVVIGEGVVIGGDKPEEDRKRFRSEEGIV 379 Score = 27.5 bits (61), Expect = 4.2 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 3/32 (9%) Query: 194 SEIVEGCIIR---EGSVLGMGVFIGKSTKIID 222 S + GCII E SVL GV IGK + I + Sbjct: 297 SLVAGGCIISGTVENSVLFRGVRIGKGSVIEN 328 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.318 0.137 0.414 Gapped Lambda K H 0.267 0.0623 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,524,856 Number of extensions: 189758 Number of successful extensions: 711 Number of sequences better than 10.0: 1 Number of HSP's gapped: 513 Number of HSP's successfully gapped: 93 Length of query: 285 Length of database: 6,263,737 Length adjustment: 93 Effective length of query: 192 Effective length of database: 4,254,100 Effective search space: 816787200 Effective search space used: 816787200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 57 (26.0 bits)