HHsearch alignment for GI: 254780782 and conserved domain: COG4187

>COG4187 RocB Arginine degradation protein (predicted deacylase) [Amino acid transport and metabolism].
Probab=99.94  E-value=4.2e-26  Score=179.32  Aligned_cols=218  Identities=22%  Similarity=0.318  Sum_probs=159.7

Q ss_pred             HHHHHHHHHHHCCCCCCC--CHHHHHHHHHHHHHHCCC-EEEEEEECC---CCCC-EEEEEEEEE-C-CCCCEEEEECCC
Q ss_conf             789999999964999789--968999999999997798-489997058---8876-248999998-7-999889997336
Q gi|254780782|r    3 PDCLEHLIQLIKCPSVTP--QDGGAFFILVNTLKLLGF-SIEEKDFQT---KNTS-IVKNLYARF-G-TEAPHLMFAGHI   73 (389)
Q Consensus         3 ~e~v~~l~~lv~ips~s~--~e~~~~~~l~~~l~~~G~-~~~~~~~~~---~~~~-~~~~~~~~~-g-~~~~~ill~~H~   73 (389)
T Consensus         8 e~v~~lt~~LV~~~SvtgT~GE~a~ad~l~~vL~~~pYFqehped~~~~pi~nDpygR~nv~AlVrg~~~k~tvvl~gH~   87 (553)
T COG4187           8 ERVRALTLSLVSWPSVTGTPGEGAFADRLLGVLGELPYFQEHPEDLWLQPIHNDPYGRRNVFALVRGGTSKRTVVLHGHF   87 (553)
T ss_pred             HHHHHHHHHHEECCCCCCCCCCCCHHHHHHHHHHCCCHHHHCHHHHCCCCCCCCCCCCCEEEEEEECCCCCCEEEEEECC
T ss_conf             99999998870020247986632088999999715825553947650257778866541169998458877348996033


Q ss_pred             CCCCCC---CHHHCCCCCC----------CE----E----EECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEE
Q ss_conf             815788---8777256664----------22----4----5213323654433320124544100000001135783499
Q gi|254780782|r   74 DVVPPG---DFNHWTYPPF----------SA----T----IAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISL  132 (389)
Q Consensus        74 Dtvp~~---~~~~W~~~Pf----------~~----~----~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~~~~~i~~  132 (389)
T Consensus        88 DtV~iedYg~lKd~Afdp~~ll~~~i~~~e~~~erv~~Dl~SGDwlfGRGa~DMKsGlav~la~L~~fa~~~~~~GNlLf  167 (553)
T COG4187          88 DTVSIEDYGELKDLAFDPLALLDALIESLELREERVLRDLESGDWLFGRGALDMKSGLAVHLACLEEFAARTDRQGNLLF  167 (553)
T ss_pred             CEEECCCCCCHHHHCCCHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCEEE
T ss_conf             24541236626643369899999999862158898864354068455777212220059999999998627787775799


Q ss_pred             EEEEECCCEECCCCCCCCCCCCCCCC----CCCEEEECCCCCCCCCCE---EEEEEEEEEEEEEEEEEEECCCCHHHHCC
Q ss_conf             97520220110442111110001332----120354145665434310---01232223579999996412310000001
Q gi|254780782|r  133 LITGDEEGPAINGTKKMLSWIEKKGE----KWDACIVGEPTCNHIIGD---TIKIGRRGSLSGEITIHGKQGHVAYPHLT  205 (389)
Q Consensus       133 ~~~~dEE~~~~~G~~~l~~~~~~~~~----~~d~~i~~ep~~~~~~~~---~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g  205 (389)
T Consensus       168 ~a~pdEE~~s-~G~r~a~~~L~~L~kk~~l~~~~~IN~D~~~~~~dGd~~ryvYtGtiGKLLp~f~vvG~etHvG~~f~G  246 (553)
T COG4187         168 MAVPDEEVES-RGMREARPALPGLKKKFDLEYTAAINLDVTSDQGDGDQGRYVYTGTIGKLLPFFFVVGCETHVGYPFEG  246 (553)
T ss_pred             EECCCHHHHC-CCHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCCCCEEEEECCCHHHCCEEEEEEECCCCCCCCCC
T ss_conf             8466054202-128877788888777508537887314444678898644178823203102135897411336776467


Q ss_pred             CCHHHHHHHHHHCCCC
Q ss_conf             2013455443201122
Q gi|254780782|r  206 ENPIRGLIPLLHQLTN  221 (389)
Q Consensus       206 ~nAi~~~~~~i~~l~~  221 (389)
T Consensus       247 vnan~maSei~~~le~  262 (553)
T COG4187         247 VNANFMASEITRRLEL  262 (553)
T ss_pred             CCHHHHHHHHHHHHHC
T ss_conf             7788899999998515