HHsearch alignment for GI: 254780782 and conserved domain: PRK12892

>PRK12892 allantoate amidohydrolase; Reviewed.
Probab=100.00  E-value=6e-40  Score=264.33  Aligned_cols=342  Identities=18%  Similarity=0.233  Sum_probs=259.9

Q ss_pred             HHHHHHHHHCCC---------CCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEE-CC--CCCEEEEECC
Q ss_conf             999999996499---------97899689999999999977984899970588876248999998-79--9988999733
Q gi|254780782|r    5 CLEHLIQLIKCP---------SVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF-GT--EAPHLMFAGH   72 (389)
Q Consensus         5 ~v~~l~~lv~ip---------s~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~-g~--~~~~ill~~H   72 (389)
T Consensus        12 l~~~l~~l~~ig~~~~GvtR~a~s~~d~~ar~~l~~~~~~~Gl~v~~D--------~~GNl~g~~~G~~~~~p~v~~GSH   83 (413)
T PRK12892         12 ILDDLMELAAIGTAKTGVHRPTLSDAHRAARRRLAAWCEAAGLAVRID--------GIGNVFGRLPGPGPHLPAIMVGSH   83 (413)
T ss_pred             HHHHHHHHHCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHCCCEEEEE--------CCCCEEEEECCCCCCCCEEEECCC
T ss_conf             999999996237999952317589999999999999999869979880--------788889993488888870565143


Q ss_pred             CCCCCCCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCC----EECCCCC
Q ss_conf             6815788877725666422452133236544333201245441000000011-3578349997520220----1104421
Q gi|254780782|r   73 IDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEG----PAINGTK  147 (389)
Q Consensus        73 ~Dtvp~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~----~~~~G~~  147 (389)
T Consensus        84 lDTVp~GG----~f--------DG~----------lGVlaale~~~~l~e~g~~~~~~i~Vv~f~~EEGsRF~~~~~GS~  141 (413)
T PRK12892         84 LDSQPLGG----RY--------DGA----------LGVVAGLEAARALNEHGIATRHPLDVVAWCDEEGSRFTGGFLGSR  141 (413)
T ss_pred             CCCCCCCC----CC--------CCH----------HHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCCCCCCCCCCHH
T ss_conf             12467886----53--------735----------677999999999997399678996799970665654676532368


Q ss_pred             CCCCCCCCC----------CCCCC-----EEEEC------CCCC----------------CCCCCEEEEEEEEEEEEEEE
Q ss_conf             111100013----------32120-----35414------5665----------------43431001232223579999
Q gi|254780782|r  148 KMLSWIEKK----------GEKWD-----ACIVG------EPTC----------------NHIIGDTIKIGRRGSLSGEI  190 (389)
Q Consensus       148 ~l~~~~~~~----------~~~~d-----~~i~~------ep~~----------------~~~~~~~i~~g~rG~~~~~i  190 (389)
T Consensus       142 ~~~G~l~~~~~~~~~d~~dG~sl~~al~~~G~~~~~~~~~~~~~~~a~lElHIEQGpvLe~~~~~iGIVt~I~G~~r~~v  221 (413)
T PRK12892        142 VYAGALDPADLDAARDRTTGVPLRDALAAAGLAGRPRLAADRARPKGYLEAHIEQGPVLEAAGLPVGVVTGIVGIWQYRI  221 (413)
T ss_pred             HHHCCCCHHHHHHCCCCCCCCCHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHCCCHHHHCCCCEEEEEEECCEEEEEE
T ss_conf             88288899999735046689599999997699986333467100247999988617268768984568842134068999


Q ss_pred             EEEEECCCCHH-H-HCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHH
Q ss_conf             99641231000-0-001201345544320112233445664421014667655420466655432116651343420677
Q gi|254780782|r  191 TIHGKQGHVAY-P-HLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWN  268 (389)
Q Consensus       191 ~v~G~~~Hs~~-p-~~g~nAi~~~~~~i~~l~~~~~~~~~~~~~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~  268 (389)
T Consensus       222 ~i~G~a~HAGtTPM~~R~DAl~aAa~~i~~~~~~~~~~~----~~~v~TVG~i~v~P~~~NvIPg~v~ftvDiR~~d~~~  297 (413)
T PRK12892        222 TVTGEANHAGTTPMAVRRDAMGLAAAMIAALIEHPHACG----PDAVVTVGRVALDPGSPSIIPGKVEFSFDIRHPSPPV  297 (413)
T ss_pred             EEEEECCCCCCCCHHHHCCHHHHHHHHHHHHHHHHHHCC----CCCEEEEEEEEECCCCCEECCCEEEEEEECCCCCHHH
T ss_conf             998537888998624411489999999999999998609----9828986489735874133265479999815799899


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHCCCE-
Q ss_conf             9999999999876532420343112322266311257867899999999999982899579741454358898605989-
Q gi|254780782|r  269 EKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPV-  347 (389)
Q Consensus       269 ~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~~~iP~-  347 (389)
T Consensus       298 l~~~~~~i~~~~~~ia~-~~gv~~~~~~~~~~~p~~~--d~~l~~~i~~aa~~-~g~~~~~m~SGAGHDA~~~a~~~Pt~  373 (413)
T PRK12892        298 LQRLVALLEALCNEIAA-RRGCRVDVDRIAEYAPAPC--DAALVDAIRAAAEA-AGGPYLEMPSGAGHDAQNLARIAPAA  373 (413)
T ss_pred             HHHHHHHHHHHHHHHHH-HCCCEEEEEEEECCCCCCC--CHHHHHHHHHHHHH-CCCCCEEECCCHHHHHHHHHHHCCEE
T ss_conf             99999999999999999-7197189999860798587--99999999999996-69997264750579999987448889


Q ss_pred             EEEEECCCCC-CCCCCEEEHHHHHHHHHHHHHHHHHHC
Q ss_conf             9990047873-687840479999999999999999872
Q gi|254780782|r  348 IEFGLVGRTM-HALNENASLQDLEDLTCIYENFLQNWF  384 (389)
Q Consensus       348 v~fGp~~~~~-H~pdE~i~i~~l~~~~~~~~~~i~~~~  384 (389)
T Consensus       374 MiFVps~~GiSH~p~E~t~~eD~~~g~~vL~~~l~~LA  411 (413)
T PRK12892        374 MLFVPSKGGISHNPAEDTSIDDLVQGARVLADTLRRLA  411 (413)
T ss_pred             EEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             99804899846892326999999999999999999984