HHsearch alignment for GI: 254780782 and conserved domain: TIGR01892

>TIGR01892 AcOrn-deacetyl acetylornithine deacetylase (ArgE); InterPro: IPR010169 This entry represents a clade of acetylornithine deacetylases (argE) from proteobacteria, which catalyse the final step in arginine biosynthesis. The enzyme is closely related to and may share a common origin with dapE (succinyl-diaminopimelate desuccinylase), cpg2 (carboxypeptidase G2) and ACY1 (aminoacylase I), all of which are members of the metal-dependent aminoacylase family, ArgE/dapE/ACY1/CPG2/yscS .; GO: 0008270 zinc ion binding, 0008777 acetylornithine deacetylase activity, 0050897 cobalt ion binding, 0006526 arginine biosynthetic process, 0005737 cytoplasm.
Probab=100.00  E-value=0  Score=472.70  Aligned_cols=360  Identities=26%  Similarity=0.372  Sum_probs=308.3

Q ss_pred             HHHHHHHCCCCCCCCHH-------HHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEECCC----CCEEEEECCCCC
Q ss_conf             99999964999789968-------9999999999977984899970588876248999998799----988999733681
Q gi|254780782|r    7 EHLIQLIKCPSVTPQDG-------GAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE----APHLMFAGHIDV   75 (389)
Q Consensus         7 ~~l~~lv~ips~s~~e~-------~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g~~----~~~ill~~H~Dt   75 (389)
T Consensus         1 ~il~~LvA~~s~s~~eealdqsN~~li~~~~~yL~~~G~~~~~~p~~~~~Gv~k~Nl~A~iGp~~G~G~~G~~L~GH~D~   80 (386)
T TIGR01892         1 EILAKLVAFDSTSAREEALDQSNVDLIEWVEDYLEELGFSVEVQPVPDGRGVEKSNLLAVIGPSVGSGAGGLVLSGHTDV   80 (386)
T ss_pred             CCHHHHCCCCCCCHHHHHHCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCEEEEEEEECCCCCCCCCCEEEECCEEE
T ss_conf             90351327653000034312778679999999999649836763488887630466677608786677632688767012


Q ss_pred             CCCCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCEECCCCCCCCCCCCC
Q ss_conf             57888777256664224521332365443332012454410000000113578349997520220110442111110001
Q gi|254780782|r   76 VPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEK  155 (389)
Q Consensus        76 vp~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~  155 (389)
T Consensus        81 VP~-d~~~Wt~Dpf~Lte~dGrLYGrGt~DmKGFlA~~L~A~pdl~~-~~Lk~Pl~~~~t~DEE~g~-~Ga~~~~~~~~~  157 (386)
T TIGR01892        81 VPV-DDAAWTRDPFRLTEKDGRLYGRGTCDMKGFLALALAAAPDLAA-EKLKKPLHLALTADEEVGC-AGAPKMIEALAR  157 (386)
T ss_pred             ECC-CCCCCCCCCCCCEEECCCEECCCCCCHHHHHHHHHHHHHHHHH-HHCCCCEEEEEECCHHHHH-CCHHHHHHHHHH
T ss_conf             347-8788777723000124731047665247899999986446767-6438846776733523212-024899999898


Q ss_pred             CCCCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCCC-----CCCCCC
Q ss_conf             332120354145665434310012322235799999964123100000012013455443201122334-----456644
Q gi|254780782|r  156 KGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGF-----DTGNTT  230 (389)
Q Consensus       156 ~~~~~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~-----~~~~~~  230 (389)
T Consensus       158 ~~~rp~~aivGEPT~l~avR-----AhKG~~~~~v~v~G~~GHSS~p~~G~~Ai~~~~~~l~~~~~l~~~l~~e~~~~~~  232 (386)
T TIGR01892       158 LVLRPALAIVGEPTSLVAVR-----AHKGKASAKVTVRGREGHSSDPDRGVSAIELAAKLLARLVALADKLKREEDLEEA  232 (386)
T ss_pred             HCCCCCEEEEECCCCCEEEC-----CCCCEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             51787778871799862320-----1213054566771112556875244118999999999999999863014777778


Q ss_pred             CCC--EEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHH-----HHHHHCCCCEEEEECCCCCCC
Q ss_conf             210--1466765542046665543211665134342067799999999998765-----324203431123222663112
Q gi|254780782|r  231 FSP--TNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-----GIQNVPKLSHTVHFSSPVSPV  303 (389)
Q Consensus       231 ~~~--~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~-----~~~~~~~~~~~i~~~~~~~p~  303 (389)
T Consensus       233 F~ppy~tl~~G~v~-GG~A~N~i~~~C~~~~d~R~~~G~~p~~l~~~l~~~~~~aldaq~~~~~p~~~~~~~~~~~~Pa~  311 (386)
T TIGR01892       233 FTPPYATLNIGVVK-GGKAVNIIPAACEFVFDLRPIPGMDPEELLALLEKIAEEALDAQVKEKEPGFEVKVELLSAIPAL  311 (386)
T ss_pred             CCCCCCEEEEEEEE-CCCEEEEECCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCC
T ss_conf             75988714420674-68425550346789996068867898999899999987666667744137650368874367888


Q ss_pred             CCCCHHHHHHHHHHHHHHHHCC-CCEEEECCCCCHHHHH-HHCCCEEEEEECC-CCCCCCCCEEEHHHHHHHHHHHHHHH
Q ss_conf             5786789999999999998289-9579741454358898-6059899990047-87368784047999999999999999
Q gi|254780782|r  304 FLTHDRKLTSLLSKSIYNTTGN-IPLLSTSGGTSDARFI-KDYCPVIEFGLVG-RTMHALNENASLQDLEDLTCIYENFL  380 (389)
Q Consensus       304 ~~~~~~~l~~~l~~a~~~~~g~-~~~~~~~gg~~d~~~~-~~~iP~v~fGp~~-~~~H~pdE~i~i~~l~~~~~~~~~~i  380 (389)
T Consensus       312 ~~~~d~~~~~~~~~----l~G~n~~~~~V~Ygt-EAp~~q~lG~~avv~GPG~I~~AHqp~EYv~~~~l~~~~a~~~~~v  386 (386)
T TIGR01892       312 ELEPDAELVAFLEK----LAGANEAAEVVSYGT-EAPQFQELGIEAVVCGPGDIDQAHQPDEYVEIEELKRCRALLERLV  386 (386)
T ss_pred             CCCCCHHHHHHHHH----HCCCCCCCCCCCCCC-CCHHHHHCCCCEEEECCCCCCCCCCCCCCEEHHHHHHHHHHHHHHC
T ss_conf             99887389999999----708898886356403-4125775688789988888765778898212532002489999719