Query         gi|254780782|ref|YP_003065195.1| succinyl-diaminopimelate desuccinylase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 389
No_of_seqs    141 out of 7317
Neff          9.0 
Searched_HMMs 39220
Date          Sun May 29 18:43:57 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780782.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR01246 dapE_proteo succinyl 100.0       0       0  616.5  20.8  373    5-383     1-383 (383)
  2 PRK13009 succinyl-diaminopimel 100.0       0       0  582.8  34.0  372    3-385     2-375 (375)
  3 PRK08588 succinyl-diaminopimel 100.0       0       0  532.6  33.8  368    2-384     1-377 (378)
  4 PRK06837 acetylornithine deace 100.0       0       0  530.2  33.3  374    2-386    19-424 (427)
  5 PRK06915 acetylornithine deace 100.0       0       0  517.9  33.3  374    2-386    16-420 (422)
  6 PRK13013 succinyl-diaminopimel 100.0       0       0  516.3  33.9  380    2-387    13-425 (427)
  7 PRK05111 acetylornithine deace 100.0       0       0  515.4  31.9  362    3-385     5-382 (383)
  8 PRK13983 diaminopimelate amino 100.0       0       0  513.3  33.0  377    1-380     4-398 (399)
  9 PRK13004 peptidase; Reviewed   100.0       0       0  510.6  30.1  369    1-385    13-397 (397)
 10 PRK07522 acetylornithine deace 100.0       0       0  508.1  31.1  367    2-385     4-386 (387)
 11 TIGR03320 ygeY M20/DapE family 100.0       0       0  505.0  29.9  368    2-385    12-395 (395)
 12 TIGR03526 selenium_YgeY putati 100.0       0       0  503.7  29.7  369    1-385    11-395 (395)
 13 PRK08596 acetylornithine deace 100.0       0       0  490.3  32.0  369    2-386    12-418 (421)
 14 PRK08651 succinyl-diaminopimel 100.0       0       0  486.7  29.7  350   25-384     1-371 (371)
 15 TIGR01910 DapE-ArgE acetylorni 100.0       0       0  493.8  22.8  365    6-375     1-427 (427)
 16 PRK07906 hypothetical protein; 100.0       0       0  469.5  29.9  364    2-382     9-436 (437)
 17 PRK06446 hypothetical protein; 100.0       0       0  468.2  30.3  370    2-385     1-432 (433)
 18 TIGR01892 AcOrn-deacetyl acety 100.0       0       0  472.7  22.9  360    7-380     1-386 (386)
 19 PRK08652 acetylornithine deace 100.0       0       0  462.8  30.3  344    2-383     1-346 (349)
 20 PRK09133 hypothetical protein; 100.0       0       0  459.2  32.1  371    2-384    29-463 (464)
 21 PRK08201 hypothetical protein; 100.0       0       0  458.6  30.4  373    2-383    12-452 (455)
 22 COG0624 ArgE Acetylornithine d 100.0       0       0  453.2  29.8  376    2-385    12-408 (409)
 23 PRK13007 dipeptidase; Reviewed 100.0       0       0  452.3  29.9  341    1-380     6-353 (354)
 24 PRK07907 hypothetical protein; 100.0       0       0  448.2  32.0  372    2-383     5-434 (437)
 25 PRK06133 glutamate carboxypept 100.0       0       0  448.6  31.0  360    2-384    44-415 (418)
 26 PRK00466 acetyl-lysine deacety 100.0       0       0  444.0  29.1  334    1-385     8-343 (345)
 27 PRK04443 acetyl-lysine deacety 100.0       0       0  441.5  31.0  344    2-385     5-351 (352)
 28 PRK08737 acetylornithine deace 100.0       0       0  446.0  26.9  347    3-382     6-364 (366)
 29 PRK07338 hypothetical protein; 100.0       0       0  436.5  33.2  363    2-385    16-399 (407)
 30 PRK07205 hypothetical protein; 100.0       0       0  430.6  30.3  356    2-385    10-443 (444)
 31 PRK07318 dipeptidase PepV; Rev 100.0       0       0  426.4  30.4  356    2-384    13-468 (469)
 32 PRK09104 hypothetical protein; 100.0       0       0  425.3  29.3  374    2-384    17-463 (465)
 33 PRK08554 peptidase; Reviewed   100.0       0       0  419.8  32.2  369    4-385     2-438 (438)
 34 PRK07473 carboxypeptidase; Pro 100.0       0       0  419.6  29.4  355    3-383    11-375 (376)
 35 PRK07079 hypothetical protein; 100.0       0       0  417.9  30.7  371    3-384    17-455 (468)
 36 PRK08262 hypothetical protein; 100.0       0       0  416.9  25.4  367    3-383    47-487 (489)
 37 TIGR01880 Ac-peptdase-euk N-ac 100.0       0       0  416.5  11.8  370    4-382    11-429 (433)
 38 TIGR01887 dipeptidaselike dipe 100.0       0       0  363.7  23.2  363    3-380     2-492 (492)
 39 KOG2275 consensus              100.0       0       0  360.3  23.9  371    3-383    25-417 (420)
 40 PRK06156 hypothetical protein; 100.0       0       0  348.1  29.3  364    3-388    48-521 (522)
 41 KOG2276 consensus              100.0       0       0  354.8  22.5  382    2-384    15-471 (473)
 42 pfam01546 Peptidase_M20 Peptid 100.0       0       0  356.6  20.5  305   68-382     1-310 (310)
 43 TIGR01902 dapE-lys-deAc N-acet 100.0       0       0  329.7  20.7  346    7-386     1-352 (352)
 44 PRK13381 peptidase T; Provisio 100.0       0       0  320.1  27.6  357    1-384     5-410 (413)
 45 TIGR01883 PepT-like peptidase  100.0       0       0  331.7  16.4  352    5-380     2-362 (363)
 46 PRK05469 peptidase T; Provisio 100.0       0       0  311.0  28.5  350    3-383     2-404 (405)
 47 TIGR01886 dipeptidase dipeptid 100.0       0       0  306.9  19.9  351    3-383    13-478 (480)
 48 TIGR01893 aa-his-dipept aminoa 100.0 5.9E-43       0  282.8  27.4  362    1-383     1-505 (506)
 49 TIGR01900 dapE-gram_pos succin 100.0 5.6E-45       0  295.3  16.8  340    8-365     1-373 (373)
 50 PRK12893 allantoate amidohydro 100.0 1.1E-41       0  275.0  28.0  341    5-383    12-408 (408)
 51 PRK09290 allantoate amidohydro 100.0 6.1E-42       0  276.6  26.0  345    5-387     9-411 (412)
 52 PRK12890 allantoate amidohydro 100.0   8E-41 1.4E-45  269.7  27.9  342    4-383    10-408 (412)
 53 PRK12892 allantoate amidohydro 100.0   6E-40 1.5E-44  264.3  26.1  342    5-384    12-411 (413)
 54 PRK12891 allantoate amidohydro 100.0 1.7E-38 4.2E-43  255.5  26.8  342    5-384    12-409 (414)
 55 TIGR03176 AllC allantoate amid 100.0 2.6E-38 6.6E-43  254.3  26.6  344    2-383     2-402 (406)
 56 PRK13799 unknown domain/N-carb 100.0 9.4E-38 2.4E-42  250.9  26.0  326   21-383   212-588 (591)
 57 TIGR01879 hydantase amidase, h 100.0 4.7E-38 1.2E-42  252.7  21.5  341    6-383     7-406 (406)
 58 PRK13590 putative bifunctional 100.0 6.4E-37 1.6E-41  245.8  25.6  324   21-383   211-585 (590)
 59 COG1473 AbgB Metal-dependent a 100.0 1.2E-35 3.1E-40  237.9  30.0  365    1-386    10-391 (392)
 60 TIGR01891 amidohydrolases amid 100.0 3.4E-34 8.6E-39  229.0  22.3  332    5-349     1-352 (384)
 61 COG2195 PepD Di- and tripeptid 100.0 2.2E-33 5.6E-38  224.0  18.8  362    1-383     3-411 (414)
 62 TIGR01882 peptidase-T peptidas 100.0 4.4E-27 1.1E-31  185.3  16.1  350    3-383     3-409 (413)
 63 COG4187 RocB Arginine degradat  99.9 4.2E-26 1.1E-30  179.3  14.6  218    3-221     8-262 (553)
 64 COG1363 FrvX Cellulase M and r  99.7   4E-15   1E-19  111.9  21.6  323    3-384     2-347 (355)
 65 pfam07687 M20_dimer Peptidase   99.7 9.9E-18 2.5E-22  127.9   8.1  104  180-285     1-104 (107)
 66 TIGR03106 trio_M42_hydro hydro  99.7 4.8E-15 1.2E-19  111.4  20.4  324    2-387     2-342 (343)
 67 PRK09961 exoaminopeptidase; Pr  99.7 6.7E-14 1.7E-18  104.4  21.0  315    6-383     3-333 (345)
 68 TIGR03107 glu_aminopep glutamy  99.6 9.4E-13 2.4E-17   97.3  21.5  318    7-383     2-341 (350)
 69 PRK09864 putative fructose-spe  99.6 7.3E-13 1.9E-17   98.0  19.4  321    6-383     3-341 (356)
 70 pfam05343 Peptidase_M42 M42 gl  99.1 4.6E-09 1.2E-13   74.6  12.2   67  308-375   222-292 (292)
 71 KOG2194 consensus               98.9   2E-08 5.1E-13   70.7   9.6  127    3-151    57-209 (834)
 72 PRK10199 alkaline phosphatase   98.8 9.8E-09 2.5E-13   72.6   6.2  128   15-155    47-191 (346)
 73 pfam04389 Peptidase_M28 Peptid  98.5 8.3E-08 2.1E-12   66.9   3.8   65   66-152     2-67  (173)
 74 COG2234 Iap Predicted aminopep  97.5 0.00023 5.8E-09   45.8   6.0   56   97-154   220-275 (435)
 75 KOG3946 consensus               97.5 0.00079   2E-08   42.5   8.1  117   19-152    68-200 (338)
 76 PRK09961 exoaminopeptidase; Pr  97.0 0.00063 1.6E-08   43.1   3.3   69   93-169   155-223 (345)
 77 TIGR03107 glu_aminopep glutamy  96.7  0.0013 3.2E-08   41.3   3.1   67   95-169   169-235 (350)
 78 PRK09864 putative fructose-spe  96.0  0.0042 1.1E-07   38.1   2.2   67   94-170   165-231 (356)
 79 KOG2195 consensus               95.8   0.021 5.4E-07   33.7   5.1   78   52-153   337-421 (702)
 80 KOG2526 consensus               95.7   0.069 1.8E-06   30.6   7.4  125   25-167   163-304 (555)
 81 COG4882 Predicted aminopeptida  92.1    0.32 8.2E-06   26.5   4.8   24   15-38     15-38  (486)
 82 COG2195 PepD Di- and tripeptid  92.1    0.21 5.3E-06   27.6   3.8   78   61-147    58-139 (414)
 83 PRK05015 aminopeptidase B; Pro  85.1     2.6 6.7E-05   20.8   8.1  128    4-141   101-248 (424)
 84 PRK02813 putative aminopeptida  82.4    0.75 1.9E-05   24.2   1.7   72  308-380   347-425 (427)
 85 PRK02256 putative aminopeptida  82.3       3 7.6E-05   20.5   4.8   72  308-380   380-458 (459)
 86 TIGR01754 flav_RNR ribonucleot  78.8     3.3 8.3E-05   20.3   4.0  105   10-152     2-107 (145)
 87 cd00433 Peptidase_M17 Cytosol   78.2     4.7 0.00012   19.3   7.6   40    5-44    156-195 (468)
 88 pfam00883 Peptidase_M17 Cytoso  77.2       5 0.00013   19.1   7.3  125    6-140     1-142 (312)
 89 KOG2597 consensus               73.8     6.2 0.00016   18.6   9.4   53   24-76    210-264 (513)
 90 pfam05450 Nicastrin Nicastrin.  73.3     1.9 4.8E-05   21.8   1.5   73   65-155     1-77  (227)
 91 PRK00913 leucyl aminopeptidase  67.3     8.6 0.00022   17.7   8.1   15  369-383   474-488 (491)
 92 pfam02127 Peptidase_M18 Aminop  66.2     3.9 9.9E-05   19.8   1.9   68  311-379   350-424 (425)
 93 PRK09271 flavodoxin; Provision  63.6     7.2 0.00018   18.2   2.9   36   12-47      4-39  (160)
 94 TIGR02610 PHA_gran_rgn putativ  63.5     9.6 0.00025   17.4   3.5   83  195-283     7-89  (91)
 95 COG1362 LAP4 Aspartyl aminopep  61.1      11 0.00029   17.0   6.1   74  308-382   355-435 (437)
 96 pfam01364 Peptidase_C25 Peptid  57.9      13 0.00032   16.7   3.8   95   24-118    22-129 (349)
 97 KOG2596 consensus               56.1       9 0.00023   17.6   2.3   52  333-384   417-470 (479)
 98 TIGR01931 cysJ sulfite reducta  53.0      15 0.00039   16.2   6.1   49   17-65     76-130 (628)
 99 COG0260 PepB Leucyl aminopepti  51.5      16 0.00041   16.0   8.8   14  371-384   471-484 (485)
100 PTZ00323 NAD+ synthase; Provis  48.9      18 0.00045   15.8   5.5   44    1-44      7-52  (294)
101 COG3375 Uncharacterized conser  46.8      19 0.00049   15.6   5.8   49   26-77     35-83  (266)
102 COG4635 HemG Flavodoxin [Energ  44.7      19 0.00048   15.6   2.5   35   11-45      3-37  (175)
103 TIGR01349 PDHac_trf_mito pyruv  44.5      21 0.00053   15.3   2.7   15  308-322   410-424 (584)
104 TIGR00455 apsK adenylylsulfate  35.4      29 0.00074   14.5   2.5   28   25-56     35-62  (187)
105 PRK10953 cysJ sulfite reductas  31.5      34 0.00086   14.1   4.3   30   19-48     72-101 (599)
106 TIGR01753 flav_short flavodoxi  30.7      35 0.00088   14.0   3.8   33   16-48      6-38  (146)
107 TIGR01990 bPGM beta-phosphoglu  28.7      11 0.00028   17.1  -0.8   24  259-282    79-103 (190)
108 pfam02784 Orn_Arg_deC_N Pyrido  28.3      38 0.00097   13.7   3.9   12  312-323   215-226 (245)
109 PRK07308 flavodoxin; Validated  27.8      39 0.00099   13.7   3.5   32   16-47      9-40  (147)
110 TIGR02707 butyr_kinase butyrat  27.5      39   0.001   13.6   3.3   35   10-44     33-67  (353)
111 PRK08105 flavodoxin; Provision  27.1      40   0.001   13.6   4.9   30   16-45      9-38  (149)
112 TIGR02546 III_secr_ATP type II  23.8      39 0.00099   13.7   1.2   32  253-284   296-327 (430)
113 PRK06703 flavodoxin; Provision  23.5      47  0.0012   13.2   3.8   35   14-48      7-41  (151)
114 pfam09211 DUF1958 Domain of un  23.4      39   0.001   13.7   1.2   30   64-99     14-44  (65)
115 TIGR01458 HAD-SF-IIA-hyp3 HAD-  23.3      42  0.0011   13.5   1.3   43    3-45     28-71  (258)
116 TIGR01169 rplA_bact ribosomal   22.8      48  0.0012   13.1   1.8   26  145-171    94-119 (227)
117 PRK09004 flavodoxin; Provision  22.7      48  0.0012   13.1   4.8   29   16-44      9-37  (146)
118 TIGR02414 pepN_proteo aminopep  20.6      38 0.00098   13.7   0.7  103  242-350   354-459 (898)

No 1  
>TIGR01246 dapE_proteo succinyl-diaminopimelate desuccinylase; InterPro: IPR005941   The lysine/diaminopimelic acid branch of the aspartate pathway produces the essential amino acid lysine via the intermediate meso-diaminopimelic acid (meso-DAP), which is also a vital cell wall component in Gram-negative bacteria . The production of dihydropicolinate from aspartate-semialdehyde controls flux into the lysine/diaminopimelic acid pathway. Three variants of this pathway exist, differing in how tetrahydropicolinate (formed by reduction of dihydropicolinate) is metabolised to meso-DAP. One variant, the most commonly found one in archaea and bacteria, uses primarily succinyl intermediates, while a second variant, found only in Bacillus, utilises primarily acetyl intermediates. In the third variant, found in some Gram-positive bacteria, a dehydrogenase converts tetrahydropicolinate directly to meso-DAP. In all variants meso-DAP is subsequently converted to lysine by a decarboxylase, or, in Gram-negative bacteria, assimilated into the cell wall. Evidence exists that a fourth, currently unknown, variant of this pathway may function in plants .    Succinyl-diaminopimelate desuccinylase (3.5.1.18 from EC) hydrolyses N-succinyl-L,L-diaminopimelic acid which is required for the bacterial synthesis of lysine and meso-diaminopimelic acid.    This group of bacterial sequences belong to the MEROPS peptidase family M20 (clan MH), subfamily M20A (non-peptidase homologs).  ; GO: 0009014 succinyl-diaminopimelate desuccinylase activity, 0009089 lysine biosynthetic process via diaminopimelate.
Probab=100.00  E-value=0  Score=616.52  Aligned_cols=373  Identities=46%  Similarity=0.741  Sum_probs=355.8

Q ss_pred             HHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEECC-----CCCEEEEECCCCCCCCC
Q ss_conf             9999999964999789968999999999997798489997058887624899999879-----99889997336815788
Q gi|254780782|r    5 CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT-----EAPHLMFAGHIDVVPPG   79 (389)
Q Consensus         5 ~v~~l~~lv~ips~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g~-----~~~~ill~~H~Dtvp~~   79 (389)
                      +++++++||++||+||++.+++++|.+.|+++||+++.+.+.     ...|+|+++|.     ++|.|.|.||.||||+|
T Consensus         1 ~~~lak~Lis~pSVTP~D~Gcq~~Ia~rL~~~gF~~e~~~f~-----d~kN~wa~~g~aif~~~~P~l~F~GHtDVVP~G   75 (383)
T TIGR01246         1 VTELAKELISRPSVTPNDAGCQDLIAERLKKIGFEIEILHFG-----DTKNLWATRGTAIFKDGEPVLAFAGHTDVVPAG   75 (383)
T ss_pred             CHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECC-----CCHHHHHHCCEEEECCCCCEEEECCCCCCCCCC
T ss_conf             912466330378889984778999999984539758998508-----734445455714650887658874621211388


Q ss_pred             CHHHCCC-CCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCC-C-CEEEEEEEECCCEECCCCCCCCCCCCCC
Q ss_conf             8777256-66422452133236544333201245441000000011357-8-3499975202201104421111100013
Q gi|254780782|r   80 DFNHWTY-PPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-G-SISLLITGDEEGPAINGTKKMLSWIEKK  156 (389)
Q Consensus        80 ~~~~W~~-~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~~~-~-~i~~~~~~dEE~~~~~G~~~l~~~~~~~  156 (389)
                      +.+.|++ |||+|+++||+||||||+||||++|||+.|++++.+..+.+ | +|.|++|+|||+.+.+|.++++++|.++
T Consensus        76 ~~e~W~~s~PF~p~~~dG~lYGRGAaDMKGs~Aafv~AaerFv~~~pdhkGa~islLiTSDEEG~A~dGT~~vve~L~~r  155 (383)
T TIGR01246        76 PLEQWSSSPPFEPVERDGKLYGRGAADMKGSLAAFVVAAERFVKKNPDHKGASISLLITSDEEGEAIDGTKKVVETLMAR  155 (383)
T ss_pred             CCCCCCCCCCCCCEEECCCEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHCCCCCHHHHHHHHHHHHHH
T ss_conf             88778887696634621217626562146789999999999998477778405344333000133113688999999972


Q ss_pred             CCCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCEEE
Q ss_conf             32120354145665434310012322235799999964123100000012013455443201122334456644210146
Q gi|254780782|r  157 GEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNM  236 (389)
Q Consensus       157 ~~~~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~~~~~~~~~~~~~  236 (389)
                      ...+||||+||||+....|+.|-+|+||+++.+|+|+|.+||.||||+..|||+.++++|.+|....||.++++|+|+++
T Consensus       156 ~~~IDyc~VGEPss~k~~GD~iK~GRRGSi~g~L~i~G~QGHVAYPh~A~NP~H~~~p~L~~L~~~~lD~G~e~F~ptsl  235 (383)
T TIGR01246       156 DELIDYCIVGEPSSVKKLGDVIKNGRRGSITGNLTIKGIQGHVAYPHLANNPVHKAAPVLAELTAIKLDEGNEFFPPTSL  235 (383)
T ss_pred             CCCCCEEEEECCCCCCCCCCEEEECCCEEEEEEEEEEEEECCCCCHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCC
T ss_conf             58997898606535111688678423113544478988751104645415870369999999861128896343589753


Q ss_pred             EEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCC-CHHHHHHHH
Q ss_conf             6765542046665543211665134342067799999999998765324203431123222663112578-678999999
Q gi|254780782|r  237 EITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLT-HDRKLTSLL  315 (389)
Q Consensus       237 ~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~-~~~~l~~~l  315 (389)
                      +|+.|++|.++.||||++..+.|++|+.|+.+.+.++.+|.+.+.+++.+ ++++|+++|..+..|..++ .++++++.+
T Consensus       236 ~I~NI~aGtG~~NVIPg~L~v~FN~Rfs~e~~~e~~k~~v~~il~~hCke-Y~l~Y~lew~~Sg~pFlT~P~~g~l~~~~  314 (383)
T TIGR01246       236 QITNIHAGTGANNVIPGELKVQFNIRFSTEVSEETLKSRVEAILDQHCKE-YGLDYDLEWSLSGEPFLTNPIDGKLIDKV  314 (383)
T ss_pred             EECCCCCCCCCCCCCCHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCC-CCCCEEEEECCCCCCCCCCCCCCHHHHHH
T ss_conf             22455788898876611120013410286677178999999999742200-38841698721585527888876389999


Q ss_pred             HHHHHHHHCCCCEEEECCCCCHHHHHHH-CCCEEEEEECCCCCCCCCCEEEHHHHHHHHHHHHHHHHHH
Q ss_conf             9999998289957974145435889860-5989999004787368784047999999999999999987
Q gi|254780782|r  316 SKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNENASLQDLEDLTCIYENFLQNW  383 (389)
Q Consensus       316 ~~a~~~~~g~~~~~~~~gg~~d~~~~~~-~iP~v~fGp~~~~~H~pdE~i~i~~l~~~~~~~~~~i~~~  383 (389)
                      .++++++.+..|.+.++|||||+||++. |+.+|-|||.++++|..||++.|+||.+...+|.++|.++
T Consensus       315 ~~~i~~~~~~~P~lsT~GGTSDgRFia~~G~~vVE~G~~N~~IHkvnE~V~i~DL~kL~~vY~~~l~~L  383 (383)
T TIGR01246       315 REAIEETNGIKPELSTSGGTSDGRFIALMGAEVVELGPVNATIHKVNECVKIEDLEKLSDVYEDLLENL  383 (383)
T ss_pred             HHHHHHHCCCCCCCCCCCCCCHHHHHHHHCCCEEEEECCCCCEEEECCEECHHHHHHHHHHHHHHHHHC
T ss_conf             999999708675534789871699999754918988455783042215111888877899999999719


No 2  
>PRK13009 succinyl-diaminopimelate desuccinylase; Reviewed
Probab=100.00  E-value=0  Score=582.81  Aligned_cols=372  Identities=52%  Similarity=0.834  Sum_probs=339.9

Q ss_pred             HHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEECCCCCEEEEECCCCCCCCCCHH
Q ss_conf             78999999996499978996899999999999779848999705888762489999987999889997336815788877
Q gi|254780782|r    3 PDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDVVPPGDFN   82 (389)
Q Consensus         3 ~e~v~~l~~lv~ips~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g~~~~~ill~~H~Dtvp~~~~~   82 (389)
                      .|+|++|++||+|||+||+|.++++|++++|+++||++++.+..     .+.|+++++|+++|+|+|+||+||||+|+.+
T Consensus         2 ~d~i~ll~~LV~ipS~s~~e~~~~~~l~~~l~~~G~~ve~~~~~-----~~~Nl~a~~g~~~~~l~l~gH~DvVP~gd~~   76 (375)
T PRK13009          2 SDVLELAQDLIRRPSVTPDDAGCQDLLAERLKALGFTCERMDFG-----DVKNLWARRGGEGPHLCFAGHTDVVPPGDLE   76 (375)
T ss_pred             CHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECC-----CCCEEEEEECCCCCEEEEECCCCCCCCCCCC
T ss_conf             66999999982999969886899999999999779906996049-----9647999968999879997873754899711


Q ss_pred             HCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCCEECCCCCCCCCCCCCCCCCCC
Q ss_conf             725666422452133236544333201245441000000011-3578349997520220110442111110001332120
Q gi|254780782|r   83 HWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWD  161 (389)
Q Consensus        83 ~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~~~~~~d  161 (389)
                      +|++|||+++++||+|||||++||||++|++|.|++++++.. .+.++|.|+|++|||+++..|++++++++..++..+|
T Consensus        77 ~W~~dPf~~~i~dg~lyGRGa~DmKg~laa~l~A~~~l~~~~~~~~~~l~~~~~~dEE~~~~~G~~~~~~~l~~~~~~~d  156 (375)
T PRK13009         77 QWTSPPFEPTIRDGMLYGRGAADMKGSLAAFVVAAERFVAKHPDHKGSISFLITSDEEGPAINGTVKVLEWLKARGEKID  156 (375)
T ss_pred             CCCCCCCCCEEECCEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHCCCCCC
T ss_conf             24479986089899998036443545589999999999985667898669999604556655675899888996299878


Q ss_pred             EEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEEEE
Q ss_conf             35414566543431001232223579999996412310000001201345544320112233445664421014667655
Q gi|254780782|r  162 ACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI  241 (389)
Q Consensus       162 ~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~~~~~~~~~~~~~~i~~i  241 (389)
                      +||++|||+....+..|.+|+||.++++++++|+++|||+|++|.|||..+++++.+|....++.+++.|++++++++.|
T Consensus       157 ~~iv~EPt~~~~~G~~i~~g~kG~~~~~l~v~G~~aH~s~P~~g~NAi~~~~~~l~~L~~~~~d~~~~~~~~tt~~v~~i  236 (375)
T PRK13009        157 YCIVGEPTSTERLGDVIKNGRRGSLSGKLTVKGVQGHVAYPHLADNPIHLAAPALAELAATEWDEGNEFFPPTSLQITNI  236 (375)
T ss_pred             EEEECCCCCCCCCCCEEEECCEEEEEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEE
T ss_conf             89984787654111004642347999999999515544685456699999999999987035544776679874213258


Q ss_pred             EECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             42046665543211665134342067799999999998765324203431123222663112578678999999999999
Q gi|254780782|r  242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYN  321 (389)
Q Consensus       242 ~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~l~~a~~~  321 (389)
                      ++|..+.|+||++|++.+|+|+.|+++.+++.++|++.+.+     .+.++++++.....|+.+ .++++++.+.+++++
T Consensus       237 ~gG~~~~nviP~~~~~~~d~R~~p~~~~e~v~~~i~~~~~~-----~~~~~~i~~~~~~~p~~~-~~~~~v~~l~~a~~~  310 (375)
T PRK13009        237 DAGTGATNVIPGELEAQFNFRFSTEHTAESLKARVEAILDK-----HGLDYTLEWSLSGEPFLT-PPGKLVDAVSAAIEA  310 (375)
T ss_pred             ECCCCCCCEECCEEEEEEEEEECCCCCHHHHHHHHHHHHHH-----CCCCCEEEECCCCCCCCC-CCCHHHHHHHHHHHH
T ss_conf             77888676848879999999708999999999999999987-----499814754247887679-996899999999999


Q ss_pred             HHCCCCEEEECCCCCHHHHHH-HCCCEEEEEECCCCCCCCCCEEEHHHHHHHHHHHHHHHHHHCC
Q ss_conf             828995797414543588986-0598999900478736878404799999999999999998724
Q gi|254780782|r  322 TTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMHALNENASLQDLEDLTCIYENFLQNWFI  385 (389)
Q Consensus       322 ~~g~~~~~~~~gg~~d~~~~~-~~iP~v~fGp~~~~~H~pdE~i~i~~l~~~~~~~~~~i~~~~~  385 (389)
                      ++|..|.+.+.+|++|++|++ .++|++.|||++.++|++|||++++++.+++++|.++|++||.
T Consensus       311 ~~g~~p~~~~~gGtsDa~~~~~~gip~v~~Gp~~~~aH~~dE~v~i~~l~~~~~iy~~~i~rlla  375 (375)
T PRK13009        311 VTGITPELSTSGGTSDARFIADYGCQVVEFGPVNATIHKVNERVSVADLEKLTDIYERILERLLA  375 (375)
T ss_pred             HHCCCCEEECCCCCCHHHHHHHHCCCEEEECCCCCCCCCCCCCEEHHHHHHHHHHHHHHHHHHHC
T ss_conf             87899778636551599999870999999777999877787409999999999999999999719


No 3  
>PRK08588 succinyl-diaminopimelate desuccinylase; Reviewed
Probab=100.00  E-value=0  Score=532.59  Aligned_cols=368  Identities=26%  Similarity=0.366  Sum_probs=322.5

Q ss_pred             CHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEECCCCCEEEEECCCCCCCCCCH
Q ss_conf             87899999999649997899689999999999977984899970588876248999998799988999733681578887
Q gi|254780782|r    2 TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDVVPPGDF   81 (389)
Q Consensus         2 ~~e~v~~l~~lv~ips~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g~~~~~ill~~H~Dtvp~~~~   81 (389)
                      +.|+|++|++||+|||+|++|.++++|++++|+++|++++.+++.+    .+.|+++++|+++|+|+|+|||||||+|+.
T Consensus         1 ~~e~v~ll~~Lv~i~S~sg~e~~~~~~l~~~l~~~G~~~~~~~~~~----~~~nlva~~g~~~~~l~l~gH~DvVp~g~~   76 (378)
T PRK08588          1 EEEKIQILADIVKINSVNDNEIEVANYLQDLFAKHGIESKIVKVND----GRANLVAEIGSGSPVLALSGHMDVVAAGDQ   76 (378)
T ss_pred             CCHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC----CEEEEEEEECCCCCEEEEECCCCCCCCCCC
T ss_conf             9469999999848999493899999999999998899679997289----907999998999957999786572699974


Q ss_pred             HHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCCEECCCCCCCCCCCCCCCCCC
Q ss_conf             7725666422452133236544333201245441000000011-357834999752022011044211111000133212
Q gi|254780782|r   82 NHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKW  160 (389)
Q Consensus        82 ~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~~~~~~  160 (389)
                      ++|++|||+++++||+|||||++||||+++++++|++.|++.. ++.++|.|+|++|||.++. |++++++.  ......
T Consensus        77 ~~W~~~Pf~~~~~dg~lyGRG~~D~Kg~~aa~l~A~~~l~~~~~~~~~~i~~~~~~dEE~g~~-G~~~l~~~--g~~~~~  153 (378)
T PRK08588         77 DKWTYDPFKLTEKDGKLYGRGATDMKSGLAALVIALIELKEQGQLLNGTIRLLATAGEEVGQE-GAKQLTEK--GYADDL  153 (378)
T ss_pred             CCCCCCCCCEEEECCEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEEEEEEECCCH-HHHHHHHH--CCCCCC
T ss_conf             557479975299899999577653546579999999999973799997299999973113766-89999982--753468


Q ss_pred             CEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCC---CCCCCCCCCCEEEE
Q ss_conf             035414566543431001232223579999996412310000001201345544320112233---44566442101466
Q gi|254780782|r  161 DACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIG---FDTGNTTFSPTNME  237 (389)
Q Consensus       161 d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~---~~~~~~~~~~~~~~  237 (389)
                      |+++++||++.     .+++++||.++++|+++|+++|||+|+.|+|||..+++++.++.+..   ....+..+.+++++
T Consensus       154 d~~iv~Ept~~-----~i~~~~kG~~~~~i~v~G~~~Hss~P~~G~NAi~~l~~~i~~l~~~~~~~~~~~~~~~~~~t~~  228 (378)
T PRK08588        154 DALIIGEPSGY-----GIVYAHKGSMDYKVTSTGKAAHSSMPELGINAIDPLLEFYNEEKEYFDSIKEEDNPYLGGLTHN  228 (378)
T ss_pred             CEEEEECCCCC-----EEEEEEEEEEEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEE
T ss_conf             87999238898-----7999987689999999653221378434637999999999999998764655556455883378


Q ss_pred             EEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHH
Q ss_conf             76554204666554321166513434206779999999999876532420343112322266311257867899999999
Q gi|254780782|r  238 ITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSK  317 (389)
Q Consensus       238 i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~l~~  317 (389)
                      ++.|++ +.+.|+||++|++.+|+|+.|+++.+++.+.+++.+.+....  ..+++++.....+|+.++.++++++.+.+
T Consensus       229 ~~~i~g-G~~~NvVP~~a~~~~d~R~~p~~~~~~v~~~i~~~i~~~~~~--~~~~~~~~~~~~~p~~~~~~~~~v~~~~~  305 (378)
T PRK08588        229 VTVING-GEQVNSVPDEAELEFNIRTIPEYDNDQVIALLQNIINEVNQN--GAQLTLDIYSNHRPVASDKDSDLVQLAKD  305 (378)
T ss_pred             EEEEEC-CCCCCCCCCEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHCC--CCEEEEEEEECCCCCCCCCCCHHHHHHHH
T ss_conf             899846-864540487699999996399999999999999999986174--87299999606685246998999999999


Q ss_pred             HHHHHHCCCCEEEECCCCCHHHHHH----HCCCEEEEEECCC-CCCCCCCEEEHHHHHHHHHHHHHHHHHHC
Q ss_conf             9999828995797414543588986----0598999900478-73687840479999999999999999872
Q gi|254780782|r  318 SIYNTTGNIPLLSTSGGTSDARFIK----DYCPVIEFGLVGR-TMHALNENASLQDLEDLTCIYENFLQNWF  384 (389)
Q Consensus       318 a~~~~~g~~~~~~~~gg~~d~~~~~----~~iP~v~fGp~~~-~~H~pdE~i~i~~l~~~~~~~~~~i~~~~  384 (389)
                      ++++++|..+.+..++|++|++++.    .++|++.||||+. .+|++|||+++++|.+++++|+++|.+||
T Consensus       306 ~~~~~~g~~~~~~~~~g~tD~~~~~~~~~~gip~v~~GPG~~~~aH~~dE~v~i~~l~~~~~iy~~~i~~~l  377 (378)
T PRK08588        306 VASSYVERDIPLSAIPGATDASSFLKDNPDNFPVIVFGPGNNLTAHQVDEYVEKDMYLKFIDIYKELIIQYL  377 (378)
T ss_pred             HHHHHHCCCCEEEEEEECCCHHHHHHHCCCCCCEEEECCCCCCCCCCCCCEEEHHHHHHHHHHHHHHHHHHH
T ss_conf             999984999738888300059999854668961999898999888899820899999999999999999975


No 4  
>PRK06837 acetylornithine deacetylase; Provisional
Probab=100.00  E-value=0  Score=530.19  Aligned_cols=374  Identities=22%  Similarity=0.355  Sum_probs=318.1

Q ss_pred             CHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCC-------------CCCEEEEEEEEE--C-CCCC
Q ss_conf             87899999999649997899689999999999977984899970588-------------876248999998--7-9998
Q gi|254780782|r    2 TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTK-------------NTSIVKNLYARF--G-TEAP   65 (389)
Q Consensus         2 ~~e~v~~l~~lv~ips~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~-------------~~~~~~~~~~~~--g-~~~~   65 (389)
                      ..|+|++|++||+|||+|++|.++++|++++|+++||++++..+...             ....++|+++++  | +++|
T Consensus        19 ~de~v~ll~~Lv~ipS~~g~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~nvv~~~~~~~~~G~   98 (427)
T PRK06837         19 FDAQVAFTQDLVRFPSTRGAEAPCQDFLADAFRARGYEVDRFHIDVDDLADHPGAGPIEIDYSGAPIVVGTYRPSTGTGR   98 (427)
T ss_pred             CHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCHHHHHHCCCCCCCCCCCCCCCEEEEEECCCCCCCC
T ss_conf             68899999999689996976499999999999977993699751635554246767533234677508998347899998


Q ss_pred             EEEEECCCCCCCCCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCCEECC
Q ss_conf             89997336815788877725666422452133236544333201245441000000011-35783499975202201104
Q gi|254780782|r   66 HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEGPAIN  144 (389)
Q Consensus        66 ~ill~~H~Dtvp~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~~~~~  144 (389)
                      +|+|+||+||||+|+.+.|++|||+++++||+|||||++||||++|++|.|+++|++.+ ++.++|.|.+++|||.+|. 
T Consensus        99 ~l~l~gH~DvVP~g~~~~W~~dPF~~~i~dg~lyGRGa~DmKgg~aa~l~A~~~l~~~~~~~~~~i~l~~v~dEE~~G~-  177 (427)
T PRK06837         99 SLILQGHIDVVPEGPLEMWSTPPFEPVIRDGWMYGRGAQDMKAGLAAMLFALDAIRAAGLAPAARVHFQSVVEEESTGN-  177 (427)
T ss_pred             EEEEECCCCCCCCCCCCCCCCCCCCEEEECCEEECCCHHHCCHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCCC-
T ss_conf             8999268870699987667469975099899998577575021089999999999972889899778998532333671-


Q ss_pred             CCCCCCCCCCCCCCCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCCC
Q ss_conf             42111110001332120354145665434310012322235799999964123100000012013455443201122334
Q gi|254780782|r  145 GTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGF  224 (389)
Q Consensus       145 G~~~l~~~~~~~~~~~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~  224 (389)
                      |+...+    .++.+.|+||++||++.     .+++++||.++++|+++|+++||++|+.|+|||..++.++.+|+++..
T Consensus       178 g~~~~l----~~g~~~D~~iv~EPt~~-----~i~~~~~G~~~~~v~v~G~~aH~s~p~~G~NAI~~a~~~i~~L~~l~~  248 (427)
T PRK06837        178 GALSTL----QRGYRADACLIPEPTGE-----KLVRAQVGVIWFRLRVRGTPVHVAEAGTGANAIDAAYHLIRALRKLEA  248 (427)
T ss_pred             HHHHHH----HCCCCCCEEEECCCCCC-----EEEEEEEEEEEEEEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             199999----73777661573378766-----067668888999999975613546855576999999999999999898


Q ss_pred             C-----CCCCC----CCCEEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCC---E
Q ss_conf             4-----56644----2101466765542046665543211665134342067799999999998765324203431---1
Q gi|254780782|r  225 D-----TGNTT----FSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLS---H  292 (389)
Q Consensus       225 ~-----~~~~~----~~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~---~  292 (389)
                      .     .....    ..++++|++.|++ +...|+||++|++.+++|+.|+++.+++.++|++.+.+.....+...   .
T Consensus       249 ~~~~~~~~~p~~~~~~~p~t~nvg~I~g-G~~~n~VP~~~~~~~~~r~~Pg~~~~~v~~ei~~~l~~~~~~~~~l~~~~~  327 (427)
T PRK06837        249 EWNARKVSDPHFEDVPHPINFNVGIIKG-GDWASSVPAWCDLDCRIALYPGWTPADAQAEIEACVAAAARADPFLSNNPP  327 (427)
T ss_pred             HHHCCCCCCCCCCCCCCCCEEEEEEEEC-CCCCCCCCCEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             7632145786666788872588768856-876760388799999985599999999999999999998524321137883


Q ss_pred             EEEECC-CCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHH--HCCCEEEEEECCCCCCCCCCEEEHHHH
Q ss_conf             232226-63112578678999999999999828995797414543588986--059899990047873687840479999
Q gi|254780782|r  293 TVHFSS-PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK--DYCPVIEFGLVGRTMHALNENASLQDL  369 (389)
Q Consensus       293 ~i~~~~-~~~p~~~~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~--~~iP~v~fGp~~~~~H~pdE~i~i~~l  369 (389)
                      ++++.. ..+|+..+.++++++.+.+++++++|.++....++|++|++|+.  .++|++.|||++.++|++|||++++++
T Consensus       328 ~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~G~~~~~~~~~g~tD~~~~~~~~gip~v~fGPg~~~~H~~dE~V~i~~l  407 (427)
T PRK06837        328 EVTWSGFLAEGYVLEPGSEAEAALGRAHAAVFGGPLQSFVTTAYTDTRFYGLYYNIPALCYGPYGRGMHGFDERVDLESV  407 (427)
T ss_pred             EEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEEEECHHHHHHHHCCCCEEEECCCCCCCCCCCCEEEHHHH
T ss_conf             79985034675447998769999999999987999834664434439898721899999979898878999825849999


Q ss_pred             HHHHHHHHHHHHHHCCC
Q ss_conf             99999999999987247
Q gi|254780782|r  370 EDLTCIYENFLQNWFIT  386 (389)
Q Consensus       370 ~~~~~~~~~~i~~~~~~  386 (389)
                      .+++++|+.+|.+||+-
T Consensus       408 ~~~~kv~a~~i~~~cg~  424 (427)
T PRK06837        408 RKVTKTIALFVAEWCGV  424 (427)
T ss_pred             HHHHHHHHHHHHHHHCC
T ss_conf             99999999999999688


No 5  
>PRK06915 acetylornithine deacetylase; Validated
Probab=100.00  E-value=0  Score=517.91  Aligned_cols=374  Identities=23%  Similarity=0.320  Sum_probs=314.9

Q ss_pred             CHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCC-------------CCCEEEEEEEEE-CC-CCCE
Q ss_conf             87899999999649997899689999999999977984899970588-------------876248999998-79-9988
Q gi|254780782|r    2 TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTK-------------NTSIVKNLYARF-GT-EAPH   66 (389)
Q Consensus         2 ~~e~v~~l~~lv~ips~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~-------------~~~~~~~~~~~~-g~-~~~~   66 (389)
                      +.|+|++|++||+|||+|++|.+++++++++|+++||+++..+....             .....+|+++++ |+ ++|+
T Consensus        16 ~~e~i~ll~~LV~i~S~sg~e~~~~~~i~~~l~~~G~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~nvia~~~g~~~g~~   95 (422)
T PRK06915         16 EEESVKLLKRLIQEKSVSGDESGAQAIVIEKLRELGLDLDIWEPSFSKLKDHPYFVSPRTSFSDSPNIVATLKGSGDGKS   95 (422)
T ss_pred             HHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCHHHCCCCCCCCCCCCCCCCCEEEEEECCCCCCCE
T ss_conf             49899999999579998978788999999999977995886312410102476433444456888749999668899988


Q ss_pred             EEEECCCCCCCCCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCCEECCC
Q ss_conf             9997336815788877725666422452133236544333201245441000000011-357834999752022011044
Q gi|254780782|r   67 LMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEGPAING  145 (389)
Q Consensus        67 ill~~H~Dtvp~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~~~~~G  145 (389)
                      |+|+||+||||+|+.++|++|||+++++||+|||||++||||+++++++|+++|.+.+ ++.++|.|++++|||.++. |
T Consensus        96 lll~gH~DvVP~gd~~~W~~~PF~~~i~dg~lyGRGa~DmKgg~aa~l~a~~~l~~~g~~~~~~v~~~~~~dEE~gg~-g  174 (422)
T PRK06915         96 MILNGHIDVVPEGDVKQWDHHPYSGERIGGRIYGRGTTDMKGGNVALMLAMEALIESGIELKGDIYFQSVIEEESGGA-G  174 (422)
T ss_pred             EEEECCCCCCCCCCCCCCCCCCCCCEEECCEEECCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCEEEEEEEEECCCCC-C
T ss_conf             999687786799986657689987588799997678655554199999999999970999999827999985423870-7


Q ss_pred             CCCCCCCCCCCCCCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCCCC
Q ss_conf             21111100013321203541456654343100123222357999999641231000000120134554432011223344
Q gi|254780782|r  146 TKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFD  225 (389)
Q Consensus       146 ~~~l~~~~~~~~~~~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~~  225 (389)
                      +...+    .++.++|++|++||++..     +++++||..+++|+++|+++|||.|+.|+|||..++.+|..|+++...
T Consensus       175 ~~~~~----~~~~~~d~~iv~EPt~~~-----i~~~~kG~~~~~i~v~G~~aHs~~p~~G~nAi~~~~~~i~~l~~l~~~  245 (422)
T PRK06915        175 TLAAI----LRGYKADGAIIPEPTNMK-----FFPKQQGSMWFRLHVKGKAAHGGTRYEGVSAIEKSMFVIDHLRKLEEK  245 (422)
T ss_pred             HHHHH----HCCCCCCEEEECCCCCCC-----EEEECCEEEEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             39998----559998879975898886-----132040279999999876376777423448899999999999999998


Q ss_pred             CC--------CCCCCCEEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCC---CCEEE
Q ss_conf             56--------64421014667655420466655432116651343420677999999999987653242034---31123
Q gi|254780782|r  226 TG--------NTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPK---LSHTV  294 (389)
Q Consensus       226 ~~--------~~~~~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~---~~~~i  294 (389)
                      ..        .....++++|++.|+ |+...|+||++|++.+++|+.|+++.+.+.+++++.+.+.......   ...++
T Consensus       246 ~~~~~~~~~~~~~~~~~t~nvg~I~-GG~~~n~vp~~~~~~~~~r~~p~~~~~~~~~~i~~~l~~~~~~~~~~~~~~~~i  324 (422)
T PRK06915        246 RNARITDPLFKGIPIPIPINIGKIE-GGSWPSSVPDSLILEGRCGIAPNETIEAAKEELENWIAELNDVDNWFVEHPVEV  324 (422)
T ss_pred             HCCCCCCCCCCCCCCCEEEEEEEEE-CCCCCCCCCCEEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             5020268532478886258888773-586666668679999996359999999999999999998752121320585379


Q ss_pred             EECC-CCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHH--HCCCEEEEEECCC-CCCCCCCEEEHHHHH
Q ss_conf             2226-63112578678999999999999828995797414543588986--0598999900478-736878404799999
Q gi|254780782|r  295 HFSS-PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK--DYCPVIEFGLVGR-TMHALNENASLQDLE  370 (389)
Q Consensus       295 ~~~~-~~~p~~~~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~--~~iP~v~fGp~~~-~~H~pdE~i~i~~l~  370 (389)
                      ++.. .+.|..++.++|+++.+.++++++.|..|.....++++|++++.  .++|+++||||.. .+|+||||++++++.
T Consensus       325 ~~~~~~~~p~~~~~~~plv~~l~~a~~~~~g~~p~~~~~~~gtd~~~~~~~~gip~v~~GPG~~~~aH~~dE~v~i~~l~  404 (422)
T PRK06915        325 EWFGARWVPGELEENHELITTLEHNFVEIEGNKPIIEASPWGTDGGLLTQIAGVPTIVFGPGETKVAHYPNEYIEVDKMI  404 (422)
T ss_pred             EEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECEEEHHHHHHHCCCCEEEECCCCCCCCCCCCCEEEHHHHH
T ss_conf             98325457888898789999999999998799983678836770898775669999998999744589887018999999


Q ss_pred             HHHHHHHHHHHHHCCC
Q ss_conf             9999999999987247
Q gi|254780782|r  371 DLTCIYENFLQNWFIT  386 (389)
Q Consensus       371 ~~~~~~~~~i~~~~~~  386 (389)
                      +++++|+++|.+||+.
T Consensus       405 ~~~ki~a~~i~~~C~~  420 (422)
T PRK06915        405 AAAKIIACTLLDWCEV  420 (422)
T ss_pred             HHHHHHHHHHHHHHCC
T ss_conf             9999999999998678


No 6  
>PRK13013 succinyl-diaminopimelate desuccinylase; Reviewed
Probab=100.00  E-value=0  Score=516.32  Aligned_cols=380  Identities=24%  Similarity=0.320  Sum_probs=320.9

Q ss_pred             CHHHHHHHHHHHCCCCCCC---CHHHHHHHHHHHHHHCCCEEEEEEECCC----CCCEEEEEEEEEC--CCCCEEEEECC
Q ss_conf             8789999999964999789---9689999999999977984899970588----8762489999987--99988999733
Q gi|254780782|r    2 TPDCLEHLIQLIKCPSVTP---QDGGAFFILVNTLKLLGFSIEEKDFQTK----NTSIVKNLYARFG--TEAPHLMFAGH   72 (389)
Q Consensus         2 ~~e~v~~l~~lv~ips~s~---~e~~~~~~l~~~l~~~G~~~~~~~~~~~----~~~~~~~~~~~~g--~~~~~ill~~H   72 (389)
                      +.|+|++|++||+|||+||   ++..+++|++++|+++||+++.++....    ....+.|++++.+  .++++|+|++|
T Consensus        13 ~de~v~ll~~LV~ipSv~p~g~~~~~~a~~l~~~l~~~G~~~~~~~~~g~~g~~~~~~r~Nlva~~~g~~~~~~l~l~gH   92 (427)
T PRK13013         13 RDDLVALTQDLIRIPTLNPPGRNYREICEMLAARLAPRGFEVELIRAHGAPGDSETYPRWNLVARRQGARPGDCVHFNSH   92 (427)
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEECC
T ss_conf             18799999999589998989959899999999999977994899965788775455652379999679999877999688


Q ss_pred             CCCCCCCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCC-CCCCEEEEEEEECCCEECCCCCCCCC
Q ss_conf             68157888777256664224521332365443332012454410000000113-57834999752022011044211111
Q gi|254780782|r   73 IDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK-NFGSISLLITGDEEGPAINGTKKMLS  151 (389)
Q Consensus        73 ~Dtvp~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~-~~~~i~~~~~~dEE~~~~~G~~~l~~  151 (389)
                      |||||+++  +|++|||+++++||+|||||++||||++|++|.|++++++... +.++|.|+|++|||.++.+|..++.+
T Consensus        93 ~DvVp~gd--~W~~dPf~~~i~dg~lYGRGa~DmKgg~aa~l~A~~~l~~~~~~~~g~v~~~~~~dEE~g~~~g~~~l~~  170 (427)
T PRK13013         93 HDVVEVGH--GWTRDPFGGEVEDGRIYGRGACDMKGGLAASIIAAEAFIAVYPDFAGAIEISATADEESGGFGGVAYLAE  170 (427)
T ss_pred             CCCCCCCC--CCCCCCCCCEEECCEEECCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCCCCCCHHHHHH
T ss_conf             58638999--8877999767889999876620036867999999999997465668618999996333477674899985


Q ss_pred             CCCCCCCCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCCCCCCC---
Q ss_conf             00013321203541456654343100123222357999999641231000000120134554432011223344566---
Q gi|254780782|r  152 WIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGN---  228 (389)
Q Consensus       152 ~~~~~~~~~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~~~~~---  228 (389)
                      .........|++|++||++..    .+++|+||.+|++|+++|+++|+|+|+.|+|||..++.++.+|++..++...   
T Consensus       171 ~~~~~~~~~d~~iv~EPt~~~----~i~~g~kG~~~~~v~v~G~~aH~s~P~~G~NAi~~~~~~l~~l~~~~~~~~~~~~  246 (427)
T PRK13013        171 QGYFAPPRVQHVIIPEPLNKD----RICLGHRGVWWAEIETHGRIAHGSMPFLGDSAIRHMGAVLEEIEERLFPLLATKR  246 (427)
T ss_pred             HCCCCCCCCCEEEECCCCCCC----CEEEECCCEEEEEEEEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             175466667768845889877----1577304379999999716715468644659999999999999997667764024


Q ss_pred             ---CC----CCCEEEEEEEEEECCC---------CCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCE
Q ss_conf             ---44----2101466765542046---------6655432116651343420677999999999987653242034311
Q gi|254780782|r  229 ---TT----FSPTNMEITTIDVGNP---------SKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSH  292 (389)
Q Consensus       229 ---~~----~~~~~~~i~~i~~g~~---------~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~  292 (389)
                         ..    ...+++|++.|++|..         ..|+||++|++.+|+|+.|+++.+++.+++++.+.+.....+++++
T Consensus       247 ~~~p~~~~~~~~~t~ni~~i~gG~~~~~~~~~g~~~~~vp~~~~~~~d~R~~p~~~~~~v~~~i~~~~~~~~~~~~~~~~  326 (427)
T PRK13013        247 TAMPVVPEGARQSTLNINSIHGGEPEQDPDYTGLPAPCVADRCRIVIDRRFLIEEDLDEVKAEVTALLERLKATRPGFAY  326 (427)
T ss_pred             CCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCEEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCCEE
T ss_conf             45877877666653788667658644566656752343266069999715788889999999999999999843788369


Q ss_pred             EEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHH-C--CCEEEEEECC-CCCCCCCCEEEHHH
Q ss_conf             232226631125786789999999999998289957974145435889860-5--9899990047-87368784047999
Q gi|254780782|r  293 TVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-Y--CPVIEFGLVG-RTMHALNENASLQD  368 (389)
Q Consensus       293 ~i~~~~~~~p~~~~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~~-~--iP~v~fGp~~-~~~H~pdE~i~i~~  368 (389)
                      ++.......|..++.++|+++.+.+++++++|..+....++|++|++++.. +  .|++.||||. ..+|+||||+++++
T Consensus       327 ~~~~~~~~~P~~~~~d~p~v~~l~~a~~~~~g~~~~~~~~~g~~d~~~~~~~g~~~~~v~fGPG~~~~aH~~dE~v~id~  406 (427)
T PRK13013        327 EIRDLFEVLPTMTDRDAPVVRSVAAAIERVLARQADYVVSPGTYDQKHIDRIGKLKNCIAYGPGILDLAHQPDEWVGIQD  406 (427)
T ss_pred             EEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEECCCCHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCEEHHH
T ss_conf             99983134766789888999999999999878998769724511067899737888889989997667878881188999


Q ss_pred             HHHHHHHHHHHHHHHCCCC
Q ss_conf             9999999999999872477
Q gi|254780782|r  369 LEDLTCIYENFLQNWFITP  387 (389)
Q Consensus       369 l~~~~~~~~~~i~~~~~~~  387 (389)
                      +.+++++|+++|.+||.--
T Consensus       407 l~~~~ki~a~~l~~ll~~~  425 (427)
T PRK13013        407 MVDSAKVMALVLADLLAGK  425 (427)
T ss_pred             HHHHHHHHHHHHHHHHCCC
T ss_conf             9999999999999985679


No 7  
>PRK05111 acetylornithine deacetylase; Provisional
Probab=100.00  E-value=0  Score=515.37  Aligned_cols=362  Identities=25%  Similarity=0.333  Sum_probs=300.2

Q ss_pred             HHHHHHHHHHHCCCCCCCCH-------HHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEECCCCCEEEEECCCCC
Q ss_conf             78999999996499978996-------89999999999977984899970588876248999998799988999733681
Q gi|254780782|r    3 PDCLEHLIQLIKCPSVTPQD-------GGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDV   75 (389)
Q Consensus         3 ~e~v~~l~~lv~ips~s~~e-------~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g~~~~~ill~~H~Dt   75 (389)
                      |++|++|++||+|||+|++|       +++++||++||+++||++++.++..  .....|+++++|++.++|+|+||+||
T Consensus         5 ~~~iell~~LV~ipSvs~~e~~~d~~~~~~~~~l~~~l~~~G~~ve~~~~~~--~~~~~Nvia~~g~g~~~l~l~gH~Dt   82 (383)
T PRK05111          5 PSFIEIYRALIATPSISATEPALDQSNRAVIDLLAGWFEDLGFNVEIQPVPG--TRGKFNLLASLGSGEGGLLLAGHTDT   82 (383)
T ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCC--CCCCEEEEEEECCCCCEEEEECCCCC
T ss_conf             6999999999589997987655340489999999999997899589997589--99834799996799973999814165


Q ss_pred             CCCCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCEECCCCCCCCCCCCC
Q ss_conf             57888777256664224521332365443332012454410000000113578349997520220110442111110001
Q gi|254780782|r   76 VPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEK  155 (389)
Q Consensus        76 vp~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~  155 (389)
                      ||++ ...|++|||.++++||+|||||++||||++|+++.|++.+... ...+++.++|++|||.++ .|++++++.   
T Consensus        83 VP~~-~~~W~~dPf~~~~~dg~lyGRGa~DmKg~~Aa~l~A~~~l~~~-~~~~~v~~~~~~dEE~g~-~G~~~l~~~---  156 (383)
T PRK05111         83 VPFD-EGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFILEALRDIDLT-KLKKPLYILATADEETSM-AGARAFAEA---  156 (383)
T ss_pred             CCCC-CCCCCCCCCCEEEECCEEECCCCCCCCCHHHHHHHHHHHHHHC-CCCCCEEEEEEECCCCCC-HHHHHHHHH---
T ss_conf             8999-8856679961698899898178565514499999999998754-688768999982431475-148999981---


Q ss_pred             CCCCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCCCCC----CCCC-
Q ss_conf             33212035414566543431001232223579999996412310000001201345544320112233445----6644-
Q gi|254780782|r  156 KGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDT----GNTT-  230 (389)
Q Consensus       156 ~~~~~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~~~----~~~~-  230 (389)
                      ...++|++|++|||+..     +++++||.++++|+++|+++|||+|++|.|||..+.+++.+|.++....    .+.. 
T Consensus       157 ~~~~~d~~IvgEPt~~~-----~~~~~kG~~~~~i~v~G~~aHas~P~~G~NAI~~~~~~i~~l~~l~~~~~~~~~~~~~  231 (383)
T PRK05111        157 TAIRPDCAIIGEPTSLK-----PVRAHKGHMSEAIRITGQSGHSSDPALGVNAIELMHDVIGELMQLRDELQERYHNPAF  231 (383)
T ss_pred             CCCCCCEEEECCCCCCC-----EEEEECEEEEEEEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             89899989981588760-----7997050899999998576034885437799999999999999999998753479877


Q ss_pred             -CCCEEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECC-CCCCCCCCCH
Q ss_conf             -21014667655420466655432116651343420677999999999987653242034311232226-6311257867
Q gi|254780782|r  231 -FSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS-PVSPVFLTHD  308 (389)
Q Consensus       231 -~~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~-~~~p~~~~~~  308 (389)
                       .+.+|+|++.|++ +.+.|+||++|++.+|+|+.|+++.+++.+.+++.+.+...+. ..++++.... ..+|+..+.+
T Consensus       232 ~~~~ptlnvg~I~G-G~~~NvVP~~~~~~~d~R~~P~~~~~~~~~~i~~~l~~~~~~~-~~~~~~~~~~~~~p~~~~~~~  309 (383)
T PRK05111        232 TVPYPTLNLGHIHG-GDAPNRICGCCELHFDIRPLPGMTLEELNGLLREALAPVSERW-PGRITVAPLHPPIPGYECPAD  309 (383)
T ss_pred             CCCCCEEEEEEEEC-CCCCCCCCCEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHC-CCEEEEEECCCCCCCCCCCCC
T ss_conf             88975588877765-8767524858999998846999999999999999999998666-963999975678886689973


Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHH-HCCCEEEEEECC-CCCCCCCCEEEHHHHHHHHHHHHHHHHHHCC
Q ss_conf             8999999999999828995797414543588986-059899990047-8736878404799999999999999998724
Q gi|254780782|r  309 RKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVG-RTMHALNENASLQDLEDLTCIYENFLQNWFI  385 (389)
Q Consensus       309 ~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~-~~iP~v~fGp~~-~~~H~pdE~i~i~~l~~~~~~~~~~i~~~~~  385 (389)
                      +++++.+    +++.|..+..  ..++||++|++ .++|++.||||+ ..+|++|||++++++.+++++|.++|++||.
T Consensus       310 ~~lv~~~----~~~~g~~~~~--~~~~TDa~~~~~~Giptv~~GPG~~~~aH~~dE~V~i~~l~~~~~i~~~~I~~fc~  382 (383)
T PRK05111        310 SQLVRVV----EKLLGHKAEV--VNYCTEAPFIQQLGCPTLVLGPGSINQAHQPDEYLELSFIKPTRELLRQLIHHFCL  382 (383)
T ss_pred             CHHHHHH----HHHHCCCCCC--CCCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCEEEHHHHHHHHHHHHHHHHHHCC
T ss_conf             0999999----9986899862--21325388897669999998999724587677408999999999999999998736


No 8  
>PRK13983 diaminopimelate aminotransferase; Provisional
Probab=100.00  E-value=0  Score=513.27  Aligned_cols=377  Identities=24%  Similarity=0.339  Sum_probs=315.0

Q ss_pred             CCHHHHHHHHHHHCCCCCCCC-----HHHHHHHHHHHHHHCCCE-EEEEEECCC--CCCEEEEEEEEEC--CCCCEEEEE
Q ss_conf             987899999999649997899-----689999999999977984-899970588--8762489999987--999889997
Q gi|254780782|r    1 MTPDCLEHLIQLIKCPSVTPQ-----DGGAFFILVNTLKLLGFS-IEEKDFQTK--NTSIVKNLYARFG--TEAPHLMFA   70 (389)
Q Consensus         1 l~~e~v~~l~~lv~ips~s~~-----e~~~~~~l~~~l~~~G~~-~~~~~~~~~--~~~~~~~~~~~~g--~~~~~ill~   70 (389)
                      ++.|+|++|++||+|||+|++     |.++++|++++|+++||+ ++.++..+.  ..+.++||+++.+  .++++|+|+
T Consensus         4 ~~~e~v~~l~~Lv~i~Svs~~~~g~ge~~~a~~l~~~l~~~G~~~~~~~~~~~~~~~~~~r~nvi~~~~g~~~~~~lll~   83 (399)
T PRK13983          4 LRDEMIELLKELISIPAVNPESGGEGEKEKAEYLENILREYGFDDIERYDAPDDRVPEGVRPNIVAKIPGGDGERTLWII   83 (399)
T ss_pred             CHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCEEEEEECCCCCCCEEEEE
T ss_conf             48999999999968999798878848999999999999858998899973688766678743799997389999879993


Q ss_pred             CCCCCCCCCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCCEECCCCCCC
Q ss_conf             336815788877725666422452133236544333201245441000000011-3578349997520220110442111
Q gi|254780782|r   71 GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEGPAINGTKKM  149 (389)
Q Consensus        71 ~H~Dtvp~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~~~~~G~~~l  149 (389)
                      |||||||+|+.+.|++|||+++++||+|||||++||||+++++|+|+++|++.+ .+.++|.|+|++|||.|+..|+.++
T Consensus        84 gH~DvVP~g~~~~W~~~Pf~~~i~dg~lyGRGa~DmKgg~aa~l~A~~~l~~~~~~~~~~i~~~~~~dEE~G~~~G~~~l  163 (399)
T PRK13983         84 SHMDVVPPGDLSLWETDPFKPVVKDGKIYGRGSEDNGQGIVSSLLAAKALMELGIRPKYNLGLAFVSDEETGSKYGIQYL  163 (399)
T ss_pred             CCCCCCCCCCCCCCCCCCCEEEEECCEEEECCCCCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCHHHHHHH
T ss_conf             76575189973447679961899899899667334640389999999999984899997189998624035646369999


Q ss_pred             CCCCCCCCCCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCC---CCCC
Q ss_conf             1100013321203541456654343100123222357999999641231000000120134554432011223---3445
Q gi|254780782|r  150 LSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNI---GFDT  226 (389)
Q Consensus       150 ~~~~~~~~~~~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~---~~~~  226 (389)
                      ++.........|++++.+++.+  .+..+++++||.++++++++|+++|||.|+.|.||+..++.++.+|.+.   .++.
T Consensus       164 ~~~~~~~~~~~d~~iv~d~g~p--~~~~i~~~~kG~~~~~v~v~G~~aHas~p~~g~nAi~~~~~~i~~l~~~~~~~~~~  241 (399)
T PRK13983        164 LKNEPELFGKDDLIIVPDAGNP--DGTFIEIAEKSILWLKFKVKGKQCHASMPENGINAHRAAAKFILELDEALHEKYNK  241 (399)
T ss_pred             HHHCHHHCCCCCEEEECCCCCC--CCCEEEEEECCEEEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             9735432686667995567889--88889997141799999994664113586556489999999999999998765245


Q ss_pred             CCCCCCC--EEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCC-CCCC
Q ss_conf             6644210--146676554204666554321166513434206779999999999876532420343112322266-3112
Q gi|254780782|r  227 GNTTFSP--TNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP-VSPV  303 (389)
Q Consensus       227 ~~~~~~~--~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~-~~p~  303 (389)
                      .+..+.+  ++++++.+.+|..+.|+||++|++.+|+|+.|+++.+++.+++++++.+.... .+.++++++... ..|.
T Consensus       242 ~~~~~~~~~~t~~~t~~~~g~~~~n~iP~~a~~~~d~R~~p~~~~~~v~~~i~~~~~~~~~~-~~~~~~~e~~~~~~~~~  320 (399)
T PRK13983        242 RDELFNPPYSTFEPTKKENNVDNVNTIPGEDVFYFDCRILPDYDLDEVLSDIEKIADEFENE-YGVKIEYEIVQREQAPP  320 (399)
T ss_pred             CCCCCCCCCCCEEEEEEECCCCCCCEECCEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHH-CCCCEEEEEEECCCCCC
T ss_conf             66455898552266666667566536167599999998589999999999999999999987-09935898750467777


Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHH-HCCCEEEEEECCCCCCCCCCEEEHHHHHHHHHHHHHHH
Q ss_conf             578678999999999999828995797414543588986-05989999004787368784047999999999999999
Q gi|254780782|r  304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMHALNENASLQDLEDLTCIYENFL  380 (389)
Q Consensus       304 ~~~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~-~~iP~v~fGp~~~~~H~pdE~i~i~~l~~~~~~~~~~i  380 (389)
                      .++.++++++.+.+++++++|..+.+..++|++|++|++ .++|+++|||++.++|+||||+++++|.+++++|+++|
T Consensus       321 ~~~~~~~~v~~l~~a~~~~~g~~~~~~~~~ggtda~~~~~~Gip~v~~Gpg~~~aH~~dE~v~i~~l~~~~~iy~~~i  398 (399)
T PRK13983        321 PTPPDSEIVKKLKSAIKEVRGKEPKVGGIGGGTVAAFLRKKGYPAVVWSTLDETAHQPNEYAKISNLIEDAKVFADLL  398 (399)
T ss_pred             CCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHCCCCEEEECCCCCCCCCCCCEEEHHHHHHHHHHHHHHH
T ss_conf             889987999999999999879997698424756799998769989997988898887772199999999999999986


No 9  
>PRK13004 peptidase; Reviewed
Probab=100.00  E-value=0  Score=510.64  Aligned_cols=369  Identities=22%  Similarity=0.296  Sum_probs=308.6

Q ss_pred             CCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEECCCCCEEEEECCCCCCCCCC
Q ss_conf             98789999999964999789968999999999997798489997058887624899999879998899973368157888
Q gi|254780782|r    1 MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDVVPPGD   80 (389)
Q Consensus         1 l~~e~v~~l~~lv~ips~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g~~~~~ill~~H~Dtvp~~~   80 (389)
                      .+.|+|++|++||+|||+|++|.++++|++++|+++||+....+       ..+|++++.+.+.|+|+|++|+||||+++
T Consensus        13 ~~~e~v~ll~~LV~ipS~sg~E~~~a~~l~~~l~~~G~~~~~~d-------~~~nv~a~~~~g~~~ill~gH~DvVP~g~   85 (397)
T PRK13004         13 YKADMTRFLRDLIAIPSESGDEKRVVHRIKEEMEKVGFDKVEID-------PMGNVLGYIGHGKRLIAMDAHIDTVGVGD   85 (397)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEC-------CCCEEEEEECCCCCEEEEECCCCCCCCCC
T ss_conf             69999999999818999498999999999999987799779988-------99709999589997799987517889998


Q ss_pred             HHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCC-CCCCEEEEEEEECCCEECCCCCCCCCCCCCCCCC
Q ss_conf             777256664224521332365443332012454410000000113-5783499975202201104421111100013321
Q gi|254780782|r   81 FNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEK  159 (389)
Q Consensus        81 ~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~-~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~~~~~  159 (389)
                      .++|++|||+++++||+|||||++||||+++++|+|++.+++.+. +.++|.+++++|||.++..|+++++   .....+
T Consensus        86 ~~~W~~dPf~~~~~dg~lyGRGa~DmKg~~aa~l~A~~~l~~~~~~~~~~l~~~~~~dEE~~~g~~~~~~~---~~~~~~  162 (397)
T PRK13004         86 IKNWDFDPFEGMETDGRIYGRGTSDQKGGMASMVYAGKIIKDLGLEDEYTLYVTGTVQEEDCDGLAWRYII---EEDKIK  162 (397)
T ss_pred             CCCCCCCCCCCEEECCEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEEEEECCCCCCCHHHHHHH---HHCCCC
T ss_conf             66685699665898999994686545464899999999999629999826999998554256766899999---737999


Q ss_pred             CCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCCCCCC-CCCCCCEEEEE
Q ss_conf             20354145665434310012322235799999964123100000012013455443201122334456-64421014667
Q gi|254780782|r  160 WDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTG-NTTFSPTNMEI  238 (389)
Q Consensus       160 ~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~~~~-~~~~~~~~~~i  238 (389)
                      +|++|++||+..     .+++|+||.++++|+++|+++|||+|+.|+|||..+++++.+|+++..+.. ...+.+.++++
T Consensus       163 ~d~~ii~Ept~~-----~i~~g~kG~~~~~i~v~G~~~Hss~p~~g~NAI~~~~~~l~~l~~l~~~~~~~~~lg~~t~~~  237 (397)
T PRK13004        163 PDFVVITEPTDL-----NIYRGQRGRMEIRITTKGVSAHGSAPERGDNAIYKMAPILNELEELNPNLGEDPFLGKGTLTV  237 (397)
T ss_pred             CCEEEECCCCCC-----EEEEECCCEEEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEE
T ss_conf             998998788663-----699950407899999988638767842360999999999999986150434476678865898


Q ss_pred             EEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCC-----------EEEEECCCCCCCCCCC
Q ss_conf             65542046665543211665134342067799999999998765324203431-----------1232226631125786
Q gi|254780782|r  239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLS-----------HTVHFSSPVSPVFLTH  307 (389)
Q Consensus       239 ~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~-----------~~i~~~~~~~p~~~~~  307 (389)
                      +.|..|+.+.|+||++|++.+|+|+.|+++.+++.+++++.+...... ..++           ..++.....+++..+.
T Consensus       238 ~~i~~g~~~~n~vP~~~~~~~d~R~~pg~~~~~v~~~i~~~~~~~~~~-~~v~~~~~~~~~~~g~~~~~~~~~p~~~~~~  316 (397)
T PRK13004        238 SEIFSTSPSRCAVPDSCAISIDRRLTWGETWEGALDEIRALPAVQKAN-AEVSMYNYERPSYTGLVYPTECYFPTWLLEE  316 (397)
T ss_pred             EEEECCCCCCEEECCEEEEEEEEECCCCCCHHHHHHHHHHHHHHHCCC-CEEEEEECCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             757618973228898899999960799999999999999998743689-6799860567654675323211476557898


Q ss_pred             HHHHHHHHHHHHHHHHCCCCEEEECCCCCHH-HHH-HHCCCEEEEEECCCC-CCCCCCEEEHHHHHHHHHHHHHHHHHHC
Q ss_conf             7899999999999982899579741454358-898-605989999004787-3687840479999999999999999872
Q gi|254780782|r  308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDA-RFI-KDYCPVIEFGLVGRT-MHALNENASLQDLEDLTCIYENFLQNWF  384 (389)
Q Consensus       308 ~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~-~~~-~~~iP~v~fGp~~~~-~H~pdE~i~i~~l~~~~~~~~~~i~~~~  384 (389)
                      ++++++.+.+++++++|..|.....++++|+ .|. ..++|++.||||+.+ +|++|||++++++.+++++|++++.+||
T Consensus       317 d~p~v~~l~~~~~~~~g~~~~~~~~~~~td~~~~~~~~gip~v~~GPG~~~~aH~~dE~v~i~~l~~~~~iya~~~~~ll  396 (397)
T PRK13004        317 DHPIVKAAVKAYKGLFGKSPVVDKWTFSTNGVSIMGRAGIPTIGFGPGKEPLAHAPNEKTWKEQLVKAAAMYAAIPLSLL  396 (397)
T ss_pred             CCHHHHHHHHHHHHHHCCCCCCCCEEEEECHHHHHHHCCCCEEEECCCCCCCCCCCCCCEEHHHHHHHHHHHHHHHHHHH
T ss_conf             78999999999999869998302021361658889875998999898987778888732899999999999999999973


Q ss_pred             C
Q ss_conf             4
Q gi|254780782|r  385 I  385 (389)
Q Consensus       385 ~  385 (389)
                      -
T Consensus       397 ~  397 (397)
T PRK13004        397 K  397 (397)
T ss_pred             C
T ss_conf             9


No 10 
>PRK07522 acetylornithine deacetylase; Provisional
Probab=100.00  E-value=0  Score=508.06  Aligned_cols=367  Identities=24%  Similarity=0.353  Sum_probs=302.8

Q ss_pred             CHHHHHHHHHHHCCCCCCCCHH-HHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEEC-CCCCEEEEECCCCCCCCC
Q ss_conf             8789999999964999789968-99999999999779848999705888762489999987-999889997336815788
Q gi|254780782|r    2 TPDCLEHLIQLIKCPSVTPQDG-GAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG-TEAPHLMFAGHIDVVPPG   79 (389)
Q Consensus         2 ~~e~v~~l~~lv~ips~s~~e~-~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g-~~~~~ill~~H~Dtvp~~   79 (389)
                      +.+.|++|++||+|||+|+++. ++++|++++|+++||+++++....   +...||+++.| .++|+|+|+||+||||+ 
T Consensus         4 ~m~~v~ll~~LV~i~Svs~~~~~~~~~~l~~~l~~~G~~~~~~~~~~---g~~~nlia~~~~~~~~~lll~gH~DtVP~-   79 (387)
T PRK07522          4 SMSSLDILERLVAFDTVSRDSNLALIEWVRDYLAAHGIESELIHDPE---GTKANLFATIGPRDRGGIVLSGHTDVVPV-   79 (387)
T ss_pred             CCCHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC---CCEEEEEEEECCCCCCCEEEECCCCCCCC-
T ss_conf             67899999998099895998459999999999997799189997689---98337999979989971899677772799-


Q ss_pred             CHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCEECCCCCCCCCCCCCCCCC
Q ss_conf             87772566642245213323654433320124544100000001135783499975202201104421111100013321
Q gi|254780782|r   80 DFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEK  159 (389)
Q Consensus        80 ~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~~~~~  159 (389)
                      +.++|++|||+++++||+|||||++||||++|++|+|++.+.+.. ..++|.++|++|||.++. |++++++.+.....+
T Consensus        80 ~~~~W~~dPf~~~~~dg~lyGRGa~DmKg~laa~l~a~~~l~~~~-~~~~v~l~~~~dEE~g~~-G~~~l~~~~~~~~~~  157 (387)
T PRK07522         80 DGQAWTSDPFALTERDGRLYGRGTCDMKGFIAAALAAVPELAAAP-LRRPLHLAFSYDEEVGCL-GVPSMIARLAERGVK  157 (387)
T ss_pred             CCCCCCCCCCCCEEECCEEECCCCCCCCCHHHHHHHHHHHHHHCC-CCCCEEEEEEEEECCCCC-CCHHHHHHHHHCCCC
T ss_conf             997676799777587999988770203167999999999999658-988779999995314657-619999998861899


Q ss_pred             CCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCCCC-----CCCCCCCC-
Q ss_conf             203541456654343100123222357999999641231000000120134554432011223344-----56644210-
Q gi|254780782|r  160 WDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFD-----TGNTTFSP-  233 (389)
Q Consensus       160 ~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~~-----~~~~~~~~-  233 (389)
                      +|+||++|||...     +++|+||.++++++++|+++|||+|+.|+|||..++.++.+|.++...     .....+.+ 
T Consensus       158 ~d~~ivgEPt~~~-----v~~~~kG~~~~~v~v~G~~aHss~p~~G~NAI~~~~~~i~~l~~~~~~~~~~~~~~~~~~~p  232 (387)
T PRK07522        158 PAGCIVGEPTSMR-----PVVGHKGKAAYRCTVRGRAAHSSLAPRGVNAIEYAARLIAHLRDLADRLAAQGPFDALFDPP  232 (387)
T ss_pred             CCEEEECCCCCCE-----EEEEEEEEEEEEEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             8889976676878-----99986237999999996423557886787999999999999999999863337766566887


Q ss_pred             -EEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHH-----HHCCCCEEEEECCCCCCCCCCC
Q ss_conf             -1466765542046665543211665134342067799999999998765324-----2034311232226631125786
Q gi|254780782|r  234 -TNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQ-----NVPKLSHTVHFSSPVSPVFLTH  307 (389)
Q Consensus       234 -~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~-----~~~~~~~~i~~~~~~~p~~~~~  307 (389)
                       +|++++.|+ |+.+.|+||++|++++|+|+.|+++.+++.+++++++.+...     ......++++....++|+..+.
T Consensus       233 ~st~~~g~i~-GG~~~NvVP~~~~~~~d~R~~p~~~~~~v~~~i~~~~~~~~~~~~~~~~~~~~v~~~~~~~~p~~~~~~  311 (387)
T PRK07522        233 YSTLQTGTIQ-GGTALNIVPAECEFDFEFRALPGDDPEAILARIRAYAEEELLPEMRAVHPEAAIELEPLSAYPGLDTAE  311 (387)
T ss_pred             CCCCEEEEEE-CCCCCCEECCEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCC
T ss_conf             3433057761-784175638889999999628999999999999999998744444301888508998656678777998


Q ss_pred             HHHHHHHHHHHHHHHHCCCCEEEECCCCCHHH-HHHHCCCEEEEEECC-CCCCCCCCEEEHHHHHHHHHHHHHHHHHHCC
Q ss_conf             78999999999999828995797414543588-986059899990047-8736878404799999999999999998724
Q gi|254780782|r  308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDAR-FIKDYCPVIEFGLVG-RTMHALNENASLQDLEDLTCIYENFLQNWFI  385 (389)
Q Consensus       308 ~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~-~~~~~iP~v~fGp~~-~~~H~pdE~i~i~~l~~~~~~~~~~i~~~~~  385 (389)
                      ++++++.+++.    .+..+......| +|++ |...++|++.||||+ ..+|++|||+++++|.+++++|.++|.+++.
T Consensus       312 ~~~~v~~~~~~----~~~~~~~~~~~g-tda~~~~~~Gip~v~~GPG~~~~aH~~dE~v~i~~l~~~~~~~~~li~~Laa  386 (387)
T PRK07522        312 DAAAARLVRAL----TGDNDFRKVAYG-TEAGLFQRAGIPTVVCGPGSIEQAHKPDEFVELAQLAACEAFLRRLLASLAA  386 (387)
T ss_pred             CCHHHHHHHHH----HCCCCCCCCCCC-CCHHHHHHCCCCEEEECCCCCCCCCCCCCEEEHHHHHHHHHHHHHHHHHHHC
T ss_conf             66999999998----589988873135-7668797779999998999600377776318999999999999999999705


No 11 
>TIGR03320 ygeY M20/DapE family protein YgeY. Members of this protein family, including the YgeY protein of Escherichia coli, typically are found in extended genomic regions associated with purine catabolism. Homologs include peptidases and deacylases of the M20/M25 /M40 and DapE/ArgE families. The function is unknown.
Probab=100.00  E-value=0  Score=505.04  Aligned_cols=368  Identities=21%  Similarity=0.260  Sum_probs=304.5

Q ss_pred             CHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEECCCCCEEEEECCCCCCCCCCH
Q ss_conf             87899999999649997899689999999999977984899970588876248999998799988999733681578887
Q gi|254780782|r    2 TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDVVPPGDF   81 (389)
Q Consensus         2 ~~e~v~~l~~lv~ips~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g~~~~~ill~~H~Dtvp~~~~   81 (389)
                      +.|+|++|++||+|||+|++|.++++|++++|+++||+...++       ..+|++++.|.++++|+|+||+||||+|+.
T Consensus        12 ~~e~v~ll~~LV~ipS~sg~e~~~a~~l~~~l~~~G~~~~~vd-------~~~nv~~~~g~g~~~l~l~gH~DvVP~g~~   84 (395)
T TIGR03320        12 RGDMIRFLRDLVAIPSESGDEKRVAERIKEEMEKLGFDKVEID-------PMGNVLGYIGHGPKLIAMDAHIDTVGIGDS   84 (395)
T ss_pred             HHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEC-------CCCCEEEEECCCCCEEEEECCCCCCCCCCC
T ss_conf             6889999999828999397889999999999987899779987-------888389995899976999795477799986


Q ss_pred             HHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCCEECCCCCCCCCCCCCCCCCC
Q ss_conf             7725666422452133236544333201245441000000011-357834999752022011044211111000133212
Q gi|254780782|r   82 NHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKW  160 (389)
Q Consensus        82 ~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~~~~~~  160 (389)
                      ++|++|||+++++||+|||||++||||++|++|+|++.+++.+ ++.+.+.++++.+||.++..|..+++   .+.+..+
T Consensus        85 ~~W~~dPf~~~i~dg~iyGRGa~DmKgglaa~l~A~~~l~~~g~~~~~~~~~~~~~~EE~~~g~~~~~~~---~~~~~~~  161 (395)
T TIGR03320        85 KQWQFDPYEGYEDEEIIYGRGASDQEGGIASMVYAGKIIKDLGLLDDYTLLVTGTVQEEDCDGLCWQYII---EEDGIKP  161 (395)
T ss_pred             CCCCCCCCCCEEECCEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCCCEEEEEEEECCCCCCCCHHHHHH---HHCCCCC
T ss_conf             6786899866887999970474445245999999999998548889941999998144067880799998---6379998


Q ss_pred             CEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCCCCC-CCCCCCCEEEEEE
Q ss_conf             035414566543431001232223579999996412310000001201345544320112233445-6644210146676
Q gi|254780782|r  161 DACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDT-GNTTFSPTNMEIT  239 (389)
Q Consensus       161 d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~~~-~~~~~~~~~~~i~  239 (389)
                      |+||++||++.     .+++|+||.++++|+++|+++|||+|++|.|||..+++++.+++++..+. .+..+.+.+++++
T Consensus       162 d~~iv~EPt~~-----~i~~~~kG~~~~~i~v~G~~aHss~p~~G~NAI~~~~~~i~~l~~~~~~~~~~~~~~~~t~~v~  236 (395)
T TIGR03320       162 EFVVITEPTDM-----NIYRGQRGRMEIKVTVKGVSCHGSAPERGDNAIYKMAPILKELSQLNANLVEDPFLGKGTLTVS  236 (395)
T ss_pred             CEEEECCCCCC-----EEEEEECCEEEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEE
T ss_conf             97997679887-----2899403169999999860477778524729999999999999998776233876788746987


Q ss_pred             EEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCC-----------EEEEECCCCCCCCCCCH
Q ss_conf             5542046665543211665134342067799999999998765324203431-----------12322266311257867
Q gi|254780782|r  240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLS-----------HTVHFSSPVSPVFLTHD  308 (389)
Q Consensus       240 ~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~-----------~~i~~~~~~~p~~~~~~  308 (389)
                      .|..|+++.|+||++|++++|+|+.|+++.+.+.+++++........ ..+.           .........+++..+.+
T Consensus       237 ~i~~g~~~~n~vp~~~~~~~d~R~~~g~~~~~~~~~v~~~~~~~~~~-~~~~~~~~~~p~~~~~~~~~~~~~p~~~~~~d  315 (395)
T TIGR03320       237 EIFFSSPSRCAVADGCTISIDRRLTWGETWEYALEQIRNLPAVQGAE-AKVEMYNYDRPSYTGLVYPTECYFPTWVLPED  315 (395)
T ss_pred             EEECCCCCCCEECCEEEEEEEECCCCCCCHHHHHHHHHHHHHHHCCC-CEEEEEECCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             68538860537898689999962699999999999999888652353-21432103564336764420003765568987


Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEECCCCCHH-HHHH-HCCCEEEEEECCC-CCCCCCCEEEHHHHHHHHHHHHHHHHHHCC
Q ss_conf             899999999999982899579741454358-8986-0598999900478-736878404799999999999999998724
Q gi|254780782|r  309 RKLTSLLSKSIYNTTGNIPLLSTSGGTSDA-RFIK-DYCPVIEFGLVGR-TMHALNENASLQDLEDLTCIYENFLQNWFI  385 (389)
Q Consensus       309 ~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~-~~~~-~~iP~v~fGp~~~-~~H~pdE~i~i~~l~~~~~~~~~~i~~~~~  385 (389)
                      +++++.+.+++++++|..+.....++++|+ .|+. .++|++.||||+. .+|++|||+++++|.+++++|+.++.+||.
T Consensus       316 ~~~v~~l~~~~~~~~g~~~~~~~~~~~t~~~~~~~~~gip~v~fGPG~~~~aH~~dE~v~i~~l~~~~~iya~i~~~y~~  395 (395)
T TIGR03320       316 HLITKAALETYKRLFGKEPGVDKWTFSTNGVSIMGRHGIPVIGFGPGDEDQAHAPNEKTWKEDLVRAAAMYAAIPTVYLE  395 (395)
T ss_pred             CHHHHHHHHHHHHHHCCCCCCCCCCCEECHHHHHHHCCCCEEEECCCCCCCCCCCCCEEEHHHHHHHHHHHHHHHHHHHC
T ss_conf             79999999999998599983035310536489998749989998999855667876208999999999999999999729


No 12 
>TIGR03526 selenium_YgeY putative selenium metabolism hydrolase. SelD, selenophosphate synthase, is the selenium donor protein for both selenocysteine and selenouridine biosynthesis systems, but it occurs also in a few prokaryotes that have neither of those pathways. The method of partial phylogenetic profiling, starting from such orphan-selD genomes, identifies this protein as one of those most strongly correlated to SelD occurrence. Its distribution is also well correlated with that of family TIGR03309, a putative accessory protein of labile selenium (non-selenocysteine) enzyme maturation. This family includes the uncharacterized YgeY of Escherichia coli, and belongs to a larger family of metalloenzymes in which some are known peptidases, others enzymes of different types.
Probab=100.00  E-value=0  Score=503.73  Aligned_cols=369  Identities=21%  Similarity=0.267  Sum_probs=304.4

Q ss_pred             CCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEECCCCCEEEEECCCCCCCCCC
Q ss_conf             98789999999964999789968999999999997798489997058887624899999879998899973368157888
Q gi|254780782|r    1 MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDVVPPGD   80 (389)
Q Consensus         1 l~~e~v~~l~~lv~ips~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g~~~~~ill~~H~Dtvp~~~   80 (389)
                      .+.|+|++|++||+|||+|++|.++++|++++|+++||+...++       ..+|++++.|.++++|+|+||+||||+|+
T Consensus        11 ~~~e~v~ll~~LV~ipS~sg~e~~~a~~l~~~l~~~Gf~~~~id-------~~~nv~~~~g~g~~~l~l~gH~DvVp~g~   83 (395)
T TIGR03526        11 YRGDMIRFLRDLVAIPSESGDEGRVALRIKQEMEKLGFDKVEID-------PMGNVLGYIGHGPKLIAMDAHIDTVGIGD   83 (395)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEC-------CCCCEEEEECCCCCEEEEECCCCCCCCCC
T ss_conf             13779999999828999396789999999999987899779987-------88858999589996699979557369998


Q ss_pred             HHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCCEECCCCCCCCCCCCCCCCC
Q ss_conf             77725666422452133236544333201245441000000011-35783499975202201104421111100013321
Q gi|254780782|r   81 FNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEK  159 (389)
Q Consensus        81 ~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~~~~~  159 (389)
                      .++|++|||+++++||+|||||++||||++|++|.|++.|++.+ .+.+.+.++++.+||.++..|..+++   .+...+
T Consensus        84 ~~~W~~dPf~~~~~dg~iyGRGa~DmKgglaa~l~A~~~l~~~g~~~~~~~~~~~~~eEE~~~g~~~~~~~---~~~~~~  160 (395)
T TIGR03526        84 MDQWQFDPYEGYEDEEIIYGRGASDQEGGIASMVYAGKIIKDLGLLDDYTLLVTGTVQEEDCDGLCWQYII---EEDKIK  160 (395)
T ss_pred             CCCCCCCCCCCEEECCEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCCCCHHHHHHH---HHCCCC
T ss_conf             77786899865887999982375656125999999999998558888942999996254477873899999---747999


Q ss_pred             CCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCCCCCC-CCCCCCEEEEE
Q ss_conf             20354145665434310012322235799999964123100000012013455443201122334456-64421014667
Q gi|254780782|r  160 WDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTG-NTTFSPTNMEI  238 (389)
Q Consensus       160 ~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~~~~-~~~~~~~~~~i  238 (389)
                      +|++|++||+..     .+++|+||.++++|+++|+++|||+|++|.|||..+++++.+|+++..+.. +..+...++++
T Consensus       161 ~d~~Iv~EPt~~-----~i~~~~kG~~~~~i~v~G~~aHss~p~~G~NAI~~~~~~i~~l~~~~~~~~~~~~~~~~t~~~  235 (395)
T TIGR03526       161 PEFVVITEPTDM-----NIYRGQRGRMEIKVTVKGVSCHGSAPERGDNAIYKMAPILKELSQLNANLVEDPFLGKGTLTV  235 (395)
T ss_pred             CCEEEECCCCCC-----EEEEECCEEEEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEE
T ss_conf             998997689987-----699964448999999985045567865572999999999999999877524487778873588


Q ss_pred             EEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCC-----------EEEEECCCCCCCCCCC
Q ss_conf             65542046665543211665134342067799999999998765324203431-----------1232226631125786
Q gi|254780782|r  239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLS-----------HTVHFSSPVSPVFLTH  307 (389)
Q Consensus       239 ~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~-----------~~i~~~~~~~p~~~~~  307 (389)
                      +.|..|+++.|+||++|++++|+|+.|+++.+.+.+++++........ ..+.           .........+++..+.
T Consensus       236 ~~i~~g~~~~n~vp~~~~~~~d~R~~~~~~~~~~~~~i~~~~~~~~~~-~~~~~~~~~~p~~~~~~~~~~~~~p~~~~~~  314 (395)
T TIGR03526       236 SEIFFSSPSRCAVADGCTISIDRRLTWGETWEYALEQIRNLPAVQGAE-AEVEMYEYDRPSYTGLVYPTECYFPTWVLPE  314 (395)
T ss_pred             EEEECCCCCCCEECCEEEEEEEEECCCCCCHHHHHHHHHHHHHHHCCC-CEEEEEECCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             868538861427898689999970699999999999999888652356-4255541356433676442000376556898


Q ss_pred             HHHHHHHHHHHHHHHHCCCCEEEECCCCCHH-HHHH-HCCCEEEEEECC-CCCCCCCCEEEHHHHHHHHHHHHHHHHHHC
Q ss_conf             7899999999999982899579741454358-8986-059899990047-873687840479999999999999999872
Q gi|254780782|r  308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDA-RFIK-DYCPVIEFGLVG-RTMHALNENASLQDLEDLTCIYENFLQNWF  384 (389)
Q Consensus       308 ~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~-~~~~-~~iP~v~fGp~~-~~~H~pdE~i~i~~l~~~~~~~~~~i~~~~  384 (389)
                      ++++++.+.+++++++|..+.....++++|+ .|++ .++|++.||||+ ..+|++|||++++++.+++++|++++.+||
T Consensus       315 d~~~v~~~~~~~~~~~g~~~~~~~~~~~td~~~~~~~~gip~V~fGPG~~~~aH~~dE~v~i~~l~~a~~iYa~i~~~~~  394 (395)
T TIGR03526       315 DHLITKAALETYKRLFGKEPGVDKWTFSTNGVSIMGRHGIPVIGFGPGDEDQAHAPNEKTWKEDLVKAAAMYAAIPTVYL  394 (395)
T ss_pred             CCHHHHHHHHHHHHHHCCCCCCCCCCEEECHHHHHHHCCCCEEEECCCCCCCCCCCCCCEEHHHHHHHHHHHHHHHHHHH
T ss_conf             67999999999999859998404531154669999874998999899985566676611899999999999999999972


Q ss_pred             C
Q ss_conf             4
Q gi|254780782|r  385 I  385 (389)
Q Consensus       385 ~  385 (389)
                      .
T Consensus       395 ~  395 (395)
T TIGR03526       395 Q  395 (395)
T ss_pred             C
T ss_conf             9


No 13 
>PRK08596 acetylornithine deacetylase; Validated
Probab=100.00  E-value=0  Score=490.26  Aligned_cols=369  Identities=20%  Similarity=0.293  Sum_probs=306.1

Q ss_pred             CHHHHHHHHHHHCCCCCCC---CHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEE-CCC---CCEEEEECCCC
Q ss_conf             8789999999964999789---9689999999999977984899970588876248999998-799---98899973368
Q gi|254780782|r    2 TPDCLEHLIQLIKCPSVTP---QDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF-GTE---APHLMFAGHID   74 (389)
Q Consensus         2 ~~e~v~~l~~lv~ips~s~---~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~-g~~---~~~ill~~H~D   74 (389)
                      +.|+|++|++||+|||+|+   ++.++++|++++|+++||++++.++.++.    .|+++++ |.+   .++|+|++|||
T Consensus        12 ~~e~i~ll~~LV~i~S~sp~g~~~~~~~~~l~~~l~~~G~~~~~~~~~~~~----~n~ia~~~g~~~~~~~~l~l~gH~D   87 (421)
T PRK08596         12 KEELLELTKTLIRFETPAPPARNTNEAQQFIAEFLRKRNFSVDKWDVYPND----PNVVGVKKGTESDTHKSLIINGHMD   87 (421)
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCC----CEEEEEECCCCCCCCCEEEEECCCC
T ss_conf             899999999995899989898687899999999999779928999835998----5699997577889987699967614


Q ss_pred             CCCCCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCCEECCCCCCCCCCC
Q ss_conf             15788877725666422452133236544333201245441000000011-35783499975202201104421111100
Q gi|254780782|r   75 VVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEGPAINGTKKMLSWI  153 (389)
Q Consensus        75 tvp~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~~~~~G~~~l~~~~  153 (389)
                      |||+++.++|++|||+++++||+|||||++||||++|++|.|+++|.+.+ .+.++|.|+|++|||.++. |++++++  
T Consensus        88 vVpv~~~~~W~~~Pf~~~i~dg~lyGRGa~DmKgg~aa~l~A~~~l~~~g~~~~~~l~~~~~~dEE~g~~-G~~~~~~--  164 (421)
T PRK08596         88 VAEVSADEAWETNPFEPFIKDGWLVGRGAADMKGGLAGALFAIQLLHEAGIELPGDLIFQSVIGEEVGEA-GTLQCCK--  164 (421)
T ss_pred             CCCCCCCCCCCCCCCCCEEECCEEEECCHHCCCCHHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCCCH-HHHHHHH--
T ss_conf             1589998767569986588899998166201415399999999999982899995399999936645626-7999997--


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECC----------CCHHHHCCCCHHHHHHHHHHCCCCCC
Q ss_conf             01332120354145665434310012322235799999964123----------10000001201345544320112233
Q gi|254780782|r  154 EKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQG----------HVAYPHLTENPIRGLIPLLHQLTNIG  223 (389)
Q Consensus       154 ~~~~~~~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~----------Hs~~p~~g~nAi~~~~~~i~~l~~~~  223 (389)
                        ++...|+++++||+...      +.|++|.+...++++|+.+          ||+.|+.|.|||..+++++..|.++.
T Consensus       165 --~~~~~d~~iv~e~~~~~------~~g~~G~~~~~i~v~~~~~~~~~~~~~~~Ha~~~~~G~nAi~~~~~~i~~l~~l~  236 (421)
T PRK08596        165 --RGYDADFAVVVDTSDLH------MQGQGGVITGWITVKSPQTFHDGTRRQMIHAGGGLFGASAIEKMMKIIQSLQELE  236 (421)
T ss_pred             --CCCCCCEEEEECCCCCE------EECCCEEEEEEEEEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             --29999989995698874------6623128999999998655421445542024674100218999999999999999


Q ss_pred             CC----CCCCCC--CCEEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCC-------
Q ss_conf             44----566442--10146676554204666554321166513434206779999999999876532420343-------
Q gi|254780782|r  224 FD----TGNTTF--SPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKL-------  290 (389)
Q Consensus       224 ~~----~~~~~~--~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~-------  290 (389)
                      ..    .....+  ..+|+|++.|+ |+.+.|+||++|++.+|+|+.|+++.+++.+++++.+.+.....+.+       
T Consensus       237 ~~~~~~~~~~~~~~g~~tin~~~i~-gG~~~n~Vp~~~~~~id~R~~P~~~~e~v~~ei~~~l~~~~~~d~~~~~~~~~~  315 (421)
T PRK08596        237 RHWAVMKTYPGYPPGTNTINPAVIE-GGRHAAFIADECRLWITVHFYPNETHEQIIKEIEEYIGKVAAADPWLRENPPQF  315 (421)
T ss_pred             HHHHCCCCCCCCCCCCCEEEEEEEC-CCCCCCCCCCEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCHHHHHCCCEE
T ss_conf             7550115688889986467777862-787664238737999998659999999999999999999873142554067525


Q ss_pred             ----CEEEEECC-CCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHH-HCCCEEEEEECC-CCCCCCCCE
Q ss_conf             ----11232226-63112578678999999999999828995797414543588986-059899990047-873687840
Q gi|254780782|r  291 ----SHTVHFSS-PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVG-RTMHALNEN  363 (389)
Q Consensus       291 ----~~~i~~~~-~~~p~~~~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~-~~iP~v~fGp~~-~~~H~pdE~  363 (389)
                          +..++... ..+++..+.++++++.+.++++++++..+....++|++|++|++ .++|+++|||++ .++|++|||
T Consensus       316 ~~g~~~~i~~~~~~~p~~~~~~~~~~v~~l~~~~~~v~g~~~~~~~~~~~tD~~~~~~~gip~v~~GPG~~~~aH~~nE~  395 (421)
T PRK08596        316 KWGGESMIEDRGEIFPSLEIDSEHPAVKTLSSVHESVLSKNAILDMSATVTDGGWFSEFGIPAVIYGPGTLEEAHSVNEK  395 (421)
T ss_pred             EECCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEECCCCCCHHHHHHHCCCCEEEECCCCHHCCCCCCCE
T ss_conf             54572588741443677578998899999999999973999745046643449999875999999999944508876631


Q ss_pred             EEHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             47999999999999999987247
Q gi|254780782|r  364 ASLQDLEDLTCIYENFLQNWFIT  386 (389)
Q Consensus       364 i~i~~l~~~~~~~~~~i~~~~~~  386 (389)
                      +++++|.+++++|+++|.+||.+
T Consensus       396 v~i~~l~~~~ki~~~~l~~~~~~  418 (421)
T PRK08596        396 VEIEQLIEYTKVITAFIYEWCHT  418 (421)
T ss_pred             EEHHHHHHHHHHHHHHHHHHHCC
T ss_conf             89999999999999999998656


No 14 
>PRK08651 succinyl-diaminopimelate desuccinylase; Reviewed
Probab=100.00  E-value=0  Score=486.75  Aligned_cols=350  Identities=26%  Similarity=0.390  Sum_probs=298.2

Q ss_pred             HHHHHHHHHHHCCCEEEEEEECCCC-------CCEEEEEEEEEC-CCCCEEEEECCCCCCCCCCHHHCCCCCCCEEEECC
Q ss_conf             9999999999779848999705888-------762489999987-99988999733681578887772566642245213
Q gi|254780782|r   25 AFFILVNTLKLLGFSIEEKDFQTKN-------TSIVKNLYARFG-TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEG   96 (389)
Q Consensus        25 ~~~~l~~~l~~~G~~~~~~~~~~~~-------~~~~~~~~~~~g-~~~~~ill~~H~Dtvp~~~~~~W~~~Pf~~~~~~g   96 (389)
                      +++||+++|+++||++|++++.+..       .+..+||+++.+ +++|+|+|+||+||||+++  +|++|||+++++||
T Consensus         1 ~~~~l~~~l~~~G~~~e~~~~~~~~~~~~~~~~~~~~nl~~~~~~~~~~~l~l~gH~DvVp~~~--~W~~dPf~~~~~dg   78 (371)
T PRK08651          1 IVELLRDYLESLGFDTEIIEVPDEEVDKLYPYEKDYPNLILLARNGGEPKLHFNGHYDVVPPGE--GWKVTPFEPKVKDG   78 (371)
T ss_pred             CHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCEEEEEECCCCCCEEEEECCCCCCCCCC--CCCCCCCCEEEECC
T ss_conf             9789999999779879999778754443344579974699996899998799971255169999--87379974299899


Q ss_pred             CCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCEECCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCE
Q ss_conf             32365443332012454410000000113578349997520220110442111110001332120354145665434310
Q gi|254780782|r   97 KIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGD  176 (389)
Q Consensus        97 ~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~~~~~~d~~i~~ep~~~~~~~~  176 (389)
                      +|||||++||||+++++|+|++.+.+.+...+++.++|++|||.++..|++++.+.   ...++|+++++||+...    
T Consensus        79 ~lyGRGa~D~Kg~iaa~l~Al~~l~~~~~~~~~i~~~~~~dEE~gg~~G~~~l~~~---~~~~~d~~iv~ept~~~----  151 (371)
T PRK08651         79 KIYGRGASDMKGGIAAILAAFERLAEAGEKPSNVEVAFVPDEETGGETGTGYLAEK---GGIKPDYVIVAEPSGLD----  151 (371)
T ss_pred             EEECCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCHHHHHHH---CCCCCCEEEEECCCCCC----
T ss_conf             99916623346899999999999997499999889999914345776435677663---15688999997799986----


Q ss_pred             EEEEEEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCCCCCCC----------CCCCCEEEEEE-EEEECC
Q ss_conf             0123222357999999641231000000120134554432011223344566----------44210146676-554204
Q gi|254780782|r  177 TIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGN----------TTFSPTNMEIT-TIDVGN  245 (389)
Q Consensus       177 ~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~~~~~----------~~~~~~~~~i~-~i~~g~  245 (389)
                      .+++|+||.++++|+++|+++|||+|+.|+|||..++.++.+|.+...+...          .....++.+++ .+..|+
T Consensus       152 ~v~~g~kG~~~~~i~v~G~~~Hss~P~~g~NAi~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gg  231 (371)
T PRK08651        152 NVCIGHRGLVWGIVKVYGKQAHGSTPWLGLNAFEKASKIALELQQELKEIVKIRLSKYEIIPPRGASPTVTLGGEVVKGG  231 (371)
T ss_pred             CEEEECCEEEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEEEEEECC
T ss_conf             25883444899999986886434687767199999999999998645443101024545564336785488612388778


Q ss_pred             CCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCC
Q ss_conf             66655432116651343420677999999999987653242034311232226631125786789999999999998289
Q gi|254780782|r  246 PSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGN  325 (389)
Q Consensus       246 ~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~l~~a~~~~~g~  325 (389)
                      .+.|+||++|++++|+|++|+++.+++.++|++++.+...+ .+.+++++.....+|+.+++++++++.+.+++++++|.
T Consensus       232 ~~~Nvip~~a~~~~d~R~~p~~~~~~v~~~i~~~l~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~v~~l~~a~~~~~G~  310 (371)
T PRK08651        232 TKTNIVPGYFAFSVDRRLIPEEDLEEVIDELIALLDEVAKE-LGIKVEVEITDFSEPAYTDPDNELVEALREAIREVLGR  310 (371)
T ss_pred             CCCCEECCEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHH-CCCEEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCC
T ss_conf             52306367599999986399999999999999999987665-19469999876267311199998999999999998799


Q ss_pred             CCEEEECCCCCHHHHHH-HCCCEEEEEECC-CCCCCCCCEEEHHHHHHHHHHHHHHHHHHC
Q ss_conf             95797414543588986-059899990047-873687840479999999999999999872
Q gi|254780782|r  326 IPLLSTSGGTSDARFIK-DYCPVIEFGLVG-RTMHALNENASLQDLEDLTCIYENFLQNWF  384 (389)
Q Consensus       326 ~~~~~~~gg~~d~~~~~-~~iP~v~fGp~~-~~~H~pdE~i~i~~l~~~~~~~~~~i~~~~  384 (389)
                      .+.+..++|++|+++++ .++|++.|||+. .++|++|||++++++.+++++|+++|++++
T Consensus       311 ~~~~~~~~G~tDa~~~~~~gip~v~~Gpg~~~~aH~~nE~v~i~~l~~~~~iy~~~i~~Ll  371 (371)
T PRK08651        311 EPKKTICLGGTDARYFIKKGIPTVNYGPGELGLAHAPDEYVEVKDVENVAKVYKDLLKRLL  371 (371)
T ss_pred             CCCEEEECCCCHHHHHHHCCCCEEEECCCCCCCCCCCCCEEEHHHHHHHHHHHHHHHHHHC
T ss_conf             9717876131759999875999999899985665798550999999999999999999869


No 15 
>TIGR01910 DapE-ArgE acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase; InterPro: IPR010182   This group of sequences contains annotations for both acetylornithine deacetylase and succinyl-diaminopimelate desuccinylase, but does not contain any members with experimental characterization. Bacillus, Staphylococcus and Sulfolobus species contain multiple hits to this subfamily and each may have a separate activity. Determining which is which must await further laboratory research.; GO: 0009014 succinyl-diaminopimelate desuccinylase activity, 0046872 metal ion binding, 0009085 lysine biosynthetic process.
Probab=100.00  E-value=0  Score=493.80  Aligned_cols=365  Identities=27%  Similarity=0.386  Sum_probs=307.2

Q ss_pred             HHHHHHHHCCCC---CCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEE--------------EEEEEECCC-CCEE
Q ss_conf             999999964999---7899689999999999977984899970588876248--------------999998799-9889
Q gi|254780782|r    6 LEHLIQLIKCPS---VTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVK--------------NLYARFGTE-APHL   67 (389)
Q Consensus         6 v~~l~~lv~ips---~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~--------------~~~~~~g~~-~~~i   67 (389)
                      |++|++||+|||   +.+++..++.||+++|+++||+++.+++..+......              ++....|++ .|.|
T Consensus         1 ~~~lk~LI~i~svnP~~~~~~~~~~~i~~lL~~~G~~~~~~~~~~~~~~~~~~F~p~~~DF~~~~~~~~~~~g~~~~~~L   80 (427)
T TIGR01910         1 VELLKDLISIPSVNPPGGNEETIANYIKDLLREFGFEVDVIEITDDRLKKLSRFGPIRSDFQKKRKIVVKEIGNGREKSL   80 (427)
T ss_pred             CCCHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHCCCCCCCCHHHHCCCCEEEEEECCCCCCEE
T ss_conf             90025462677889788754679999999998539705887407675000467787400101146126873147897079


Q ss_pred             EEECCCCCCCCCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECC--CEECC
Q ss_conf             997336815788877725666422452133236544333201245441000000011-357834999752022--01104
Q gi|254780782|r   68 MFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEE--GPAIN  144 (389)
Q Consensus        68 ll~~H~Dtvp~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE--~~~~~  144 (389)
                      +|+|||||||+|+.+.|++|||+|+++||+||||||+|||||++|+|.|+.+|.+.+ ++.+++.|.+++|||  +|+. 
T Consensus        81 ~~ngH~DVVp~Gd~~~W~~dPF~~~ekdGK~yGRGa~DMKgG~~a~~~A~~~l~~~~~~~~g~~~l~~V~dEE~~~g~~-  159 (427)
T TIGR01910        81 ILNGHYDVVPAGDVEKWKTDPFKPVEKDGKLYGRGATDMKGGLVALLYALKALREAGLKLNGNIILQAVVDEEETSGEA-  159 (427)
T ss_pred             EEECCEEECCCCCCCCCCCCCCCCEEECCEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCHHCCCCCH-
T ss_conf             9973341203885225778997337876807755665126899999999999996488977407998853701055225-


Q ss_pred             CCCCCCCCCCCC----CCCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCC
Q ss_conf             421111100013----3212035414566543431001232223579999996412310000001201345544320112
Q gi|254780782|r  145 GTKKMLSWIEKK----GEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLT  220 (389)
Q Consensus       145 G~~~l~~~~~~~----~~~~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~  220 (389)
                      |+.++++.....    -..+|.+|+.|||+..  +..+++++||++|++|+++|+.+|||+|..|.|||..++.++.+|.
T Consensus       160 G~~~~~~~G~~~~faivaD~d~~li~EPsgek--~~~~~~~~kG~~~~~~~v~Gk~~H~s~p~~G~nAi~~~~k~~~~l~  237 (427)
T TIGR01910       160 GTLYLLQKGYFKDFAIVADADGVLIPEPSGEK--GDKIVIGQKGSIWFKVKVKGKQAHASTPEEGVNAIEKLAKLITELE  237 (427)
T ss_pred             HHHHHHHHHHHHCCEEECCHHHEEECCCCCCC--CCEEEEEEEEEEEEEEEEEEEEECCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             68999997654134233472000743888876--5525665313689999962023024576523889999999999998


Q ss_pred             CCCCCCC-------------------CCCCCCEEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             2334456-------------------644210146676554204666554321166513434206779999999999876
Q gi|254780782|r  221 NIGFDTG-------------------NTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLI  281 (389)
Q Consensus       221 ~~~~~~~-------------------~~~~~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~  281 (389)
                      +......                   .....+.++|++.|++| ...|+||+.|.+.+++|+.|+++.+++.+.|++.+.
T Consensus       238 ~~~~~~~~~~~~~ieamtari~~~~~~~~~~~~~~n~~vi~gG-~~vn~VPd~~~~~~~~r~~P~~~~~~v~~~~~~~~~  316 (427)
T TIGR01910       238 ELEEKINARNDILIEAMTARIAPEILKEIPGPVTFNPGVIKGG-DWVNSVPDRAEFEVDVRIIPEENLEEVKQEVESVVK  316 (427)
T ss_pred             HHHHHHHCCHHHHHHHHHHHCCCHHHHCCCCCEECCCCEEECC-CCCCCCCCEEEEEEEEEECCCCCHHHHHHHHHHHHH
T ss_conf             8876552001344444542057202111488420285166468-755604545999999864689887999999999996


Q ss_pred             HHHHHHCCCCEE----EEECC---------CCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHH-HC---
Q ss_conf             532420343112----32226---------63112578678999999999999828995797414543588986-05---
Q gi|254780782|r  282 KGIQNVPKLSHT----VHFSS---------PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DY---  344 (389)
Q Consensus       282 ~~~~~~~~~~~~----i~~~~---------~~~p~~~~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~-~~---  344 (389)
                      +...+ ..+.++    +++..         -++|..+++|++++..|+++++++.|..+....+.|+||++|+. .+   
T Consensus       317 ~~~~~-~~~~~e~~~~~~~~G~~~~edrGeif~P~~~~~d~~lv~~l~~~~~~~~g~~~~~~~s~g~TD~~~~~~~g~~d  395 (427)
T TIGR01910       317 ALSKS-DGVLAELEVVVEWSGASSLEDRGEIFEPNETPDDSELVKALENVIKKVLGIEAKVLVSSGTTDARFFRKAGGKD  395 (427)
T ss_pred             HCCCC-CCCHHCCCCEECCCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCCCE
T ss_conf             22533-30021255103356420310355501787788874679999998766645431157643213588887458962


Q ss_pred             CCEEEEEEC-CCCCCCCCCEEEHHHHHHHHHH
Q ss_conf             989999004-7873687840479999999999
Q gi|254780782|r  345 CPVIEFGLV-GRTMHALNENASLQDLEDLTCI  375 (389)
Q Consensus       345 iP~v~fGp~-~~~~H~pdE~i~i~~l~~~~~~  375 (389)
                      +|+++|||| ..++|+.||||++++|.+.+++
T Consensus       396 ~P~ivyGPG~~~~aH~~NEyi~~~~l~~~~~v  427 (427)
T TIGR01910       396 IPVIVYGPGELETAHQVNEYISIKNLVESIKV  427 (427)
T ss_pred             EEEEEECCCCCCCCCCCCCCEEHHHHHHHHCC
T ss_conf             58998548888888745565118777765339


No 16 
>PRK07906 hypothetical protein; Provisional
Probab=100.00  E-value=0  Score=469.54  Aligned_cols=364  Identities=18%  Similarity=0.228  Sum_probs=285.8

Q ss_pred             CHHHHHHHHHHHCCCCCC------CCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEEC-C--CCCEEEEECC
Q ss_conf             878999999996499978------996899999999999779848999705888762489999987-9--9988999733
Q gi|254780782|r    2 TPDCLEHLIQLIKCPSVT------PQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG-T--EAPHLMFAGH   72 (389)
Q Consensus         2 ~~e~v~~l~~lv~ips~s------~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g-~--~~~~ill~~H   72 (389)
                      +.|+|++|++||+|||+|      ++|.++++|++++|+++||++++++..+    .++||+++++ .  +.|+|+|+||
T Consensus         9 ~~e~v~ll~~Li~i~svnp~~~~~~~e~~~a~~l~~~l~~~G~~~~~~~~~~----gr~nlva~~~G~~~~~~~lll~gH   84 (437)
T PRK07906          9 EDEVVDLCSELIRFDTSNTGDGDTKGEREAAEYVAEQLAEVGLEPEYVESGP----GRGNVVARIPGADPSRGALLVHGH   84 (437)
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC----CCEEEEEEECCCCCCCCEEEEECC
T ss_conf             4799999999958899899988980599999999999997799579994589----950899997788899986999799


Q ss_pred             CCCCCCCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCCEECCCCCCCCC
Q ss_conf             6815788877725666422452133236544333201245441000000011-357834999752022011044211111
Q gi|254780782|r   73 IDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEGPAINGTKKMLS  151 (389)
Q Consensus        73 ~Dtvp~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~~~~~G~~~l~~  151 (389)
                      +||||+ +.++|++|||+++++||+|||||++||||++|++|+|++.|++.+ ++.++|.|+|++|||++|..|++++++
T Consensus        85 ~DVVP~-~~~~Wt~~PF~~~i~dG~iyGRGa~DmKg~~aa~l~a~~~l~~~g~~~~~~v~l~~~~DEE~gg~~Ga~~l~~  163 (437)
T PRK07906         85 LDVVPA-EAADWSVHPFSGEIKDGYVWGRGAVDMKDMDAMMLAVARHFARTGRVPPRDLVFAFVADEEAGGTYGAHWLVD  163 (437)
T ss_pred             CCCCCC-CCCCCCCCCCCCEECCCEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCCCHHHHHH
T ss_conf             673799-9453767996657618859951444553039999999999998578889978998557743465462799986


Q ss_pred             CCCCCCCCCCEEEECCCCCCCC------CCEEEEEEEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCCCC
Q ss_conf             0001332120354145665434------3100123222357999999641231000000120134554432011223344
Q gi|254780782|r  152 WIEKKGEKWDACIVGEPTCNHI------IGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFD  225 (389)
Q Consensus       152 ~~~~~~~~~d~~i~~ep~~~~~------~~~~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~~  225 (389)
                      ...+....... .++|.++...      ....|.+++||.++++++++|+++|||+|+. .|||..+++++.+|.+..++
T Consensus       164 ~~~~~~~~~~~-~i~e~gg~~~~~~~~~~~~~i~~a~KG~~~~~l~v~G~~~H~S~p~~-~nai~~l~~al~~l~~~~~p  241 (437)
T PRK07906        164 NRPDLFEGVTE-AISEVGGFSLTVPRRDRLYLIETAEKGLAWMRLTARGRAGHGSMVND-DNAVTALAEAVARIGRHQFP  241 (437)
T ss_pred             HCHHHHHHHHH-HHCCCCCCCCCCCCCCCEEEEEEEEEEEEEEEEEEEEECCCCCCCCC-CCHHHHHHHHHHHHHHCCCC
T ss_conf             48676520156-64355664432389974445776400489999999756676777788-78999999999987641475


Q ss_pred             C-----------------------CC------------CC---CCCEEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHH
Q ss_conf             5-----------------------66------------44---2101466765542046665543211665134342067
Q gi|254780782|r  226 T-----------------------GN------------TT---FSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLW  267 (389)
Q Consensus       226 ~-----------------------~~------------~~---~~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~  267 (389)
                      .                       .+            ..   .-++|++++.|++ +...|+||++|++.+|+|+.|++
T Consensus       242 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~~t~i~g-G~~~NviP~~a~~~id~R~~P~~  320 (437)
T PRK07906        242 LVLTPTVRQFLDEVAEETGIEFDPDDLEGTLAKLGPIARMVGATLRNTANPTMLKA-GYKVNVIPGTAEAVVDCRFLPGR  320 (437)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCCCCCCHHHHHHHCCCHHHHCCCEEECCCCCEEEEC-CCCCCCCCCCEEEEEEEEECCCC
T ss_conf             10258999999988886378788533678887507524320640104325426735-87577578705999998558895


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHH-CCCCEEEECCCCCHHHHHH-HCC
Q ss_conf             79999999999876532420343112322266311257867899999999999982-8995797414543588986-059
Q gi|254780782|r  268 NEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTT-GNIPLLSTSGGTSDARFIK-DYC  345 (389)
Q Consensus       268 ~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~l~~a~~~~~-g~~~~~~~~gg~~d~~~~~-~~i  345 (389)
                      + +.+.+++++.+.        ..+++++....+|..++.++++++.+.+++.... +..+.+...+|+||+++++ .++
T Consensus       321 ~-~~~~~~v~~~~~--------~~v~~e~~~~~~~~~~~~d~~~~~~l~~a~~~~~~~~~~~p~~~~ggTDa~~f~~~gi  391 (437)
T PRK07906        321 E-EEFEATVDELLG--------PDVEREWVHDLPALETPFDGDLVDAMNAALLAEDPDARVVPYMLSGGTDAKSFSRLGI  391 (437)
T ss_pred             H-HHHHHHHHHHCC--------CCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHCCC
T ss_conf             2-999999998718--------9649999347887679998689999999999767996155530165134999987599


Q ss_pred             CEEEEEECC--------CCCCCCCCEEEHHHHHHHHHHHHHHHHH
Q ss_conf             899990047--------8736878404799999999999999998
Q gi|254780782|r  346 PVIEFGLVG--------RTMHALNENASLQDLEDLTCIYENFLQN  382 (389)
Q Consensus       346 P~v~fGp~~--------~~~H~pdE~i~i~~l~~~~~~~~~~i~~  382 (389)
                      |++.|||+.        ..+|++||||++++|.+++++|+++|++
T Consensus       392 ~~~~fgP~~l~~~~~~~~~~H~~dE~V~i~~L~~~~~v~~r~l~~  436 (437)
T PRK07906        392 RCFGFAPLRLPPDLDFAALFHGVDERVPVDALRFGVRVLDRFLRH  436 (437)
T ss_pred             CEEEECCCCCCCCCCCCCCCCCCCCCEEHHHHHHHHHHHHHHHHC
T ss_conf             899989921476677443676899769899999999999999963


No 17 
>PRK06446 hypothetical protein; Provisional
Probab=100.00  E-value=0  Score=468.23  Aligned_cols=370  Identities=23%  Similarity=0.300  Sum_probs=296.4

Q ss_pred             CHHHHHHHHHHHCCCCCCCC---HHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEECC-CCCEEEEECCCCCCC
Q ss_conf             87899999999649997899---68999999999997798489997058887624899999879-998899973368157
Q gi|254780782|r    2 TPDCLEHLIQLIKCPSVTPQ---DGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT-EAPHLMFAGHIDVVP   77 (389)
Q Consensus         2 ~~e~v~~l~~lv~ips~s~~---e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g~-~~~~ill~~H~Dtvp   77 (389)
                      ..|.|+.|++||+|||+|+.   ..++++|++++|+++||+++....     +..+|++++++. ++|+|+|+||+||||
T Consensus         1 ~~~~l~~L~~li~ipsv~~~~~~~~~~a~~l~~~l~~~G~~~~i~~~-----~g~p~v~a~~~~~~~~~lll~gH~DVVP   75 (433)
T PRK06446          1 RMDSLKDLIEFLKIPSTSATGEGIEETAKFLKDYMEDLGIEAEIRHT-----AGNPVVYGEINVGAKKTLLIYNHYDVQP   75 (433)
T ss_pred             CCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEC-----CCCCEEEEEECCCCCCEEEEECCCCCCC
T ss_conf             96389999999688998939638999999999999977995999966-----9985899995589998499934747779


Q ss_pred             CCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCEECCCCCCCCCCCCCCC
Q ss_conf             88877725666422452133236544333201245441000000011357834999752022011044211111000133
Q gi|254780782|r   78 PGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKG  157 (389)
Q Consensus        78 ~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~~~  157 (389)
                      +++.++|++|||+++++||+|||||++||||+++++|+|++.+++++.+..++.+++++|||.|+.+ ...++.... ..
T Consensus        76 ~~~~~~W~~dPF~~~i~dg~lyGRGa~DmKg~~~a~l~A~~~l~~~~~~p~~i~~~~~~dEE~Gs~~-~~~~l~~~~-~~  153 (433)
T PRK06446         76 VDPLDEWKTDPFSPTIKDGKIYARGVSDNKGTLMARLQAIIELLKEGKLPVNFKFLYEGEEEIGSPN-LENFLKRNK-NK  153 (433)
T ss_pred             CCCCCCCCCCCCCEEEECCEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCHH-HHHHHHHHH-HH
T ss_conf             9987777679963288899899824556650489999999999861579840899971262126167-999999755-52


Q ss_pred             CCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEE--EECCCCHHHHCCCCHHHHHHHHHHCCCCCCC-------CC--
Q ss_conf             212035414566543431001232223579999996--4123100000012013455443201122334-------45--
Q gi|254780782|r  158 EKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIH--GKQGHVAYPHLTENPIRGLIPLLHQLTNIGF-------DT--  226 (389)
Q Consensus       158 ~~~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~--G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~-------~~--  226 (389)
                      ...|++++.+.+......+.+++|+||.++++++++  |+++||++|..+.||+..+++++.+|.+...       +.  
T Consensus       154 ~~~d~~i~~~~g~~~~~~~~i~~g~kG~~~~~l~v~~~~~~~Hss~~~~~~n~~~~l~~~l~~l~~~~~~~i~~~~~~v~  233 (433)
T PRK06446        154 LKADYVIMEGAGLDPKGRPMIVLGVKGLLYVELRVRTGSKDLHSSNAPIVYNPAWELVKILSSLYDGGRVLIPGFYDDVR  233 (433)
T ss_pred             CCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCEECCCCCCCCC
T ss_conf             36658995587656899727999711479999999638987663567656588999999999731367030344345445


Q ss_pred             -------------------------------------CCCCCCCEEEEEEEEEEC---CCCCCCCCCCEEEEECCCCCCH
Q ss_conf             -------------------------------------664421014667655420---4666554321166513434206
Q gi|254780782|r  227 -------------------------------------GNTTFSPTNMEITTIDVG---NPSKNVIPAQVKMSFNIRFNDL  266 (389)
Q Consensus       227 -------------------------------------~~~~~~~~~~~i~~i~~g---~~~~NvIP~~a~~~~diR~~~~  266 (389)
                                                           ....+..+|++++.+.+|   .++.|+||++|++.+|+|++|+
T Consensus       234 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pt~~i~gi~~g~~g~g~~nviP~~a~a~~d~R~~p~  313 (433)
T PRK06446        234 WLSEEEKELLKKYDIDMEELKKALGAYNLKQNEPYEYARALVTEPTCNIDGIYSGYTGKGSKTIIPSYAFAKIDFRLVPD  313 (433)
T ss_pred             CCCHHHHHHHHHCCCCHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEECCEECCCCCCCCCEECCCHHEEEEEEEECCC
T ss_conf             55899999997478878998754364211356763389986248715003424587688875373731189887753899


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEE-ECCCCCHHHHH-H-H
Q ss_conf             7799999999998765324203431123222663112578678999999999999828995797-41454358898-6-0
Q gi|254780782|r  267 WNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLS-TSGGTSDARFI-K-D  343 (389)
Q Consensus       267 ~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~l~~a~~~~~g~~~~~~-~~gg~~d~~~~-~-~  343 (389)
                      ++.+++.+.|++++.+       .+.+++......|+.+++++++++.+.+++++++|.+|... ..+|++|..++ + .
T Consensus       314 ~~~~~i~~~l~~~l~~-------~~~~i~~~~~~~p~~t~~d~~~v~~l~~~~~~~~g~~p~~~~~~~gt~~~~~~~~~~  386 (433)
T PRK06446        314 QDPKKIFRSLLEHLKD-------FKVEIIVHGKEKPVRTSPNSKVARAMIESAKKVYGVDPVVIPNSPGTQPMGLFARYL  386 (433)
T ss_pred             CCHHHHHHHHHHHHCC-------CCEEEEEECCCCCEECCCCCHHHHHHHHHHHHHHCCCCEEECCCCCCHHHHHHHHHH
T ss_conf             9999999999998552-------875999935777540699999999999999998788974866788710779999983


Q ss_pred             CCCEEEEEEC----CCCCCCCCCEEEHHHHHHHHHHHHHHHHHHCC
Q ss_conf             5989999004----78736878404799999999999999998724
Q gi|254780782|r  344 YCPVIEFGLV----GRTMHALNENASLQDLEDLTCIYENFLQNWFI  385 (389)
Q Consensus       344 ~iP~v~fGp~----~~~~H~pdE~i~i~~l~~~~~~~~~~i~~~~~  385 (389)
                      ++|++.++++    ..++|+|||++++++|.+++++|.++|++||.
T Consensus       387 ~~~~~~~~~g~~~~~~~~H~~NE~v~ie~~~k~i~~~~~~i~~y~~  432 (433)
T PRK06446        387 GINQIVSAIGVGTYSSNAHAPNENIKVDDYYKAIEHTKEFLREYYH  432 (433)
T ss_pred             CCCEEEEEECCCCCCCCCCCCCCCEEHHHHHHHHHHHHHHHHHHCC
T ss_conf             9980799614799667783888878899999999999999998748


No 18 
>TIGR01892 AcOrn-deacetyl acetylornithine deacetylase (ArgE); InterPro: IPR010169   This entry represents a clade of acetylornithine deacetylases (argE) from proteobacteria, which catalyse the final step in arginine biosynthesis. The enzyme is closely related to and may share a common origin with dapE (succinyl-diaminopimelate desuccinylase), cpg2 (carboxypeptidase G2) and ACY1 (aminoacylase I), all of which are members of the metal-dependent aminoacylase family, ArgE/dapE/ACY1/CPG2/yscS .; GO: 0008270 zinc ion binding, 0008777 acetylornithine deacetylase activity, 0050897 cobalt ion binding, 0006526 arginine biosynthetic process, 0005737 cytoplasm.
Probab=100.00  E-value=0  Score=472.70  Aligned_cols=360  Identities=26%  Similarity=0.372  Sum_probs=308.3

Q ss_pred             HHHHHHHCCCCCCCCHH-------HHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEECCC----CCEEEEECCCCC
Q ss_conf             99999964999789968-------9999999999977984899970588876248999998799----988999733681
Q gi|254780782|r    7 EHLIQLIKCPSVTPQDG-------GAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE----APHLMFAGHIDV   75 (389)
Q Consensus         7 ~~l~~lv~ips~s~~e~-------~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g~~----~~~ill~~H~Dt   75 (389)
                      +.|.+||+++|+|..|+       .+.+|+++||+++||.+++.+..+..+-...|++|.+|+.    ...++|.||+||
T Consensus         1 ~il~~LvA~~s~s~~eealdqsN~~li~~~~~yL~~~G~~~~~~p~~~~~Gv~k~Nl~A~iGp~~G~G~~G~~L~GH~D~   80 (386)
T TIGR01892         1 EILAKLVAFDSTSAREEALDQSNVDLIEWVEDYLEELGFSVEVQPVPDGRGVEKSNLLAVIGPSVGSGAGGLVLSGHTDV   80 (386)
T ss_pred             CCHHHHCCCCCCCHHHHHHCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCEEEEEEEECCCCCCCCCCEEEECCEEE
T ss_conf             90351327653000034312778679999999999649836763488887630466677608786677632688767012


Q ss_pred             CCCCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCEECCCCCCCCCCCCC
Q ss_conf             57888777256664224521332365443332012454410000000113578349997520220110442111110001
Q gi|254780782|r   76 VPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEK  155 (389)
Q Consensus        76 vp~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~  155 (389)
                      ||. +...|++|||.++++|||||||||+||||.+|+.|.|+.-|.. .+++.++++++++|||.|. .|++++++.+.+
T Consensus        81 VP~-d~~~Wt~Dpf~Lte~dGrLYGrGt~DmKGFlA~~L~A~pdl~~-~~Lk~Pl~~~~t~DEE~g~-~Ga~~~~~~~~~  157 (386)
T TIGR01892        81 VPV-DDAAWTRDPFRLTEKDGRLYGRGTCDMKGFLALALAAAPDLAA-EKLKKPLHLALTADEEVGC-AGAPKMIEALAR  157 (386)
T ss_pred             ECC-CCCCCCCCCCCCEEECCCEECCCCCCHHHHHHHHHHHHHHHHH-HHCCCCEEEEEECCHHHHH-CCHHHHHHHHHH
T ss_conf             347-8788777723000124731047665247899999986446767-6438846776733523212-024899999898


Q ss_pred             CCCCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCCC-----CCCCCC
Q ss_conf             332120354145665434310012322235799999964123100000012013455443201122334-----456644
Q gi|254780782|r  156 KGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGF-----DTGNTT  230 (389)
Q Consensus       156 ~~~~~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~-----~~~~~~  230 (389)
                      .-.+++++|+||||.+..+-     ++||.+..+|+|+|++||||+|+.|.|||..+..+|.+|..+..     ...++.
T Consensus       158 ~~~rp~~aivGEPT~l~avR-----AhKG~~~~~v~v~G~~GHSS~p~~G~~Ai~~~~~~l~~~~~l~~~l~~e~~~~~~  232 (386)
T TIGR01892       158 LVLRPALAIVGEPTSLVAVR-----AHKGKASAKVTVRGREGHSSDPDRGVSAIELAAKLLARLVALADKLKREEDLEEA  232 (386)
T ss_pred             HCCCCCEEEEECCCCCEEEC-----CCCCEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             51787778871799862320-----1213054566771112556875244118999999999999999863014777778


Q ss_pred             CCC--EEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHH-----HHHHHCCCCEEEEECCCCCCC
Q ss_conf             210--1466765542046665543211665134342067799999999998765-----324203431123222663112
Q gi|254780782|r  231 FSP--TNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-----GIQNVPKLSHTVHFSSPVSPV  303 (389)
Q Consensus       231 ~~~--~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~-----~~~~~~~~~~~i~~~~~~~p~  303 (389)
                      |.|  +|+|||.|+ ||.+.|+||+.|++.||+|..|++++..+...+++...+     .....++..++++..+..+.+
T Consensus       233 F~ppy~tl~~G~v~-GG~A~N~i~~~C~~~~d~R~~~G~~p~~l~~~l~~~~~~aldaq~~~~~p~~~~~~~~~~~~Pa~  311 (386)
T TIGR01892       233 FTPPYATLNIGVVK-GGKAVNIIPAACEFVFDLRPIPGMDPEELLALLEKIAEEALDAQVKEKEPGFEVKVELLSAIPAL  311 (386)
T ss_pred             CCCCCCEEEEEEEE-CCCEEEEECCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCC
T ss_conf             75988714420674-68425550346789996068867898999899999987666667744137650368874367888


Q ss_pred             CCCCHHHHHHHHHHHHHHHHCC-CCEEEECCCCCHHHHH-HHCCCEEEEEECC-CCCCCCCCEEEHHHHHHHHHHHHHHH
Q ss_conf             5786789999999999998289-9579741454358898-6059899990047-87368784047999999999999999
Q gi|254780782|r  304 FLTHDRKLTSLLSKSIYNTTGN-IPLLSTSGGTSDARFI-KDYCPVIEFGLVG-RTMHALNENASLQDLEDLTCIYENFL  380 (389)
Q Consensus       304 ~~~~~~~l~~~l~~a~~~~~g~-~~~~~~~gg~~d~~~~-~~~iP~v~fGp~~-~~~H~pdE~i~i~~l~~~~~~~~~~i  380 (389)
                      ...+|++++..+.+    ..|. .+....+.|+ -+.++ ..|+++++||||+ +.+|+|||||.++++.++-+++.+++
T Consensus       312 ~~~~d~~~~~~~~~----l~G~n~~~~~V~Ygt-EAp~~q~lG~~avv~GPG~I~~AHqp~EYv~~~~l~~~~a~~~~~v  386 (386)
T TIGR01892       312 ELEPDAELVAFLEK----LAGANEAAEVVSYGT-EAPQFQELGIEAVVCGPGDIDQAHQPDEYVEIEELKRCRALLERLV  386 (386)
T ss_pred             CCCCCHHHHHHHHH----HCCCCCCCCCCCCCC-CCHHHHHCCCCEEEECCCCCCCCCCCCCCEEHHHHHHHHHHHHHHC
T ss_conf             99887389999999----708898886356403-4125775688789988888765778898212532002489999719


No 19 
>PRK08652 acetylornithine deacetylase; Provisional
Probab=100.00  E-value=0  Score=462.85  Aligned_cols=344  Identities=19%  Similarity=0.252  Sum_probs=280.9

Q ss_pred             CHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEECCCCCEEEEECCCCCCCCCCH
Q ss_conf             87899999999649997899689999999999977984899970588876248999998799988999733681578887
Q gi|254780782|r    2 TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDVVPPGDF   81 (389)
Q Consensus         2 ~~e~v~~l~~lv~ips~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g~~~~~ill~~H~Dtvp~~~~   81 (389)
                      +.+++++|++||+|||+|++|.++++||+++|+++||+++...   . + .   .....++++|+|+|+|||||||+   
T Consensus         1 ~er~~ell~~Lv~i~S~sg~E~~~a~~l~~~l~~~G~~~~i~~---~-g-~---~~~~~~~~~~~l~l~gH~DtVp~---   69 (349)
T PRK08652          1 TERAKELLKQLLKIPSPTGSEDRIALYIMEFLHSLGYDVHIES---D-G-E---IIDLVVNSSAELIVEVHMDTIPP---   69 (349)
T ss_pred             CHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEC---C-C-C---EEEEECCCCCEEEEECCCCCCCC---
T ss_conf             9789999999819999194889999999999997799489973---8-8-3---89974589976999757776889---


Q ss_pred             HHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCEECCCCCCCCCCCCCCCCCCC
Q ss_conf             77256664224521332365443332012454410000000113578349997520220110442111110001332120
Q gi|254780782|r   82 NHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWD  161 (389)
Q Consensus        82 ~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~~~~~~d  161 (389)
                         ..+||   ++||+|||||++||||++|++|+|++++.+... ..++.++|++|||.++. |++++.+    ....+|
T Consensus        70 ---~~~p~---~~~g~iyGRGa~DmKg~lAa~l~A~~~l~~~~~-~~~i~l~f~~dEE~g~~-G~~~~~~----~~~~~d  137 (349)
T PRK08652         70 ---RAEPF---VRGNIVYGTGASDIKGGVAAILLMLEQLKKEEK-DLNVGIAFVSDEEKGGK-GSALFAE----RYSTPK  137 (349)
T ss_pred             ---CCCCE---EECCEEEECCCCCCCCCHHHHHHHHHHHHHCCC-CCCEEEEEEECCCCCCH-HHHHHHH----HCCCCC
T ss_conf             ---99988---889999817842143209999999999986089-98689999953455866-8999997----288888


Q ss_pred             EEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEEEE
Q ss_conf             35414566543431001232223579999996412310000001201345544320112233445664421014667655
Q gi|254780782|r  162 ACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI  241 (389)
Q Consensus       162 ~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~~~~~~~~~~~~~~i~~i  241 (389)
                      ++|++||++..     +++++||.++++++++|+++|+++|+.|+|||..+++++.+|++.........+..++++++.|
T Consensus       138 ~~iv~EPt~~~-----i~~~~~G~~~~~i~v~G~~aH~s~p~~g~nAi~~~~~~i~~l~~~~~~~~~~~~~~~~~~v~~i  212 (349)
T PRK08652        138 MAVVLEPTDLK-----VAIAHAGNLEAYFEVKGVESHGSCPESGVNAIEQTFEMIQKLKKLEPLKKKGKYFDPHIGIQEL  212 (349)
T ss_pred             EEEEECCCCCE-----EEEEEEEEEEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEE
T ss_conf             89994176776-----7883467899999999617744686456799999999999986078332348877997362689


Q ss_pred             EECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             42046665543211665134342067799999999998765324203431123222663112578678999999999999
Q gi|254780782|r  242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYN  321 (389)
Q Consensus       242 ~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~l~~a~~~  321 (389)
                      + |+...|+||++|++.+|+|+.|+++.+++.++++..+.+.       ..+.++...++++..+.++++++.+.++++.
T Consensus       213 ~-gg~~~n~vP~~~~~~~d~R~~p~~~~~~v~~~i~~~~~~~-------~~~~~~~~~~~~~~~~~~~~~v~~~~~a~~~  284 (349)
T PRK08652        213 I-CENPYYLIPALCKGRLDARILPEQEVEDVLKEIDPILDEY-------TVKYEYTEIWDGYELDEDEEIVQLLKKAMKA  284 (349)
T ss_pred             E-CCCCCCEECCEEEEEEEEEECCCCCHHHHHHHHHHHHHHC-------CCCEEEEEEECCCCCCCCCHHHHHHHHHHHH
T ss_conf             8-2884858898899999989799999999999999999860-------4762799730576789986899999999998


Q ss_pred             HHCCCCEEEECCCCCHHH-HHHHCCCEEEEEECCC-CCCCCCCEEEHHHHHHHHHHHHHHHHHH
Q ss_conf             828995797414543588-9860598999900478-7368784047999999999999999987
Q gi|254780782|r  322 TTGNIPLLSTSGGTSDAR-FIKDYCPVIEFGLVGR-TMHALNENASLQDLEDLTCIYENFLQNW  383 (389)
Q Consensus       322 ~~g~~~~~~~~gg~~d~~-~~~~~iP~v~fGp~~~-~~H~pdE~i~i~~l~~~~~~~~~~i~~~  383 (389)
                      +... +.. ..++++|++ |...++|++.||||+. .+|++|||++++++.+++++|.+++++|
T Consensus       285 ~g~~-~~~-~~~~~TD~~~~~~~Gip~v~~GPG~~~~aH~~dE~v~i~el~~~~~v~~~l~e~f  346 (349)
T PRK08652        285 VGLE-EFG-VMRSWTDAINFWYNGTKTVVWGPGNLDLSHTKFERIDVRDVEKASEFLLKLNEIF  346 (349)
T ss_pred             HCCC-CCC-CCCCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCEEEHHHHHHHHHHHHHHHHHH
T ss_conf             6899-878-6035146998987799999989983014887773388999999999999999987


No 20 
>PRK09133 hypothetical protein; Provisional
Probab=100.00  E-value=0  Score=459.23  Aligned_cols=371  Identities=21%  Similarity=0.260  Sum_probs=292.7

Q ss_pred             CHHHHHHHHHHHCCCCCCC--CHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEE-CCC-CCEEEEECCCCCCC
Q ss_conf             8789999999964999789--9689999999999977984899970588876248999998-799-98899973368157
Q gi|254780782|r    2 TPDCLEHLIQLIKCPSVTP--QDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF-GTE-APHLMFAGHIDVVP   77 (389)
Q Consensus         2 ~~e~v~~l~~lv~ips~s~--~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~-g~~-~~~ill~~H~Dtvp   77 (389)
                      ..++++++++||+|+|+++  ++..+++|++++|+++||+.+.+.+. .....++|+++++ |.+ +++|||+||+||||
T Consensus        29 ~~~~~~~~~~li~i~t~~~~g~~~~aa~~l~~~l~~~G~~~~~~~~~-~~~p~r~~~va~~~G~~~~~plLl~gH~DVVP  107 (464)
T PRK09133         29 QQAARDLYKELIEINTTAGTGSTTPAAEAMAARLKAAGFADADIQVT-GPYPDKGNLVARLRGTGAKKPILLLAHMDVVE  107 (464)
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEEE-CCCCCEEEEEEEEECCCCCCEEEEEECCCCCC
T ss_conf             89999999998201787999986899999999999779985147982-58998258999997789998189982877378


Q ss_pred             CCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCCEECCCCCCCCCCCCCC
Q ss_conf             88877725666422452133236544333201245441000000011-35783499975202201104421111100013
Q gi|254780782|r   78 PGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKK  156 (389)
Q Consensus        78 ~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~~  156 (389)
                      +. .+.|++|||+++++||+|||||++||||+++++|+|+++|++.+ ++.++|.|+|++|||++|..|+..+.+...+ 
T Consensus       108 a~-~~~W~~dPF~~~i~dG~iyGRGa~DmKg~~aa~l~A~~~l~~~g~~p~r~i~~~~~~dEE~gg~~g~~~l~~~~~~-  185 (464)
T PRK09133        108 AK-REDWTRDPFKLVEENGYFYGRGTSDDKADAAIWVATLIRLKREGFKPKRDIILALTGDEEGTPMNGTAWLAENHRD-  185 (464)
T ss_pred             CC-CCCCCCCCCCEEEECCEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCEECCCCCHHHHHHHHHHH-
T ss_conf             99-6657579996388789899667552605499999999999985799887789998545100671169999984564-


Q ss_pred             CCCCCEEEECCCCCCC------CCCEEEEEEEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCCCCCC---
Q ss_conf             3212035414566543------4310012322235799999964123100000012013455443201122334456---
Q gi|254780782|r  157 GEKWDACIVGEPTCNH------IIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTG---  227 (389)
Q Consensus       157 ~~~~d~~i~~ep~~~~------~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~~~~---  227 (389)
                      ....|++|+.|+++..      .....+..|+||.++++|+++|+++|||+| .+.|||..+++++.+|....++..   
T Consensus       186 ~~~ad~~l~~d~g~~~~~~~g~p~~~~i~~geKg~~~~~l~v~G~~gHsS~P-~~~nAi~~L~~~l~~l~~~~~~~~~~~  264 (464)
T PRK09133        186 LIDAEFALNADGGGGTLDDKGKPVLLTVQGGEKTYADFRLEVTNPGGHSSRP-TPDNAIYRLAAALSRLAAYRFPVMLND  264 (464)
T ss_pred             CCCCCEEEEECCCCCCCCCCCCCEEEEEEEEEEEEEEEEEEECCCCCCCCCC-CCCCHHHHHHHHHHHHHHCCCCCCCCH
T ss_conf             0597689993687652356887469998888889999999981588655677-765799999999999874478754444


Q ss_pred             ---------------------------------------CCC---CCCEEEEEEEEEECCCCCCCCCCCEEEEECCCCCC
Q ss_conf             ---------------------------------------644---21014667655420466655432116651343420
Q gi|254780782|r  228 ---------------------------------------NTT---FSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFND  265 (389)
Q Consensus       228 ---------------------------------------~~~---~~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~  265 (389)
                                                             ...   ...+|++++.|+ |+.+.|+||++|++.+|+|++|
T Consensus       265 ~~~~~~~~~a~~~~~~~~~~~~~~~~~p~~~~~~~~l~~~p~~~~~~~tT~~~t~i~-GG~~~NvIP~~A~a~vd~Rl~P  343 (464)
T PRK09133        265 ITRAYFKQMAAIEPGPLGAAMKAFAANPADEAAIATLSADPSYNAMLRTTCVATMLE-GGHAENALPQRATANVNCRIFP  343 (464)
T ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHCCCCCHHHHHHHCCCCCCCCCCCCCEEEEEEE-CCCCCCCCCCCEEEEEEEECCC
T ss_conf             568898753010462678899875328420778876405866345446634300687-5775751663049999981389


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCC-CCCCHHHHHHHHHHHHHHHHCC-CCEEEECCCCCHHHHHH-
Q ss_conf             67799999999998765324203431123222663112-5786789999999999998289-95797414543588986-
Q gi|254780782|r  266 LWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV-FLTHDRKLTSLLSKSIYNTTGN-IPLLSTSGGTSDARFIK-  342 (389)
Q Consensus       266 ~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~-~~~~~~~l~~~l~~a~~~~~g~-~~~~~~~gg~~d~~~~~-  342 (389)
                      +++++++.+.|++++.+     +.+++  +......+. ..+.+.++++.+.++.++.++. ...+.+++|++|++|++ 
T Consensus       344 g~~~e~i~~~l~~~~~~-----~~v~v--~~~~~~~~~~~~p~~~~~~~a~~~a~~~~~~~~~~~P~~~~G~TDa~~~~~  416 (464)
T PRK09133        344 GDSIEAVRQTLKEVVAD-----PKITV--TRIGDGSPSPASPLRPDIMAAVTKLTAARWPGVPVVPSMSTGATDSRYFRA  416 (464)
T ss_pred             CCCHHHHHHHHHHHHCC-----CCEEE--EECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEEEEECHHHHHHHH
T ss_conf             99999999999998547-----85399--985577778889998699999999999875899737777741128999997


Q ss_pred             HCCCEEEEEEC-----CCCCCCCCCEEEHHHHHHHHHHHHHHHHHHC
Q ss_conf             05989999004-----7873687840479999999999999999872
Q gi|254780782|r  343 DYCPVIEFGLV-----GRTMHALNENASLQDLEDLTCIYENFLQNWF  384 (389)
Q Consensus       343 ~~iP~v~fGp~-----~~~~H~pdE~i~i~~l~~~~~~~~~~i~~~~  384 (389)
                      .++|+++|+|.     +.++|++|||+++++|.+++++|.++|++|-
T Consensus       417 ~Gip~yg~~~~~~~~~~~~~H~~nE~i~i~~~~~gi~~y~~li~~La  463 (464)
T PRK09133        417 AGIPTYGVSGLFGDPDDTFAHGLNERISVASFYEGRAFLYELVKDLA  463 (464)
T ss_pred             CCCCEEEECCCCCCCCCCCCCCCCCCEEHHHHHHHHHHHHHHHHHHH
T ss_conf             79988985652358865788899871799999999999999999971


No 21 
>PRK08201 hypothetical protein; Provisional
Probab=100.00  E-value=0  Score=458.61  Aligned_cols=373  Identities=22%  Similarity=0.308  Sum_probs=300.0

Q ss_pred             CHHHHHHHHHHHCCCCCCCC------HHHHHHHHHHHHHHCCCE-EEEEEECCCCCCEEEEEEEEE--CCCCCEEEEECC
Q ss_conf             87899999999649997899------689999999999977984-899970588876248999998--799988999733
Q gi|254780782|r    2 TPDCLEHLIQLIKCPSVTPQ------DGGAFFILVNTLKLLGFS-IEEKDFQTKNTSIVKNLYARF--GTEAPHLMFAGH   72 (389)
Q Consensus         2 ~~e~v~~l~~lv~ips~s~~------e~~~~~~l~~~l~~~G~~-~~~~~~~~~~~~~~~~~~~~~--g~~~~~ill~~H   72 (389)
                      +.++|+.|++||+|||+|+.      ..++++|++++|+++||+ ++..+.     ...+++++++  +++.|+|+|++|
T Consensus        12 ~d~~~~~L~~lv~ipSvs~~~~~~~~~~~~a~~l~~~l~~~G~~~~~i~~~-----~g~p~v~a~~~~~~~~~tvl~~gH   86 (455)
T PRK08201         12 REEHLRELKDFLRIPSVSALSEHKEDVRRAAEWLAAALRKAGLERVEIIET-----KGHPVVYAEWLDAPGKPTILIYGH   86 (455)
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEC-----CCCCEEEEEECCCCCCCEEEEEEC
T ss_conf             999999999995689989897564899999999999999779976999825-----997589999647899998999807


Q ss_pred             CCCCCCCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCCEECCCCCCCCC
Q ss_conf             6815788877725666422452133236544333201245441000000011-357834999752022011044211111
Q gi|254780782|r   73 IDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEGPAINGTKKMLS  151 (389)
Q Consensus        73 ~Dtvp~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~~~~~G~~~l~~  151 (389)
                      +||||+++.++|++|||+++++||+|||||++||||+++++|+|++++++.. .+..+|.|++++|||+|+. +..++++
T Consensus        87 ~DVVP~~~~~~W~~dPF~~~i~dG~lyGRGa~D~KG~~~a~l~A~~al~~~~~~lp~~i~~~~~~dEE~Gs~-~~~~~~~  165 (455)
T PRK08201         87 YDVQPVDPINLWETPPFEPTIRDGKLYARGASDDKGQVFMHLKAIEALLATEGTLPVNVKLLIEGEEEIGSP-NLDRFVA  165 (455)
T ss_pred             CCCCCCCCCCCCCCCCEEEEEECCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCHHCCHH-HHHHHHH
T ss_conf             771589886456589832585588899852457851899999999999874589983189998443011757-7999999


Q ss_pred             CCCCCCCCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECC--CCHHH-HCCCCHHHHHHHHHHCCCCCCC----
Q ss_conf             0001332120354145665434310012322235799999964123--10000-0012013455443201122334----
Q gi|254780782|r  152 WIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQG--HVAYP-HLTENPIRGLIPLLHQLTNIGF----  224 (389)
Q Consensus       152 ~~~~~~~~~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~--Hs~~p-~~g~nAi~~~~~~i~~l~~~~~----  224 (389)
                      ... .....|++++.+++......+.|++|+||.++++++++|..+  ||+.. ....||+..+++++..|+....    
T Consensus       166 ~~~-~~~~~d~~i~~d~~~~~~~~~~i~~g~kG~~~~~l~v~g~~~~~hsg~~g~~~~na~~~l~~~l~~l~~~~g~i~i  244 (455)
T PRK08201        166 AEK-EKLAADVLVISDTALYGRGKPAICYGLRGLAALEIDVKGAKGDLHSGLYGGAVQNAAHALVQLLASMRDEEGGVAV  244 (455)
T ss_pred             HHH-HHHCCCEEEECCCCCCCCCCEEEEEECCCEEEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             757-7735775885267645899728999711439999999956898877667874237999999999861251475613


Q ss_pred             -----------------------C----------------CC----CCCCCCEEEEEEEEEEC---CCCCCCCCCCEEEE
Q ss_conf             -----------------------4----------------56----64421014667655420---46665543211665
Q gi|254780782|r  225 -----------------------D----------------TG----NTTFSPTNMEITTIDVG---NPSKNVIPAQVKMS  258 (389)
Q Consensus       225 -----------------------~----------------~~----~~~~~~~~~~i~~i~~g---~~~~NvIP~~a~~~  258 (389)
                                             +                ..    ...+..++++++.|.+|   .+..|+||++|++.
T Consensus       245 ~g~~~~v~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ptl~v~~i~gg~~g~~~~nviP~~a~~~  324 (455)
T PRK08201        245 EGFYDQVRPLTPEERESFAALGFDEEKLKAELGVDELFGEPGYTALERTWARPTLEINGIFGGFQGEGVKTVIPAEAGAK  324 (455)
T ss_pred             CCCCCCCCCCCHHHHHHHHHCCCCHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCEEEECEECCCCCCCCCCCCCCCEEEE
T ss_conf             33233456789999999874588878887641974123777621787741255156501104776767666578400898


Q ss_pred             ECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHH
Q ss_conf             13434206779999999999876532420343112322266311257867899999999999982899579741454358
Q gi|254780782|r  259 FNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDA  338 (389)
Q Consensus       259 ~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~  338 (389)
                      +|+|++|+++.+++.+.+++++.+.  ...+++++++.....+|+.++.++|+++.+.+++++++|.++....+||+.+.
T Consensus       325 id~Rl~P~~~~~~v~~~l~~~l~~~--~~~g~~v~~~~~~~~~p~~~~~d~p~v~~l~~a~~~~~g~~~~~~~~GGs~p~  402 (455)
T PRK08201        325 ITCRLVPDQDPERILDLIEAHIEAH--TPAGVRVTIRRFDTGPAFITPIDHPAIQAAARAYEDVYGAEAAFTRMGGSIPV  402 (455)
T ss_pred             EECCCCCCCCHHHHHHHHHHHHHHH--CCCCCEEEEEECCCCCCEECCCCCHHHHHHHHHHHHHHCCCCCEECCCCCHHH
T ss_conf             7414279999999999999999961--89997799998788872446999899999999999986899875687758778


Q ss_pred             --HHHH-HCCCEEEEEECC--CCCCCCCCEEEHHHHHHHHHHHHHHHHHH
Q ss_conf             --8986-059899990047--87368784047999999999999999987
Q gi|254780782|r  339 --RFIK-DYCPVIEFGLVG--RTMHALNENASLQDLEDLTCIYENFLQNW  383 (389)
Q Consensus       339 --~~~~-~~iP~v~fGp~~--~~~H~pdE~i~i~~l~~~~~~~~~~i~~~  383 (389)
                        .|.+ .++|++.+|++.  +++|+||||+.+++|.+++++|++++.+|
T Consensus       403 ~~~~~~~~~~p~v~~g~g~~~~~~H~pnE~i~i~~l~~~~~~~a~~l~eL  452 (455)
T PRK08201        403 VETFDAVLGIPIVLMGFGLPSENFHAPNEHFHLENFDKGMRTLSRFWHEL  452 (455)
T ss_pred             HHHHHHHHCCCEEEECCCCCCCCCCCCCCCEEHHHHHHHHHHHHHHHHHH
T ss_conf             99999986889999899996457858998827999999999999999998


No 22 
>COG0624 ArgE Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylases [Amino acid transport and metabolism]
Probab=100.00  E-value=0  Score=453.25  Aligned_cols=376  Identities=33%  Similarity=0.472  Sum_probs=311.6

Q ss_pred             CHHHHHHHHHHHCCCCCC-CCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEECCCC--CEEEEECCCCCCCC
Q ss_conf             878999999996499978-996899999999999779848999705888762489999987999--88999733681578
Q gi|254780782|r    2 TPDCLEHLIQLIKCPSVT-PQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA--PHLMFAGHIDVVPP   78 (389)
Q Consensus         2 ~~e~v~~l~~lv~ips~s-~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g~~~--~~ill~~H~Dtvp~   78 (389)
                      +.++++.|++||+|||+| ..+.++++|++++|+++|+.++........  ...|++++++.+.  |+|+|++|+||||+
T Consensus        12 ~~~~~~~l~~lv~~~s~s~~~~~~~~~~l~~~l~~~g~~~~~~~~~~~~--~~~n~~~~~~~~~~~~~l~l~~H~DvVP~   89 (409)
T COG0624          12 LDDILELLKELVRIPSVSAGEEAEAAELLAEWLEELGFEVEEDEVGPGP--GRPNLVARLGGGDGGPTLLLGGHLDVVPA   89 (409)
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCC--CCCEEEEEECCCCCCCEEEEEEECCCCCC
T ss_conf             7889999988747578787652689999999999769974897326787--75308999248888976999842361179


Q ss_pred             CCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCC-CCCCCCEEEEEEEECCCEECCCCCCCCCCCC-CC
Q ss_conf             887772566642245213323654433320124544100000001-1357834999752022011044211111000-13
Q gi|254780782|r   79 GDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK-YKNFGSISLLITGDEEGPAINGTKKMLSWIE-KK  156 (389)
Q Consensus        79 ~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~-~~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~-~~  156 (389)
                      ++.+.|++|||+++++||+|||||++||||+++++++|++.+.+. ..+.++|.++|++|||+++. |++.++.... ..
T Consensus        90 g~~~~W~~~Pf~~~~~dg~lyGRG~~D~KG~~~a~l~A~~~l~~~~~~~~~~v~~~~~~dEE~g~~-~~~~~~~~~~~~~  168 (409)
T COG0624          90 GGGEDWTTDPFEPTIKDGKLYGRGAADMKGGLAAALYALSALKAAGGELPGDVRLLFTADEESGGA-GGKAYLEEGEEAL  168 (409)
T ss_pred             CCCCCCCCCCCEEEEECCEEEEEEEECCCCHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCH-HHHHHHHHCCCCC
T ss_conf             996667469943899899999985154740799999999999973789883089999778645844-6899997244102


Q ss_pred             CCCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCCHH--HHCCCC----HHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             321203541456654343100123222357999999641231000--000120----13455443201122334456644
Q gi|254780782|r  157 GEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAY--PHLTEN----PIRGLIPLLHQLTNIGFDTGNTT  230 (389)
Q Consensus       157 ~~~~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~--p~~g~n----Ai~~~~~~i~~l~~~~~~~~~~~  230 (389)
                      +..+|++|++||+.....+..+++++||..+++|+++|+++|+|+  |+.+.|    |+..+++++..+.+..    ...
T Consensus       169 ~~~~d~~iv~E~~~~~~~~~~~~~~~kG~~~~~v~v~G~~~Has~~~p~~~~n~~~~a~~~~~~~~~~~~~~~----~~~  244 (409)
T COG0624         169 GIRPDYEIVGEPTLESEGGDIIVVGHKGSLWLEVTVKGKAGHASTTPPDLGRNPIHAAIEALAELIEELGDLA----GEG  244 (409)
T ss_pred             CCCCCEEEECCCCCCCCCCCEEEEEEEEEEEEEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH----HHC
T ss_conf             5686689984776645688657998742489999999636777888843445569999999999999988764----310


Q ss_pred             CC-CEEEEEEEEEECCCC-------CCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             21-014667655420466-------6554321166513434206779999999999876532420343112322266311
Q gi|254780782|r  231 FS-PTNMEITTIDVGNPS-------KNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP  302 (389)
Q Consensus       231 ~~-~~~~~i~~i~~g~~~-------~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p  302 (389)
                      +. +.+++++.+..+.+.       .|+||++|++.+|+|+.|.++.+++.+++++.+..... ..++++++......++
T Consensus       245 ~~~~~~~~~~~~~~~~~~~~~~g~~~nvIP~~~~~~~d~R~~p~~~~~~~~~~v~~~i~~~~~-~~~~~~~~~~~~~~~~  323 (409)
T COG0624         245 FDGPLGLNVGLILAGPGASVNGGDKVNVIPGEAEATVDIRLLPGEDLDDVLEELEAELRAIAP-KEGVEYEIEPGLGEPP  323 (409)
T ss_pred             CCCCCCCCCCEEECCCCCCCCCCCCCEEECCEEEEEEEEECCCCCCHHHHHHHHHHHHHHHCC-CCCCEEEECCCCCCCC
T ss_conf             687761022303057764445666670878878999888559753357899999999986321-2371599812555677


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHC-CCEEEEEECC-CCCCCCCCEEEHHHHHHHHHHHHHHH
Q ss_conf             257867899999999999982899579741454358898605-9899990047-87368784047999999999999999
Q gi|254780782|r  303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVG-RTMHALNENASLQDLEDLTCIYENFL  380 (389)
Q Consensus       303 ~~~~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~~~-iP~v~fGp~~-~~~H~pdE~i~i~~l~~~~~~~~~~i  380 (389)
                      ...+.++++++.+.+++++.+|..+.....|+++|++|++.. +|++.|||++ +.+|+||||++++++.+++++|++++
T Consensus       324 ~~~~~~~~~v~~l~~~~~~~~g~~~~~~~~G~~~da~~~~~~~~~~~~fgp~~~~~~H~~~E~v~i~~l~~~~~~~~~~i  403 (409)
T COG0624         324 LPVPGDSPLVAALAEAAEELLGLPPEVSTGGGTHDARFFARLGIPAVIFGPGDIGLAHQPNEYVELEDLVKGAKVLARLL  403 (409)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHCCCCEECCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             77898679999999999997399834425574778999985398579983798887868052812999999999999999


Q ss_pred             HHHCC
Q ss_conf             98724
Q gi|254780782|r  381 QNWFI  385 (389)
Q Consensus       381 ~~~~~  385 (389)
                      .+|+.
T Consensus       404 ~~l~~  408 (409)
T COG0624         404 YELAE  408 (409)
T ss_pred             HHHHH
T ss_conf             99844


No 23 
>PRK13007 dipeptidase; Reviewed
Probab=100.00  E-value=0  Score=452.26  Aligned_cols=341  Identities=23%  Similarity=0.290  Sum_probs=272.7

Q ss_pred             CCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHC-CCEEEEEEECCCCCCEEEEEEEEEC-CCCCEEEEECCCCCCCC
Q ss_conf             987899999999649997899689999999999977-9848999705888762489999987-99988999733681578
Q gi|254780782|r    1 MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLL-GFSIEEKDFQTKNTSIVKNLYARFG-TEAPHLMFAGHIDVVPP   78 (389)
Q Consensus         1 l~~e~v~~l~~lv~ips~s~~e~~~~~~l~~~l~~~-G~~~~~~~~~~~~~~~~~~~~~~~g-~~~~~ill~~H~Dtvp~   78 (389)
                      |..|+|++|++||+|||+|++|.++++||+++|+++ ++++.+.         ..|++++.+ +.+++|+|++||||||+
T Consensus         6 l~~d~i~Ll~~LV~i~S~sg~E~~~a~~l~~~l~~~~~~~v~~~---------~~nv~a~~~~g~~~~lll~gH~DtVp~   76 (354)
T PRK13007          6 LAADLAELTAALVDIPSVSGHEKALADAVEAALRALPGLEVIRH---------GNSVVARTDLGRPSRVLLAGHLDTVPV   76 (354)
T ss_pred             HHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEE---------CCEEEEECCCCCCCEEEEECCCCCCCC
T ss_conf             67789999999729999297889999999999986799658988---------998999807999986999766688889


Q ss_pred             CCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCEEC-CCCCCCCCCCCCCC
Q ss_conf             88777256664224521332365443332012454410000000113578349997520220110-44211111000133
Q gi|254780782|r   79 GDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAI-NGTKKMLSWIEKKG  157 (389)
Q Consensus        79 ~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~~~~~i~~~~~~dEE~~~~-~G~~~l~~~~~~~~  157 (389)
                      +       |||.++++||+|||||++||||++|++|.|++.+.+   +..++.++|+.|||.++. .|..++.+... ..
T Consensus        77 ~-------d~~~~~i~dg~iyGRGa~DmKgglAa~l~a~~~l~~---~~~~~~~~~~~~EE~~~~~~G~~~l~~~~~-~~  145 (354)
T PRK13007         77 A-------DNLPSRREGGRLYGCGASDMKSGLAVMLHLAATLPE---PAHDLTLVFYDCEEVEAEANGLGRVAREHP-DW  145 (354)
T ss_pred             C-------CCCCCEEECCEEEECCHHHCCHHHHHHHHHHHHHHH---CCCCEEEEEEECEECCCCCCHHHHHHHHCH-HH
T ss_conf             9-------996709989999936744310169999999997440---699889999928156857467999998480-31


Q ss_pred             CCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCCCCCC--CCCCCCEE
Q ss_conf             2120354145665434310012322235799999964123100000012013455443201122334456--64421014
Q gi|254780782|r  158 EKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTG--NTTFSPTN  235 (389)
Q Consensus       158 ~~~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~~~~--~~~~~~~~  235 (389)
                      .++|++|++||++.     .++.|+||.++++|+++|+++|||+|+.|.|||+.++.++.+|.++.....  .....+++
T Consensus       146 ~~~d~~IvgEPt~~-----~i~~g~kG~~~~~i~v~G~~aHss~p~~G~NAI~~~~~~i~~l~~~~~~~~~~~~~~~~~t  220 (354)
T PRK13007        146 LAADFAILLEPTDG-----VIEAGCQGTLRVTVTFHGRRAHSARSWLGENAIHKAAPVLARLAAYEPREVVVDGLTYREG  220 (354)
T ss_pred             CCCCEEEECCCCCC-----EEEEEEEEEEEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             38878997578677-----7999633899999999557664578766879999999999999850756554578776674


Q ss_pred             EEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHH
Q ss_conf             66765542046665543211665134342067799999999998765324203431123222663112578678999999
Q gi|254780782|r  236 MEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLL  315 (389)
Q Consensus       236 ~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~l  315 (389)
                      +|++.|+ |+.+.|+||++|++.+|+|+.|+++.+++.+.+++.+.+       ...++++....++.....++|+++.+
T Consensus       221 ~nv~~i~-GG~~~NvVP~~~~~~~d~R~~p~~~~~~v~~~l~~~~~~-------~~~~~~~~~~~~~~~~~~~~p~~~~~  292 (354)
T PRK13007        221 LNAVRIE-GGVAGNVIPDECEVNVNYRFAPDRSLEEALAHVRELFDG-------LDVEVEVTDLAPGAPPGLDHPAAAAL  292 (354)
T ss_pred             EEEEEEE-CCCCCCCCCCEEEEEEEEEECCCCCHHHHHHHHHHHHHC-------CCCEEEEEECCCCCCCCCCCHHHHHH
T ss_conf             5478985-688887508879999999869999999999999998713-------78569999615787889988999999


Q ss_pred             HHHHHHHHCCCCEEEECCCCCHHHH-HHHCCCEEEEEECCCC-CCCCCCEEEHHHHHHHHHHHHHHH
Q ss_conf             9999998289957974145435889-8605989999004787-368784047999999999999999
Q gi|254780782|r  316 SKSIYNTTGNIPLLSTSGGTSDARF-IKDYCPVIEFGLVGRT-MHALNENASLQDLEDLTCIYENFL  380 (389)
Q Consensus       316 ~~a~~~~~g~~~~~~~~gg~~d~~~-~~~~iP~v~fGp~~~~-~H~pdE~i~i~~l~~~~~~~~~~i  380 (389)
                      .++    .+..+..  ..|++|+++ ...++|++.||||+.. +|++|||++++++.+++++|.++|
T Consensus       293 ~~~----~g~~~~~--~~g~tD~~~~~~~Gip~v~~GPG~~~~aH~~dE~v~i~~l~~~~~i~~~~L  353 (354)
T PRK13007        293 VAA----TGGAVRA--KYGWTDVARFAALGIPAVNFGPGDPNLAHQRDERVPVAQITACYRILRRWL  353 (354)
T ss_pred             HHH----HCCCCCC--CCCCCCHHHHHHCCCCEEEECCCCCCCCCCCCCEEEHHHHHHHHHHHHHHH
T ss_conf             998----6899756--555488999986799999989998767987762388999999999999985


No 24 
>PRK07907 hypothetical protein; Provisional
Probab=100.00  E-value=0  Score=448.22  Aligned_cols=372  Identities=19%  Similarity=0.255  Sum_probs=299.4

Q ss_pred             CHHHHHHHHHHHCCCCCCCCH------HHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEEC--CCCCEEEEECCC
Q ss_conf             878999999996499978996------899999999999779848999705888762489999987--999889997336
Q gi|254780782|r    2 TPDCLEHLIQLIKCPSVTPQD------GGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG--TEAPHLMFAGHI   73 (389)
Q Consensus         2 ~~e~v~~l~~lv~ips~s~~e------~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g--~~~~~ill~~H~   73 (389)
                      .|.+++.|++||+|||+|.+.      .++++|++++|+++||+...+...    +..++++|++.  ++.|||+||+|+
T Consensus         5 ~~~~~~~L~~lv~~pSvs~~~~~~~~~~~~a~~l~~~l~~~G~~~~~~~~~----~g~P~v~a~~~~~~~~ptll~ygH~   80 (437)
T PRK07907          5 LPRVRADLEELVRIESVAADPFRREEVARSAEAVADLLREAGFDDVEVVDE----DGAPAVIATRPAPPGAPTVLLYAHH   80 (437)
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCC----CCCCEEEEEECCCCCCCEEEEECCC
T ss_conf             389999999996589868997673899999999999999679977995169----9985799995479999989996673


Q ss_pred             CCCCCCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCEECCCCCCCCCCC
Q ss_conf             81578887772566642245213323654433320124544100000001135783499975202201104421111100
Q gi|254780782|r   74 DVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWI  153 (389)
Q Consensus        74 Dtvp~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~~~~~i~~~~~~dEE~~~~~G~~~l~~~~  153 (389)
                      ||||+++.++|++|||+++++||+|||||++||||+++++|+|++++  ...+..+|.+++++|||+|+. |...+++..
T Consensus        81 DVvPag~~~~W~~dPF~~~~~dG~lyGRGa~D~KG~~~a~l~Al~al--~~~~p~~i~~~~egeEE~Gs~-~l~~~l~~~  157 (437)
T PRK07907         81 DVQPEGDPDQWVTPPFEPTERDGRLYGRGAADDKGGIAMHLAALRAL--GGDLPVGVTVFVEGEEEMGSP-SLERLLAAH  157 (437)
T ss_pred             CCCCCCCHHHCCCCCCEEEEECCEEEEECCCCCCCHHHHHHHHHHHH--CCCCCCCEEEEEECCHHHCCH-HHHHHHHHH
T ss_conf             76689971335489924899789898404567750899999999983--889996479999643220876-699999973


Q ss_pred             CCCCCCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEE--ECCCCHH-HHCCCCHHHHHHHHHHCCCCCC-------
Q ss_conf             01332120354145665434310012322235799999964--1231000-0001201345544320112233-------
Q gi|254780782|r  154 EKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHG--KQGHVAY-PHLTENPIRGLIPLLHQLTNIG-------  223 (389)
Q Consensus       154 ~~~~~~~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G--~~~Hs~~-p~~g~nAi~~~~~~i~~l~~~~-------  223 (389)
                      . .....|+++++|++......+.++++.||..+++++|+|  +..||+. .....||+..++.++..|++..       
T Consensus       158 ~-~~l~aD~~vi~d~~~~~~~~p~i~~g~rG~~~~~l~v~~~~~~~HSg~~gg~~~~~~~~l~~ll~~L~d~~g~v~i~g  236 (437)
T PRK07907        158 R-ELLAADVIVIADSGNWSVGVPALTTSLRGNADVTVEVRTLEHALHSGQFGGAVPDALTALVRLLASLHDEDGNVAVDG  236 (437)
T ss_pred             H-HHCCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             6-641778899768886368974455740005899999834798887533476535899999999987356689772565


Q ss_pred             -----------CCC---------------------CCCCCCCEEEEEEEEEEC--CCCCCCCCCCEEEEECCCCCCHHHH
Q ss_conf             -----------445---------------------664421014667655420--4666554321166513434206779
Q gi|254780782|r  224 -----------FDT---------------------GNTTFSPTNMEITTIDVG--NPSKNVIPAQVKMSFNIRFNDLWNE  269 (389)
Q Consensus       224 -----------~~~---------------------~~~~~~~~~~~i~~i~~g--~~~~NvIP~~a~~~~diR~~~~~~~  269 (389)
                                 ++.                     ....+..++++++.+.++  +.+.|+||.+|++++|+|++|++++
T Consensus       237 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~Ptl~v~gi~~~~~g~~~nvip~~a~a~~d~RlvP~~~~  316 (437)
T PRK07907        237 LHATTPAEGLDYPEERFRADAGVLDGVSLIGTGSVADRLWAKPAITVIGIDATPVAGASNTLPPRARAKLSLRVAPGQDA  316 (437)
T ss_pred             CCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCCHHHHCCCCCCEEEEEEECCCCCCCCCEECCEEEEEEEEECCCCCCH
T ss_conf             45444333469998999864176556553577764664336782589753157777777673633699999803899999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCH-HH-HHHH--CC
Q ss_conf             99999999987653242034311232226631125786789999999999998289957974145435-88-9860--59
Q gi|254780782|r  270 KTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSD-AR-FIKD--YC  345 (389)
Q Consensus       270 ~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d-~~-~~~~--~i  345 (389)
                      +++.+.+++++.+...  .+.+++++......|+.++.++|+++++.+++++++|.+|....+||+.+ .. |...  ++
T Consensus       317 ~~v~~~l~~~L~~~~p--~~~~v~v~~~~~~~p~~~~~d~p~~~al~~a~~~~~G~~p~~~~~GGsip~~~~~~~~~~~~  394 (437)
T PRK07907        317 AEALDALEAHLEAHAP--WGARVTVERGDIGQPFAADATGPAYDAARAAMREAWGKEPVDMGSGGSIPFIAELAEAFPQA  394 (437)
T ss_pred             HHHHHHHHHHHHHCCC--CCCEEEEEECCCCCEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHCCCC
T ss_conf             9999999999996199--99769999777651274599999999999999998788973228885488899999875999


Q ss_pred             CEEEEEECC--CCCCCCCCEEEHHHHHHHHHHHHHHHHHH
Q ss_conf             899990047--87368784047999999999999999987
Q gi|254780782|r  346 PVIEFGLVG--RTMHALNENASLQDLEDLTCIYENFLQNW  383 (389)
Q Consensus       346 P~v~fGp~~--~~~H~pdE~i~i~~l~~~~~~~~~~i~~~  383 (389)
                      |++++|+++  .++|+|||++++++|.+++++|+.+|.+|
T Consensus       395 ~v~~~G~~~~~~~~H~pNE~i~l~~~~~~~~~~a~~l~~l  434 (437)
T PRK07907        395 EILVTGVEDPKTQAHSPNESLHLGELERAATAEALLLLNL  434 (437)
T ss_pred             CEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             8999899996657859988735999999999999999998


No 25 
>PRK06133 glutamate carboxypeptidase; Reviewed
Probab=100.00  E-value=0  Score=448.60  Aligned_cols=360  Identities=25%  Similarity=0.385  Sum_probs=296.9

Q ss_pred             CHHHHHHHHHHHCCCCCCCCHHH---HHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEE-CCCCCEEEEECCCCCCC
Q ss_conf             87899999999649997899689---999999999977984899970588876248999998-79998899973368157
Q gi|254780782|r    2 TPDCLEHLIQLIKCPSVTPQDGG---AFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF-GTEAPHLMFAGHIDVVP   77 (389)
Q Consensus         2 ~~e~v~~l~~lv~ips~s~~e~~---~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~-g~~~~~ill~~H~Dtvp   77 (389)
                      +|+++++|++||+|+|.|.+..+   ++++++++|+++||++++++..+...   .++++++ |++++.|||.||||||+
T Consensus        44 ~~~~l~~l~~lVni~Sgt~~~~gv~~v~~~~~~~l~~~G~~v~~~~~~~~~g---~~l~a~~~g~g~~~ilL~gH~DTVf  120 (418)
T PRK06133         44 QPAYLDTLRELVSIESGSGDAEGLKQVAALLAERLKALGATVELVPATPSAG---DMVVATFKGTGKRKIMLIAHMDTVY  120 (418)
T ss_pred             HHHHHHHHHHHEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCC---CEEEEEECCCCCCCEEEEEECCCCC
T ss_conf             4999999998735078999768999999999999997799589964788868---8799997899988789994368879


Q ss_pred             CCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCCEECCCCCCCCCCCCCC
Q ss_conf             88877725666422452133236544333201245441000000011-35783499975202201104421111100013
Q gi|254780782|r   78 PGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKK  156 (389)
Q Consensus        78 ~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~~  156 (389)
                      +.  ..|..+||  .++||++||||++|||||++++|+|+++|.+.+ ++.++|.|+|++|||.++. |++.+++.   .
T Consensus       121 p~--g~~~~~Pf--~~eggr~YGrGv~DMKgGla~~L~Al~aL~~~g~~~~~~i~v~~t~DEE~Gs~-gs~~~i~~---~  192 (418)
T PRK06133        121 LP--GSLATQPF--RIDGERAYGPGIADDKGGVAVILHALAILQQQGFKDYGTLTVLFNPDEETGSP-GSRELIAE---L  192 (418)
T ss_pred             CC--CCCCCCCE--EEECCEEECCCHHHCCHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCCCC-CHHHHHHH---H
T ss_conf             99--96567986--98899998076565107699999999999963998897089999878887860-68999997---5


Q ss_pred             CCCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCC-HHHHCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCEE
Q ss_conf             3212035414566543431001232223579999996412310-000001201345544320112233445664421014
Q gi|254780782|r  157 GEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHV-AYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTN  235 (389)
Q Consensus       157 ~~~~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs-~~p~~g~nAi~~~~~~i~~l~~~~~~~~~~~~~~~~  235 (389)
                      +...|++|+.||+...   ..+++++||..+++++|+|+++|| +.|+.|+|||..++..+.+++++...     ...++
T Consensus       193 ~~~~d~~l~~Ep~~~~---~~v~~~rkG~~~~~l~v~GkaaHsG~~p~~G~nAI~ela~~i~~l~~l~~~-----~~g~T  264 (418)
T PRK06133        193 AAQHDVVFSCEPGRAK---DALTLATSGIATALLEVKGKASHAGAAPELGRNALLELAHQLLQLRDLGDP-----AKGTT  264 (418)
T ss_pred             HHCCCEEEEECCCCCC---CCEEEEEEEEEEEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCC-----CCCCE
T ss_conf             1128989997678898---867987775899999998136656668434605999999999998751478-----99837


Q ss_pred             EEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCC-HHHHHHH
Q ss_conf             667655420466655432116651343420677999999999987653242034311232226631125786-7899999
Q gi|254780782|r  236 MEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTH-DRKLTSL  314 (389)
Q Consensus       236 ~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~-~~~l~~~  314 (389)
                      +|++.|+ |+.+.|+||++|++.+|+|+.+.++.+.+.+.+++.+.+..  .++.++++.+....+|...++ +..+++.
T Consensus       265 ~Nvg~i~-GG~~~NvVP~~a~~~~D~R~~~~~~~e~v~~~l~~~~~~~~--~~~~~v~~~~~~~~pp~~~~~~~~~L~~~  341 (418)
T PRK06133        265 LNWTLAK-AGTKRNVIPASASAEADVRYSDPAEFDRLEADLQEKVKKKL--VPDTEVTLRLEKGRPPLVANAASRALAKT  341 (418)
T ss_pred             EEEEEEE-CCCCCCCCCCEEEEEEEEEECCCCCHHHHHHHHHHHHHHHC--CCCCEEEEEEEECCCCCCCCCCCHHHHHH
T ss_conf             9888885-78777601761699999865884589999999999997534--89977999995068987889872899999


Q ss_pred             HHHHHHHHHCC--CCEEEECCCCCHHHHHH-HCCCEEEE--EECCCCCCCCCCEEEHHHHHHHHHHHHHHHHHHC
Q ss_conf             99999998289--95797414543588986-05989999--0047873687840479999999999999999872
Q gi|254780782|r  315 LSKSIYNTTGN--IPLLSTSGGTSDARFIK-DYCPVIEF--GLVGRTMHALNENASLQDLEDLTCIYENFLQNWF  384 (389)
Q Consensus       315 l~~a~~~~~g~--~~~~~~~gg~~d~~~~~-~~iP~v~f--Gp~~~~~H~pdE~i~i~~l~~~~~~~~~~i~~~~  384 (389)
                      +++.+++ .|.  .+.....+|++|++|++ .++|++++  ||.+.++|++|||++++++...+++++++|.++.
T Consensus       342 ~~~~~~e-lG~~~~~~~~~~gG~sDa~~~a~~GiptVl~G~G~~G~~aHs~dE~v~l~slv~r~~lla~li~~ls  415 (418)
T PRK06133        342 AQTIYGE-LGRRLEPIAMGTGGGTDAAFAAGSGKPAVLEGFGLVGFGLHSNDEYIELNSIVPRLYLLTRMIMELS  415 (418)
T ss_pred             HHHHHHH-HCCCCCEEECCCCEECHHHHHHHCCCCEEEECCCCCCCCCCCCCCEEEHHHHHHHHHHHHHHHHHHH
T ss_conf             9999998-4898740004574426078997559996997987378888999849985469999999999999985


No 26 
>PRK00466 acetyl-lysine deacetylase; Validated
Probab=100.00  E-value=0  Score=444.01  Aligned_cols=334  Identities=24%  Similarity=0.357  Sum_probs=278.2

Q ss_pred             CCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEECCCCCEEEEECCCCCCCCCC
Q ss_conf             98789999999964999789968999999999997798489997058887624899999879998899973368157888
Q gi|254780782|r    1 MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDVVPPGD   80 (389)
Q Consensus         1 l~~e~v~~l~~lv~ips~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g~~~~~ill~~H~Dtvp~~~   80 (389)
                      |+++++++|++||+|||+|++|.++++|++++|+++|++++....    .    |.+  .|.+  .|+|+|||||||.  
T Consensus         8 ~~~~~~~ll~~Lv~I~S~sg~E~~~a~~l~~~l~~~g~~~~i~~~----~----~~~--~g~g--~i~l~gH~DtVP~--   73 (345)
T PRK00466          8 VKQKAKKLLLDLLSIYTPSGSEERAKDFFEKIASELNLNLEVTST----N----SFF--LGDG--DILLASHVDTVPG--   73 (345)
T ss_pred             HHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEECC----C----CEE--CCCC--CEEEECCCCCCCC--
T ss_conf             899999999998088992979999999999999987992799678----8----676--0799--8898258654599--


Q ss_pred             HHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCEECCCCCCCCCCCCCCCCCC
Q ss_conf             77725666422452133236544333201245441000000011357834999752022011044211111000133212
Q gi|254780782|r   81 FNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKW  160 (389)
Q Consensus        81 ~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~~~~~~  160 (389)
                         |    |++.++||+|||||++||||++|+++.|++.+.+.+   .++.++|++|||.++. |+++++.    .+.++
T Consensus        74 ---~----~~~~i~~~~lYGRGa~DmKgglAa~l~A~~~l~~~~---~~i~~~~~~dEE~~~~-G~~~l~~----~~~~~  138 (345)
T PRK00466         74 ---Y----IEPKIEGETIYGRGAVDAKGPLISMILATWILNEKG---YKVQVAALSDEEGKSK-GARELVS----SGKRF  138 (345)
T ss_pred             ---C----CCCEEECCEEECCCCCCCCHHHHHHHHHHHHHHHCC---CCEEEEEEECCCCCCH-HHHHHHH----CCCCC
T ss_conf             ---9----886888999986871015088999999999976269---9389999917546754-5999996----69998


Q ss_pred             CEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEEE
Q ss_conf             03541456654343100123222357999999641231000000120134554432011223344566442101466765
Q gi|254780782|r  161 DACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT  240 (389)
Q Consensus       161 d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~~~~~~~~~~~~~~i~~  240 (389)
                      |++|++|||+..    .+++|+||.++++++++|+++|||.|.  .|+|..++..+.++.+...     .+..++++++.
T Consensus       139 d~~IvgEPT~~~----~i~~g~kG~~~~~v~~~G~~aHss~p~--~n~i~~~~~~i~e~~~~~~-----~~~~~~~~~~~  207 (345)
T PRK00466        139 LYIIVGEPTNTT----GVAVEYRGSLHLDILCRGHPEHSSSAT--ANLIVKISKKILEVYRQPS-----NYDDPSIVPTI  207 (345)
T ss_pred             CEEEECCCCCCC----EEEEEECCEEEEEEEEEEECCCCCCCH--HHHHHHHHHHHHHHHHCCC-----CCCCCCEEEEE
T ss_conf             989984798874----389960766999999996652257852--7499999999998642544-----46898313479


Q ss_pred             EEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             54204666554321166513434206779999999999876532420343112322266311257867899999999999
Q gi|254780782|r  241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIY  320 (389)
Q Consensus       241 i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~l~~a~~  320 (389)
                      |++ +.+.|+||++|++.+|+|++++.+.+++.+++++.+..         +.++.....+|+..+.++++++.+.+++.
T Consensus       208 i~g-G~~~NvvP~~~~~~~d~R~~~~~~~~~i~~~i~~~~~~---------~~~~~~~~~~p~~~~~~~~~v~~~~~a~~  277 (345)
T PRK00466        208 IKS-GESANVTPSRAYVHFDIRYSIPNSEDQILSEIHSKFEG---------CDLKIVEDIPPVKVSVNNPIVKALMRSLL  277 (345)
T ss_pred             EEC-CCCCCCCCCEEEEEEEEEECCCCCHHHHHHHHHHHHHC---------CEEEEEECCCCCCCCCCCHHHHHHHHHHH
T ss_conf             982-56376148689999999869999999999999998525---------74799850275207999989999999999


Q ss_pred             HHHCCCCEEEECCCCCHHHHHH-HCCCEEEEEECCCC-CCCCCCEEEHHHHHHHHHHHHHHHHHHCC
Q ss_conf             9828995797414543588986-05989999004787-36878404799999999999999998724
Q gi|254780782|r  321 NTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRT-MHALNENASLQDLEDLTCIYENFLQNWFI  385 (389)
Q Consensus       321 ~~~g~~~~~~~~gg~~d~~~~~-~~iP~v~fGp~~~~-~H~pdE~i~i~~l~~~~~~~~~~i~~~~~  385 (389)
                      . .|..|.+...+|++|++++. .++|++.||||+.. +|++|||++++++.+++++|+++|++||.
T Consensus       278 ~-~g~~p~~~~~~g~sDa~~~~~~g~~~v~~GPG~~~~AH~~dE~V~i~el~~a~~iy~~~i~~lcl  343 (345)
T PRK00466        278 K-QGVKPRLVRKRGTSDMNILKIITKSIATYGPGNSRLEHTKHEKISLDEIYIATKTYINAIEELCL  343 (345)
T ss_pred             H-HCCCCEEEECCCCCHHHHHHHCCCCEEEECCCCCCCCCCCCCEEEHHHHHHHHHHHHHHHHHHHH
T ss_conf             8-29996798337504599996549987998999732488556408999999999999999999973


No 27 
>PRK04443 acetyl-lysine deacetylase; Provisional
Probab=100.00  E-value=0  Score=441.51  Aligned_cols=344  Identities=23%  Similarity=0.324  Sum_probs=282.3

Q ss_pred             CHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEECCCCCEEEEECCCCCCCCCCH
Q ss_conf             87899999999649997899689999999999977984899970588876248999998799988999733681578887
Q gi|254780782|r    2 TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDVVPPGDF   81 (389)
Q Consensus         2 ~~e~v~~l~~lv~ips~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g~~~~~ill~~H~Dtvp~~~~   81 (389)
                      +.|+|++|++||+|||+|++|.++++|++++|+++||+++..+        .+|+++..|.++++|+|++||||||. + 
T Consensus         5 ~~e~v~ll~~Li~i~S~sg~E~~~a~~l~~~l~~~G~~~~~~~--------~~nv~~~~g~g~~~lll~gH~DtVP~-~-   74 (352)
T PRK04443          5 DEEAVELLKRLVEIPSPSGKEAEAAEFLVEFMESLGFDAFVDE--------VGNAVGVRGEGPDLVLLLGHIDTVPG-D-   74 (352)
T ss_pred             HHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEC--------CCCEEEEECCCCCEEEEEECCCCCCC-C-
T ss_conf             7999999999829999194889999999999986899269934--------78789992799975999717787899-9-


Q ss_pred             HHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCEECCCCCCCCCCCCCCCCCCC
Q ss_conf             77256664224521332365443332012454410000000113578349997520220110442111110001332120
Q gi|254780782|r   82 NHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWD  161 (389)
Q Consensus        82 ~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~~~~~~d  161 (389)
                           .||  .++||+|||||++||||++|+++.|++.+.+.+.+..+|.|+|++|||.++. |+++++.    ....+|
T Consensus        75 -----~p~--~i~dg~lyGRGa~DmKgglaa~l~A~~~l~~~~~~~~~v~~~~~~dEE~g~~-g~~~~~~----~~~~~d  142 (352)
T PRK04443         75 -----IPV--RIEDGVLWGRGSVDAKGPLATFIFAAAELPEEGRLRARVIFVGAVEEEAASS-GGARLVA----PRYRPD  142 (352)
T ss_pred             -----CCE--EEECCEEECCCCHHHHCCHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCCC-CHHHHHH----HCCCCC
T ss_conf             -----880--9989999867700101409999999999986278998789999832335674-6899985----155864


Q ss_pred             EEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEEEE
Q ss_conf             35414566543431001232223579999996412310000001201345544320112233445664421014667655
Q gi|254780782|r  162 ACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI  241 (389)
Q Consensus       162 ~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~~~~~~~~~~~~~~i~~i  241 (389)
                      ++|++|||+..    .+++|+||.++++++++|+++|||.|  +.||+..++.++.++.+.............+++.+.+
T Consensus       143 ~~iv~EPt~~~----~i~~g~kG~~~~~i~~~G~~~H~s~~--g~nAi~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~  216 (352)
T PRK04443        143 YVIIGEPSGWD----GITLGYKGRLLVKYREEQEKFHSAGP--ETNAAEDLIEWWLAVAAWFEANQGRERVFDQLQPSLV  216 (352)
T ss_pred             EEEECCCCCCC----CEEEEEEEEEEEEEEEEEEEEECCCC--CCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEE
T ss_conf             45314898876----27872157999999999667776885--5089999999999999887751578888885578999


Q ss_pred             EECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             42046665543211665134342067799999999998765324203431123222663112578678999999999999
Q gi|254780782|r  242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYN  321 (389)
Q Consensus       242 ~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~l~~a~~~  321 (389)
                      ..+ ...|.+|++|++.+|+|++|+++.+.+.+.+++..          ...+++....+|+..+.++|+++.+.+++++
T Consensus       217 ~~~-~~~~~~~~~~~~~~d~R~~p~~~~~~~~~~~~~~~----------~~~~~~~~~~p~~~~~~~~p~v~~~~~a~~~  285 (352)
T PRK04443        217 DFD-SYEDGLTFEAEMTINLRLPPGYPPEAAWEILGALA----------PGTLTFSDFVPAYQVPRRTPLARAFRRAIRE  285 (352)
T ss_pred             EEE-CCCCCEEEEEEEEEEEECCCCCCHHHHHHHHHHHC----------CCEEEEECCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             986-26884767999999984499999999999998744----------8569992465741079999899999999998


Q ss_pred             HHCCCCEEEECCCCCHHHHHH-H-CCCEEEEEECCCC-CCCCCCEEEHHHHHHHHHHHHHHHHHHCC
Q ss_conf             828995797414543588986-0-5989999004787-36878404799999999999999998724
Q gi|254780782|r  322 TTGNIPLLSTSGGTSDARFIK-D-YCPVIEFGLVGRT-MHALNENASLQDLEDLTCIYENFLQNWFI  385 (389)
Q Consensus       322 ~~g~~~~~~~~gg~~d~~~~~-~-~iP~v~fGp~~~~-~H~pdE~i~i~~l~~~~~~~~~~i~~~~~  385 (389)
                      . +..|.+....|++|++++. . ++|++.||||+.. +|++|||+++++|.+++++|.++|++|++
T Consensus       286 ~-g~~p~~~~~~g~sD~~~~~~~~gip~v~~GPG~~~~aH~~dE~v~i~el~~~~~i~~~~l~~lag  351 (352)
T PRK04443        286 A-GGTPRLKKKTGTSDMNVVGPAWGCPMVAYGPGDSDLDHTPYEHLPLAEYLRAIAVLEAVLERLAG  351 (352)
T ss_pred             H-CCCCEEEECCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCCCEEHHHHHHHHHHHHHHHHHHHC
T ss_conf             3-89817874043344998872669999998999865689987419999999999999999999708


No 28 
>PRK08737 acetylornithine deacetylase; Provisional
Probab=100.00  E-value=0  Score=446.01  Aligned_cols=347  Identities=21%  Similarity=0.317  Sum_probs=254.2

Q ss_pred             HHHHHHHHHHHCCCCCCCCHH-----HHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEECCCCCEEEEECCCCCCC
Q ss_conf             789999999964999789968-----999999999997798489997058887624899999879998899973368157
Q gi|254780782|r    3 PDCLEHLIQLIKCPSVTPQDG-----GAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDVVP   77 (389)
Q Consensus         3 ~e~v~~l~~lv~ips~s~~e~-----~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g~~~~~ill~~H~Dtvp   77 (389)
                      .+.|++|++||+|||+||...     .+++|++++|  .||+++.++..    ....|++++.|  .|+|+|+||+||||
T Consensus         6 ~~~lelL~~LI~~~T~np~~~~~~~~~i~~~l~~~l--~G~~~e~~~~~----~~~~~l~a~~g--~p~l~lngH~DvVP   77 (366)
T PRK08737          6 TSTLDHLEALVSFDTRNPPRAIAAEGGIFDYLRAQL--PGFQVEVIDHG----AGAVSLYAVRG--TPKYLFNVHLDTVP   77 (366)
T ss_pred             HHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHC--CCCEEEEEECC----CCEEEEEEECC--CCCEEEECCCCCCC
T ss_conf             779999999729878698865405689999999756--88668999369----97279997159--97189956767488


Q ss_pred             CCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCEECCCCCCCCCCCCCCC
Q ss_conf             88877725666422452133236544333201245441000000011357834999752022011044211111000133
Q gi|254780782|r   78 PGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKG  157 (389)
Q Consensus        78 ~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~~~  157 (389)
                      .+  ..|++|||.++++||||||||++||||++|++++|++.+      .+++.++|++|||.++..|...++    .++
T Consensus        78 ~~--~~W~~dPF~~~i~dgrlYGRGa~DMKG~lAa~~~a~~~~------~~~v~l~~~~DEE~g~~~g~~~~~----~~~  145 (366)
T PRK08737         78 DS--PHWSADPHVMRRTEDRVIGLGVCDIKGAAAALVAAANAG------DGDAAFLFSSDEEANDPRCIAAFL----ARG  145 (366)
T ss_pred             CC--CCCCCCCCCCEEECCEEEECCCCCHHHHHHHHHHHHHHC------CCCEEEEEECCCCCCHHHHHHHHH----HCC
T ss_conf             99--998669988678899898336210162899999998613------688699995445578377899999----659


Q ss_pred             CCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCCHHHH-CCCCHHHHHHHHHHCCCCCCCC---CCCCCCCC
Q ss_conf             2120354145665434310012322235799999964123100000-0120134554432011223344---56644210
Q gi|254780782|r  158 EKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPH-LTENPIRGLIPLLHQLTNIGFD---TGNTTFSP  233 (389)
Q Consensus       158 ~~~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~p~-~g~nAi~~~~~~i~~l~~~~~~---~~~~~~~~  233 (389)
                      ..+|+||++|||+..     +++|+||.++++++++|+++|||.|+ .|.|||+.++.++.++.+....   ........
T Consensus       146 ~~~d~~IVgEPT~~~-----~~~ahkG~~~~~v~v~G~~aHaS~~~~~g~nAi~~a~~~~~~~l~~~~~~~~~~~~~~~~  220 (366)
T PRK08737        146 IPYDAVLVAEPTMSE-----AVLAHRGISSVLMRFAGRAGHASGKQDPAASALHQAMRWGGKALDHVESLAHARFGGLTG  220 (366)
T ss_pred             CCCCEEEECCCCCCC-----EEEEECCEEEEEEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             997859983798772-----499766789999999706535888630327899999999999999988640245578887


Q ss_pred             EEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCC-CCCCHHHHH
Q ss_conf             1466765542046665543211665134342067799999999998765324203431123222663112-578678999
Q gi|254780782|r  234 TNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV-FLTHDRKLT  312 (389)
Q Consensus       234 ~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~-~~~~~~~l~  312 (389)
                      +++|++.|+ |+.+.|+||++|++.+|+|+.|+++.+++.+++++......     ..++..+.....|. ........ 
T Consensus       221 ~~~nvg~I~-GG~~~NvVP~~~~~~~d~R~~P~~d~~~v~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~-  293 (366)
T PRK08737        221 LRFNIGRVE-GGIKANMIAPAAELRFGFRPLPSMDVDGLLATFAGFAEPAA-----AHFEETFRGPSLPSGDIARAEER-  293 (366)
T ss_pred             CEEEEEEEE-CCCCCCCCCCEEEEEEEEECCCCCCHHHHHHHHHHHHCCCC-----CEEEEEECCCCCCCCCCCCCHHH-
T ss_conf             347872265-38778701887899998632999999999999998745001-----52478753677787765432267-


Q ss_pred             HHHHHHHHHHHCCCCEEEECCCCCHHHHHH-HCCCEEEEEECC-CCCCCCCCEEEHHHHHHHHHHHHHHHHH
Q ss_conf             999999999828995797414543588986-059899990047-8736878404799999999999999998
Q gi|254780782|r  313 SLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVG-RTMHALNENASLQDLEDLTCIYENFLQN  382 (389)
Q Consensus       313 ~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~-~~iP~v~fGp~~-~~~H~pdE~i~i~~l~~~~~~~~~~i~~  382 (389)
                      ..+.+...+... .|......+++|+++++ .++|++.||||+ ..+|++||||+++++.+++++|.++|..
T Consensus       294 ~~~~~~~~~~~~-~p~~~~~~~~Tda~~~~~~Giptvv~GPG~i~~AH~~dE~V~l~el~~~~~~l~rli~~  364 (366)
T PRK08737        294 RLAARDVADALD-LPIGNAVDFWTEASLFSAGGYTALVYGPGDIAQAHTADEFVTLAQLQRYAESVHRIING  364 (366)
T ss_pred             HHHHHHHHHHHC-CCCCCCCCCCCCHHHHHCCCCCEEEECCCCHHHCCCCCCCEEHHHHHHHHHHHHHHHCC
T ss_conf             889999988736-87678775526588885079998999889167589988318799999999999998657


No 29 
>PRK07338 hypothetical protein; Provisional
Probab=100.00  E-value=0  Score=436.51  Aligned_cols=363  Identities=23%  Similarity=0.268  Sum_probs=296.2

Q ss_pred             CHHHHHHHHHHHCCCCCCCCHHH---HHHHHHHHHHHCCCEEEEEEECCCC----------CCEEEEEEEEE-CCCCCEE
Q ss_conf             87899999999649997899689---9999999999779848999705888----------76248999998-7999889
Q gi|254780782|r    2 TPDCLEHLIQLIKCPSVTPQDGG---AFFILVNTLKLLGFSIEEKDFQTKN----------TSIVKNLYARF-GTEAPHL   67 (389)
Q Consensus         2 ~~e~v~~l~~lv~ips~s~~e~~---~~~~l~~~l~~~G~~~~~~~~~~~~----------~~~~~~~~~~~-g~~~~~i   67 (389)
                      .++++++|++||+|+|.|.+..+   +++++++.|+.+|++++.++..+..          ...-.++.++. +++++.|
T Consensus        16 ~~~~l~~l~~lV~i~S~S~~~~gv~~v~~~l~~~l~~lg~~v~~~~~~~~~~~~~~g~~~~~~~g~~l~~~~~~~~~~~l   95 (407)
T PRK07338         16 QAAMVDQLHAWCAINSGSGNLDGLARMAETLADAFAALPGEIELITLPPVEVIDADGRVVEQSHGPALHVRVRPEAPRQV   95 (407)
T ss_pred             HHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCEE
T ss_conf             99999999999478899999999999999999999867995899716874322556752335668669986269998228


Q ss_pred             EEECCCCCCCCCCHHHCCCCCCCE--EEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCCEECC
Q ss_conf             997336815788877725666422--452133236544333201245441000000011-35783499975202201104
Q gi|254780782|r   68 MFAGHIDVVPPGDFNHWTYPPFSA--TIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEGPAIN  144 (389)
Q Consensus        68 ll~~H~Dtvp~~~~~~W~~~Pf~~--~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~~~~~  144 (389)
                      +|+||||||++..      .||+.  .++|||+||||++|||||++++|+|+++|.+.. .+..+|.++|++|||.|+. 
T Consensus        96 ll~gH~DTV~p~g------~~~~~~~~~~~grlyG~G~~DmKgGla~~l~Al~al~~~~~~~~~~i~v~~t~DEE~G~~-  168 (407)
T PRK07338         96 LLTGHMDTVYPAD------HPFQTLSLLDDGTLNGPGVADMKGGIAVMLAALAAFENSPLADRLGYDVLINSDEEIGSP-  168 (407)
T ss_pred             EEECCCCEECCCC------CCCCCCEEECCCEEECCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCEEEEEEEEECCCCC-
T ss_conf             9981156667999------867685472499898367022542099999999999856877887489999730347886-


Q ss_pred             CCCCCCCCCCCCCCCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCCHH-HHCCCCHHHHHHHHHHCCCCCC
Q ss_conf             421111100013321203541456654343100123222357999999641231000-0001201345544320112233
Q gi|254780782|r  145 GTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAY-PHLTENPIRGLIPLLHQLTNIG  223 (389)
Q Consensus       145 G~~~l~~~~~~~~~~~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~-p~~g~nAi~~~~~~i~~l~~~~  223 (389)
                      |++.+++   +.....|+++++||+...   ..++.++||..+++|+|+|+++||+. |+.|+|||..++.++.+|+++.
T Consensus       169 ~s~~~l~---~~~~~~~~~lv~Ep~~~~---g~i~~~rkG~~~~~l~v~G~aaHag~~p~~G~nAi~~~a~~i~~l~~l~  242 (407)
T PRK07338        169 ASAPLLA---ELARGKHAALTYEPALPD---GTLAGARKGSGNFSIVVTGRAAHAGRAFDEGRNAIVAAAELALALHALN  242 (407)
T ss_pred             CHHHHHH---HHCCCCCEEEEECCCCCC---CCEEEECCCCEEEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCC
T ss_conf             3599999---862559999996788888---8178732551689999998715677784224529999999999865313


Q ss_pred             CCCCCCCCCCEEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCC
Q ss_conf             44566442101466765542046665543211665134342067799999999998765324203431123222663112
Q gi|254780782|r  224 FDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV  303 (389)
Q Consensus       224 ~~~~~~~~~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~  303 (389)
                      ...     ..+|+|++.|++| .+.|+||++|++.+|+|+.+.++.+.+.+++++.+.+. ...++++++++.....+|.
T Consensus       243 ~~~-----~g~T~Nvg~I~GG-~~~NvVPd~a~~~~d~R~~~~e~~e~v~~~i~~~~~~~-~~~~~~~~~~~~~~~rpp~  315 (407)
T PRK07338        243 GQR-----PGVTVNVAKIDGG-GPNNVVPDNAVLRFNIRPSLPEDAAWVEAELNKLIAAI-EARHDVSLHLHGGFGRPPK  315 (407)
T ss_pred             CCC-----CCCEEEEEEEECC-CCCCCCCCCEEEEEEEEECCHHHHHHHHHHHHHHHHHH-CCCCCEEEEEEEEEECCCC
T ss_conf             567-----9950225887668-86742687079999995097766999999999999862-3468738999722643885


Q ss_pred             CCCCHH-HHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHH-HCCCEE-EEEECCCCCCCCCCEEEHHHHHHHHHHHHHHH
Q ss_conf             578678-999999999999828995797414543588986-059899-99004787368784047999999999999999
Q gi|254780782|r  304 FLTHDR-KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVI-EFGLVGRTMHALNENASLQDLEDLTCIYENFL  380 (389)
Q Consensus       304 ~~~~~~-~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~-~~iP~v-~fGp~~~~~H~pdE~i~i~~l~~~~~~~~~~i  380 (389)
                      ..++.+ .+++.++++ .+..|.++....++|++|++|+. .++|++ +|||.+.++|++|||+.++++...+++++.+|
T Consensus       316 ~~~~~~~~l~~~~~~~-~~~lG~~~~~~~~gGgsDa~~~a~~GiPtldglGp~G~~~H~~dE~v~v~sl~~r~~l~A~~i  394 (407)
T PRK07338        316 PINAAAQRLFALVQAC-GAALGLDIDWKDSGGVCDGNNLAAAGLPVVDTLGVRGGNIHSSDEYAILDSLAERAQLSALIL  394 (407)
T ss_pred             CCCCCHHHHHHHHHHH-HHHHCCCCCEECCCEEEHHHHHHHCCCCEEEECCCCCCCCCCCCCEEEHHHHHHHHHHHHHHH
T ss_conf             8898409999999999-998489972214875107898877499977866898888889984898504999999999999


Q ss_pred             HHHCC
Q ss_conf             98724
Q gi|254780782|r  381 QNWFI  385 (389)
Q Consensus       381 ~~~~~  385 (389)
                      .+++.
T Consensus       395 ~~Ls~  399 (407)
T PRK07338        395 MRLAQ  399 (407)
T ss_pred             HHHHC
T ss_conf             99856


No 30 
>PRK07205 hypothetical protein; Provisional
Probab=100.00  E-value=0  Score=430.61  Aligned_cols=356  Identities=23%  Similarity=0.294  Sum_probs=268.1

Q ss_pred             CHHHHHHHHHHHCCCCCCCCH----------HHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEECCCCCEEEEEC
Q ss_conf             878999999996499978996----------8999999999997798489997058887624899999879998899973
Q gi|254780782|r    2 TPDCLEHLIQLIKCPSVTPQD----------GGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG   71 (389)
Q Consensus         2 ~~e~v~~l~~lv~ips~s~~e----------~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g~~~~~ill~~   71 (389)
                      +.|+|+.|++||+|||+++..          ..+++++.+.++++||++...  .+ +    ...++.+|.++++|++++
T Consensus        10 ~d~~i~~l~~lv~IpSV~~~~~~~~P~g~~~~~al~~~~~~~~~~Gf~t~~~--~~-~----~~g~~~~G~g~~~i~i~g   82 (444)
T PRK07205         10 QDACVAAIKRLVSYPSVLHEGENGTPFGQAIQDVLEATLDLCQGLGFKTYLD--PD-G----YYGYAEIGQGEELLAILC   82 (444)
T ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEC--CC-C----CEEEEEECCCCCEEEEEC
T ss_conf             9999999999726898188766789755789999999999998669827872--89-8----258888679997799956


Q ss_pred             CCCCCCCCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCCEECCCCCCCC
Q ss_conf             36815788877725666422452133236544333201245441000000011-35783499975202201104421111
Q gi|254780782|r   72 HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEGPAINGTKKML  150 (389)
Q Consensus        72 H~Dtvp~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~~~~~G~~~l~  150 (389)
                      |+||||+|+.++|++|||+++++||+|||||++||||+++++|+|+++|++.+ ++.++|.++|++|||+++. +..++.
T Consensus        83 H~DVVP~Gd~~~W~~dPF~~~i~dGkLYGRGa~DmKG~l~a~l~A~~~l~e~g~~l~~~I~li~~~dEE~~~~-~~~~y~  161 (444)
T PRK07205         83 HLDVVPEGDLSDWKTDPFEAVEADGCLFGRGTQDDKGPTMAALFAVKALLDAGVTFNKRIRFIFGTDEETLWR-CMNRYN  161 (444)
T ss_pred             CCCCCCCCCCCCCCCCCCCEEEECCEEEECCCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCCCC-CHHHHH
T ss_conf             5363389984458779986699899999147501666899999999999970999895099999824645753-245543


Q ss_pred             CCCCCCCCCCCEEEECCCCCCCCCCEEEEEEEEEE---------------------------------------------
Q ss_conf             10001332120354145665434310012322235---------------------------------------------
Q gi|254780782|r  151 SWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGS---------------------------------------------  185 (389)
Q Consensus       151 ~~~~~~~~~~d~~i~~ep~~~~~~~~~i~~g~rG~---------------------------------------------  185 (389)
                      +.    ...+++++..+...+      +++++||.                                             
T Consensus       162 ~~----~~~~~~g~~pD~~~p------vi~~ekG~~~~~l~~~~~~~~~~~~g~a~n~vp~~a~~~g~~~~~~~~~l~~~  231 (444)
T PRK07205        162 EV----EEQATFGFAPDSSFP------LTYAEKGLLQAKLVGPGSDKLSLEVGQAFNVVPAKASYQGPKLEALQKELDKL  231 (444)
T ss_pred             CC----CCCCCEEECCCCCCC------EEEECCEEEEEEEEECCCCCEEEEECCCCEECCCCCCCCCCHHHHHHHHHHHC
T ss_conf             00----345312224577665------05621205899999458773699815520110552200674189999999854


Q ss_pred             ------EEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCCC----------C-CCCCCCCCEE-EEEEEEEECCCC
Q ss_conf             ------799999964123100000012013455443201122334----------4-5664421014-667655420466
Q gi|254780782|r  186 ------LSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGF----------D-TGNTTFSPTN-MEITTIDVGNPS  247 (389)
Q Consensus       186 ------~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~----------~-~~~~~~~~~~-~~i~~i~~g~~~  247 (389)
                            ...+|+++|+++|+++|+.|+|||..++.++..+.....          + .+...+.+.. -..+.+......
T Consensus       232 ~~~~~~~~~~i~v~G~~aH~s~p~~GvNAi~~l~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~g~lt~n~~~  311 (444)
T PRK07205        232 GFEYVVKEGEVTVYGKSQHAKDAPDGINAVIRLAKALVVLEPHPALDFLANVIGEDATGLNIFGDIEDEPSGKLSFNIAG  311 (444)
T ss_pred             CCEEEECCCEEEEEEEECCCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCCCCCCCCCCCEEEEEEEEECC
T ss_conf             63354027779993102565686445268999999998743040778899870777776602687434302458996253


Q ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCC
Q ss_conf             65543211665134342067799999999998765324203431123222663112578678999999999999828995
Q gi|254780782|r  248 KNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIP  327 (389)
Q Consensus       248 ~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~l~~a~~~~~g~~~  327 (389)
                      .|++|++|.+.+|+|+++..+.+++.+++++.+.+.     +.+  ++.....+|..++.++++++.+.+++++++|..+
T Consensus       312 ~~~~~~~~~~~~d~R~p~~~~~e~i~~~l~~~~~~~-----~~~--~~~~~~~~p~~~~~d~~lV~~l~~~~~~~tG~~~  384 (444)
T PRK07205        312 LTITKEKSEIRIDIRIPVLADKEKLVQQLSQKAQEY-----GLT--YEEFDYLAPLYVPLDSELVSTLMSVYQEKTGDDS  384 (444)
T ss_pred             EEECCCCEEEEEEEECCCCCCHHHHHHHHHHHHHHC-----CCE--EEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             786388679999997279999999999999999872-----958--9982236777719797999999999999859998


Q ss_pred             EEEECCCCCHHHHHHHCCCEEEEE---ECC-CCCCCCCCEEEHHHHHHHHHHHHHHHHHHCC
Q ss_conf             797414543588986059899990---047-8736878404799999999999999998724
Q gi|254780782|r  328 LLSTSGGTSDARFIKDYCPVIEFG---LVG-RTMHALNENASLQDLEDLTCIYENFLQNWFI  385 (389)
Q Consensus       328 ~~~~~gg~~d~~~~~~~iP~v~fG---p~~-~~~H~pdE~i~i~~l~~~~~~~~~~i~~~~~  385 (389)
                      .+..++|+++++++   .++|.||   |+. ..+|+||||+++++|.+++++|++.|.+|+.
T Consensus       385 ~~~~~gG~t~ar~~---~~~V~fG~~~PG~~~~aH~~nE~v~id~l~~~~~IYa~ai~~L~~  443 (444)
T PRK07205        385 PAQSSGGATFARTM---PNCVAFGALFPGAPQTEHQANEHIVLEDLYRAMDIYAEAIYRLTT  443 (444)
T ss_pred             CEEEECHHHHHHHC---CCEEEECCCCCCCCCCCCCCCCCEEHHHHHHHHHHHHHHHHHHHC
T ss_conf             38997789999739---998998982499888754568158999999999999999999855


No 31 
>PRK07318 dipeptidase PepV; Reviewed
Probab=100.00  E-value=0  Score=426.38  Aligned_cols=356  Identities=24%  Similarity=0.288  Sum_probs=270.3

Q ss_pred             CHHHHHHHHHHHCCCCCCCC------------HHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEECCCCCEEEE
Q ss_conf             87899999999649997899------------689999999999977984899970588876248999998799988999
Q gi|254780782|r    2 TPDCLEHLIQLIKCPSVTPQ------------DGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMF   69 (389)
Q Consensus         2 ~~e~v~~l~~lv~ips~s~~------------e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g~~~~~ill   69 (389)
                      +.|+|+.|++||+|||+++.            ...+++++.++++++||+++..+      +.  ..++.+|.++++|++
T Consensus        13 ~de~i~~l~~Lv~IpSV~~~~~~~~~~PfG~~~~~al~~~l~~~~~~Gf~~~~~d------~~--~g~~~~G~g~~~i~i   84 (469)
T PRK07318         13 KDDLIEDLQELLRINSVRDDSKAKEGAPFGPGPVKALEYFLEIAERDGFKTKNVD------NY--AGHIEYGEGEEVLGI   84 (469)
T ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEECC------CE--EEEEEECCCCCEEEE
T ss_conf             9999999998704797288766777799986699999999999987798078507------76--999983699967999


Q ss_pred             ECCCCCCCCCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCCEECCCCCC
Q ss_conf             7336815788877725666422452133236544333201245441000000011-357834999752022011044211
Q gi|254780782|r   70 AGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEGPAINGTKK  148 (389)
Q Consensus        70 ~~H~Dtvp~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~~~~~G~~~  148 (389)
                      .+|+||||+|+  +|++|||+++++||+|||||++||||+++++|+|++.+++.+ ++.++|.++|++|||+|+. |+++
T Consensus        85 ~gH~DVVP~gd--~W~~dPF~~~i~dG~lYGRGa~D~KG~~~a~l~Alk~lkd~g~~l~~~i~li~~~dEE~G~~-~~~~  161 (469)
T PRK07318         85 LGHLDVVPAGD--GWDTDPYEPVIKDGKIYARGTSDDKGPTMAAYYALKIIKELGLPLSKKIRFIVGTDEESGWK-CMDY  161 (469)
T ss_pred             ECCCCCCCCCC--CCCCCCCCEEEECCEEEEECCCCCCCCHHHHHHHHHHHHHCCCCCCCEEEEEEEECCCCCCC-CHHH
T ss_conf             73445358999--98779974599899999605212664589999999999972999895189999825435863-4577


Q ss_pred             CCCCCCC--CCCCCCE---EEECCCCC----------------------------CCCCCE---EE--------------
Q ss_conf             1110001--3321203---54145665----------------------------434310---01--------------
Q gi|254780782|r  149 MLSWIEK--KGEKWDA---CIVGEPTC----------------------------NHIIGD---TI--------------  178 (389)
Q Consensus       149 l~~~~~~--~~~~~d~---~i~~ep~~----------------------------~~~~~~---~i--------------  178 (389)
                      +++....  .+..+|.   ++.+|.+.                            .+.++.   .+              
T Consensus       162 y~~~~~~p~~gftpDa~fPvi~gEKG~~~~~l~~~~~~~~~~~~~~l~~~~~G~~~n~VP~~a~a~i~~~~~~~~~~~~~  241 (469)
T PRK07318        162 YFKHEEMPDFGFSPDAEFPIINGEKGIITFDLVQNHFEGDNEGDYVLVSFKSGLRENMVPDSAEAVITGDEDLDDLIAAF  241 (469)
T ss_pred             HHHCCCCCCCCCCCCCCCCEEECCCCEEEEEEEEECCCCCCCCCEEEEEEECCCCCCCCCCCEEEEEECCCCHHHHHHHH
T ss_conf             87425573224466655652531343378999850235677774489985135435667632058985588578889999


Q ss_pred             -----EEEEEEEE-----EEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCC-----------------------CC
Q ss_conf             -----23222357-----9999996412310000001201345544320112233-----------------------44
Q gi|254780782|r  179 -----KIGRRGSL-----SGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIG-----------------------FD  225 (389)
Q Consensus       179 -----~~g~rG~~-----~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~-----------------------~~  225 (389)
                           ..+.+|..     +++|+++|+++|||+|+.|+|||..++.++.++.-..                       ..
T Consensus       242 ~~~~~~~~~~g~~~~~~~~~~v~~~G~~aHaS~P~~G~NAi~~l~~~l~~l~~~~~~~~~~~~~~~~~~~~~~g~~lgi~  321 (469)
T PRK07318        242 EAFLAENGLKGEAEEEGGKLVLTVIGKSAHGSTPEKGVNAGTYLAKFLAQLNLDGAAKAFLDFAAEYLHEDTRGEKLGIA  321 (469)
T ss_pred             HHHHHHCCCEEEEEECCCEEEEEEEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             88886448147998528669999976750113865574989999999986456610466777667752776664426865


Q ss_pred             CCCCCCCCEEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCC
Q ss_conf             56644210146676554204666554321166513434206779999999999876532420343112322266311257
Q gi|254780782|r  226 TGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFL  305 (389)
Q Consensus       226 ~~~~~~~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~  305 (389)
                      ..+...+++++|++.+..+      .++.|++.+|+|++++.+.+++.+.+++.+.+       ..++++.....+|..+
T Consensus       322 ~~d~~~G~~t~n~g~i~~~------~~~~~~~~~d~R~p~~~~~e~i~~~l~~~~~~-------~~~~~~~~~~~~p~~~  388 (469)
T PRK07318        322 YEDEVMGDLTMNVGVFSYD------NEKGGKLGLNLRYPVGTDFEKIKAGLEKLIGV-------TGFELSEGHHQKPHYV  388 (469)
T ss_pred             CCCCCCCCCEEEEEEECCC------CCCCEEEEEEEECCCCCCHHHHHHHHHHHHHH-------CCEEEEECCCCCCCCC
T ss_conf             5578778613886566356------88633999997048999999999999987765-------4769997326887344


Q ss_pred             CCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHCCCEEEEE---ECC-CCCCCCCCEEEHHHHHHHHHHHHHHHH
Q ss_conf             8678999999999999828995797414543588986059899990---047-873687840479999999999999999
Q gi|254780782|r  306 THDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFG---LVG-RTMHALNENASLQDLEDLTCIYENFLQ  381 (389)
Q Consensus       306 ~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~~~iP~v~fG---p~~-~~~H~pdE~i~i~~l~~~~~~~~~~i~  381 (389)
                      ++++|+++.+.+++++++|..+.+..++|+||++++..   ++.||   |+. ..+|++|||+++++|.+++++|++.|.
T Consensus       389 ~~dsplV~~l~~~~~~~tG~~~~~~~~gGgT~ar~~~~---~V~fG~~~PG~~~~aH~~dE~v~i~~L~~a~~IYa~ai~  465 (469)
T PRK07318        389 PKDDPLVKTLLKVYEKQTGLKGEEQVIGGGTYARLLKR---GVAFGAMFPGEPDTMHQANEYIEIDDLIKAAAIYAEAIY  465 (469)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCCCEEEECCHHHHHHHHC---CEEECCCCCCCCCCCCCCCCCEEHHHHHHHHHHHHHHHH
T ss_conf             99989999999999998699983796458526666016---688677579998865378842899999999999999999


Q ss_pred             HHC
Q ss_conf             872
Q gi|254780782|r  382 NWF  384 (389)
Q Consensus       382 ~~~  384 (389)
                      +++
T Consensus       466 ~La  468 (469)
T PRK07318        466 ELA  468 (469)
T ss_pred             HHH
T ss_conf             974


No 32 
>PRK09104 hypothetical protein; Validated
Probab=100.00  E-value=0  Score=425.33  Aligned_cols=374  Identities=24%  Similarity=0.309  Sum_probs=298.1

Q ss_pred             CHHHHHHHHHHHCCCCCCCCH------HHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEE-C--CCCCEEEEECC
Q ss_conf             878999999996499978996------89999999999977984899970588876248999998-7--99988999733
Q gi|254780782|r    2 TPDCLEHLIQLIKCPSVTPQD------GGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF-G--TEAPHLMFAGH   72 (389)
Q Consensus         2 ~~e~v~~l~~lv~ips~s~~e------~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~-g--~~~~~ill~~H   72 (389)
                      ..++|+.|+++|+|||+|.+.      ..+++|++++|+++||+++.++..  +   .+.++++. +  ++.||||||+|
T Consensus        17 ~~~~~~~L~~~v~ipSvS~~~~~~~~~~~~a~~~~~~l~~lG~~~~~~~t~--g---~P~v~a~~~~~~~~~ptvL~YgH   91 (465)
T PRK09104         17 LDASLERLFALLRIPSISTDPAYAADCRKAADWLVADLASLGFDASVRPTP--G---HPMVVAHHPGATGDAPHVLFYGH   91 (465)
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECC--C---CCEEEEEECCCCCCCCEEEEEEC
T ss_conf             899999999996279878996423899999999999999779969998569--9---98799971257888987999956


Q ss_pred             CCCCCCCCHHHCCCCCCCEEEECC-----CCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCCEECCCC
Q ss_conf             681578887772566642245213-----3236544333201245441000000011-3578349997520220110442
Q gi|254780782|r   73 IDVVPPGDFNHWTYPPFSATIAEG-----KIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEGPAINGT  146 (389)
Q Consensus        73 ~Dtvp~~~~~~W~~~Pf~~~~~~g-----~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~~~~~G~  146 (389)
                      +||||+++.+.|++|||+|+++|+     +|||||++||||+++++|+|++++++.. .+..+|+|+++++||+|+.+ .
T Consensus        92 yDVqP~~p~~~W~~~PF~p~i~d~~~~g~~lyGRGa~DdKG~~~a~l~A~~a~~~~~~~lpvni~~l~egeEE~GS~~-l  170 (465)
T PRK09104         92 YDVQPVDPLDLWERPPFEPQLKETPDGRKVIVARGASDDKGQLMTFVEACRAWKAVTGSLPVRVTILFEGEEESGSPS-L  170 (465)
T ss_pred             CCCCCCCCCCCCCCCCCCCEEEECCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCEEEEEECHHHHCCHH-H
T ss_conf             656689974467589977078853687627994465777358999999999999846999844699960436528865-8


Q ss_pred             CCCCCCCCCCCCCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEE--ECCCCHH-HHCCCCHHHHHHHHHHCCCCCC
Q ss_conf             111110001332120354145665434310012322235799999964--1231000-0001201345544320112233
Q gi|254780782|r  147 KKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHG--KQGHVAY-PHLTENPIRGLIPLLHQLTNIG  223 (389)
Q Consensus       147 ~~l~~~~~~~~~~~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G--~~~Hs~~-p~~g~nAi~~~~~~i~~l~~~~  223 (389)
                      ..+++...+ ..+.|++++.+.+......+.+++|.||.++++++|+|  +..||+. +....||+..++.++..|++..
T Consensus       171 ~~~l~~~~~-~l~aD~~~v~d~g~~~~~~p~i~~g~RG~~~~~l~v~g~~~~~HSG~~gg~~~np~~~L~~~la~L~d~~  249 (465)
T PRK09104        171 VPFLEANAE-ELKADVALVCDTGMWDRETPAITTSLRGLVGEEVTITAADRDLHSGLFGGAAANPIRVLTRILAGLHDET  249 (465)
T ss_pred             HHHHHHHHH-HHCCCEEEEECCCCCCCCCCEEEEECCEEEEEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCC
T ss_conf             999997257-6529989996588357898137885240689999996478888876667764659999999999850878


Q ss_pred             ---------------------------CCC----------------C----CCCCCCEEEEEEEEEEC---CCCCCCCCC
Q ss_conf             ---------------------------445----------------6----64421014667655420---466655432
Q gi|254780782|r  224 ---------------------------FDT----------------G----NTTFSPTNMEITTIDVG---NPSKNVIPA  253 (389)
Q Consensus       224 ---------------------------~~~----------------~----~~~~~~~~~~i~~i~~g---~~~~NvIP~  253 (389)
                                                 ++.                +    ...+..+|++|..|.+|   .++.||||.
T Consensus       250 g~v~Ipgfyd~v~~~s~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~Ptl~i~gi~~g~~g~g~ktVIP~  329 (465)
T PRK09104        250 GRVTLPGFYDGVEELPPEILAQWEALGFTAESFLGPIGLSIPAGEKGRSVLEQIWSRPTCEINGIWGGYTGEGFKTVIPA  329 (465)
T ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHCCCCHHHHHHHCCCCCCCCCCCCCHHHHHCCCCEEEEEEEECCCCCCCCCCCCCH
T ss_conf             97705653567788999999998766888899876428765567666478988533670787246668878887723282


Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECC
Q ss_conf             11665134342067799999999998765324203431123222663112578678999999999999828995797414
Q gi|254780782|r  254 QVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSG  333 (389)
Q Consensus       254 ~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~l~~a~~~~~g~~~~~~~~g  333 (389)
                      +|++++|+|++|+++++++.+.+++++.+...  .++++++......+|+.++.++|+++.+.+++++++|.+|....+|
T Consensus       330 ~a~akl~~RlvP~qdp~~v~~~l~~~l~~~~p--~~~~v~~~~~~~~~~~~~~~d~p~~~a~~~a~~~~~g~~p~~~~~G  407 (465)
T PRK09104        330 EASAKVSFRLVGGQDPAKIREAFRAFVRARLP--ADCSVEFHDHGGSPAIQLPYDSPFLAAAKAALSDEWGKPAVLIGSG  407 (465)
T ss_pred             HHEEEEEEEECCCCCHHHHHHHHHHHHHHHCC--CCCEEEEEECCCCCCEECCCCCHHHHHHHHHHHHHHCCCCCCCCCC
T ss_conf             11999999968999999999999999996389--9847999866887755259999999999999999739997654888


Q ss_pred             CCCHH-HHHH--HCCCEEEEEEC--CCCCCCCCCEEEHHHHHHHHHHHHHHHHHHC
Q ss_conf             54358-8986--05989999004--7873687840479999999999999999872
Q gi|254780782|r  334 GTSDA-RFIK--DYCPVIEFGLV--GRTMHALNENASLQDLEDLTCIYENFLQNWF  384 (389)
Q Consensus       334 g~~d~-~~~~--~~iP~v~fGp~--~~~~H~pdE~i~i~~l~~~~~~~~~~i~~~~  384 (389)
                      |+-.. ..+.  .++|++.+|.+  ++++|+|||++++++|.++++++++++.++-
T Consensus       408 GsiP~~~~~~~~l~~~~v~~g~g~~d~~~H~pNE~i~l~~~~~gi~~~a~~l~~la  463 (465)
T PRK09104        408 GSIPIVGDFKRILGMDSLLVGFGLDDDRIHSPNEKYDLSSFHKGIRSWARILAALA  463 (465)
T ss_pred             CCHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             53652999999878998996477787678588878269999999999999999984


No 33 
>PRK08554 peptidase; Reviewed
Probab=100.00  E-value=0  Score=419.84  Aligned_cols=369  Identities=19%  Similarity=0.307  Sum_probs=275.3

Q ss_pred             HHHHHHHHHHCCCCCCCCH------HHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEECCCCCEEEEECCCCCCC
Q ss_conf             8999999996499978996------8999999999997798489997058887624899999879998899973368157
Q gi|254780782|r    4 DCLEHLIQLIKCPSVTPQD------GGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDVVP   77 (389)
Q Consensus         4 e~v~~l~~lv~ips~s~~e------~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g~~~~~ill~~H~Dtvp   77 (389)
                      |+|++|++||+|||+|+..      .++++|++++|+++||+++.++.     +..++++++.|++.|+|+|+||+||||
T Consensus         2 d~v~ll~~LI~i~Svn~~~~~~~~~~~~~~~l~~~l~~~G~~~e~~~~-----~~~~~~~~~~g~g~p~l~~~gH~DVVP   76 (438)
T PRK08554          2 DVLELLSSLVSFETVNDPSKGIKPSKECPAFIKDTLESWGIESEIIER-----NGYYAVYGEIGEGRPKLLFMAHFDVVP   76 (438)
T ss_pred             CHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEC-----CCCEEEEEECCCCCCEEEEECCCCCCC
T ss_conf             789999997099998988777720899999999999977990699953-----991589996389996699978778868


Q ss_pred             CCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCEECCCCCCCCCCCCCCC
Q ss_conf             88877725666422452133236544333201245441000000011357834999752022011044211111000133
Q gi|254780782|r   78 PGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKG  157 (389)
Q Consensus        78 ~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~~~  157 (389)
                      +++ +.|++|||+++++||+|||||++||||++|++|+|++++.+. +..++|.|+|++|||+||.. ..++.+.+.+.+
T Consensus        77 ~~~-~~W~~dPF~~~i~dg~lyGRGa~DmKg~laa~l~A~~~l~~~-~l~~~i~~~~~~DEE~Gg~~-~~~~~~~~~~~~  153 (438)
T PRK08554         77 VNP-EEWETDPFKLTVKGDRAYGRGSADDKGNVAAIMLALKELSKE-PLNGKVIFAFTGDEEIGGAM-AMHIAERLREEG  153 (438)
T ss_pred             CCC-CCCCCCCCCEEEECCEEECCCCEECCHHHHHHHHHHHHHHHC-CCCCCEEEEEEECCCCCCCC-CHHHHHHHHHCC
T ss_conf             997-646379963799899998157622555399999999999748-99974899999346558757-199999988518


Q ss_pred             CCCCEEEECCCCCCCCC-----CEEE----------EEEEEEEEEEEEEEEEECC-CCHH--HHCCCCHHHHHHHHHHCC
Q ss_conf             21203541456654343-----1001----------2322235799999964123-1000--000120134554432011
Q gi|254780782|r  158 EKWDACIVGEPTCNHII-----GDTI----------KIGRRGSLSGEITIHGKQG-HVAY--PHLTENPIRGLIPLLHQL  219 (389)
Q Consensus       158 ~~~d~~i~~ep~~~~~~-----~~~i----------~~g~rG~~~~~i~v~G~~~-Hs~~--p~~g~nAi~~~~~~i~~l  219 (389)
                      ..+|+++.+||+.....     +..+          ..|..+...+.+.+.|..+ |+++  |....|++..+.+++...
T Consensus       154 ~~~~~~i~~e~~~~~~v~~~~~g~~~~i~v~~~~~~~~g~~~~~~~~~~~~~~~~~h~a~~~~g~~~~~~~~~~~~~~~~  233 (438)
T PRK08554        154 KLPKYMVNADGIGMKPIIRRRKGFGVTIRVPPEKTKVKGKIREMTFEIRTPVVETRHAAYFLPGVDTHPLIAASHFVREA  233 (438)
T ss_pred             CCCCEEEECCCCCCCEEECCCCEEEEEEEEECCCEEEEEEEEEEEEEEEECCCCCCCEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             78888993377765215614645679999513320344577346778774143022035406654547688899999861


Q ss_pred             CCCCCCC----CCCCCCCEEEEEEEEEEC---------------------------------------CCCCCCCCCCEE
Q ss_conf             2233445----664421014667655420---------------------------------------466655432116
Q gi|254780782|r  220 TNIGFDT----GNTTFSPTNMEITTIDVG---------------------------------------NPSKNVIPAQVK  256 (389)
Q Consensus       220 ~~~~~~~----~~~~~~~~~~~i~~i~~g---------------------------------------~~~~NvIP~~a~  256 (389)
                      .......    ......|..+++..++.+                                       ....++.+++++
T Consensus       234 ~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~d~~l~~~~~~~~p~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~  313 (438)
T PRK08554        234 EVLAVSLEGKFLKGNVVPGEVTLTYLEPGEGEEVEVDLGLTALLKSIVPLVRAPIKAEKYSDYGVSITPNVYSFAEGKHV  313 (438)
T ss_pred             HHHHHHHCCCCCCCCCCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCEECCCCCEEECCCEEEECCCCEE
T ss_conf             20233322432357756760689974377763222363155565403530125543211145450553450452276089


Q ss_pred             EEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCC
Q ss_conf             65134342067799999999998765324203431123222663112578678999999999999828995797414543
Q gi|254780782|r  257 MSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTS  336 (389)
Q Consensus       257 ~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~  336 (389)
                      +.+|+|.+++ +.+++.+.+++.+...   .+..++++.......+..+++++++++.+.++++++ |..+.+...+|++
T Consensus       314 ~~~d~R~~~~-~~~~i~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~-g~~~~p~~~~G~t  388 (438)
T PRK08554        314 LKLDVRAMSN-SKEDIERTLKEVLEFN---LPEAEVEVRTNEKAGYLFTDPEEEIVRVTLRVLKEL-GEDAEPVEGPGAS  388 (438)
T ss_pred             EEEEEECCCC-CHHHHHHHHHHHHHHC---CCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHH-CCCCCEEEEEECH
T ss_conf             9998841899-9899999999999860---896289999877677655799979999999999983-9998589977413


Q ss_pred             HHHHHH-HCCCEEEEEECCCCCCCCCCEEEHHHHHHHHHHHHHHHHHHCC
Q ss_conf             588986-0598999900478736878404799999999999999998724
Q gi|254780782|r  337 DARFIK-DYCPVIEFGLVGRTMHALNENASLQDLEDLTCIYENFLQNWFI  385 (389)
Q Consensus       337 d~~~~~-~~iP~v~fGp~~~~~H~pdE~i~i~~l~~~~~~~~~~i~~~~~  385 (389)
                      |+++++ .++|++.|||.+.++|++|||+++++|.+++++|+++|.+||+
T Consensus       389 Dar~~~~~gi~~v~fGP~~~~~H~~nE~v~i~~l~~~~~iY~~~l~~llg  438 (438)
T PRK08554        389 DSRYFTPYGVKAIDIGPKGGNIHGPNEYVEIDSLKKMPEVYRRIALRLLG  438 (438)
T ss_pred             HHHHHHHCCCCEEEECCCCCCCCCCCCCEEHHHHHHHHHHHHHHHHHHCC
T ss_conf             79999875991999879999938878638999999999999999999739


No 34 
>PRK07473 carboxypeptidase; Provisional
Probab=100.00  E-value=0  Score=419.64  Aligned_cols=355  Identities=19%  Similarity=0.223  Sum_probs=284.3

Q ss_pred             HHHHHHHHHHHCCCCCCCCHHH---HHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEE---CCCCCEEEEECCCCCC
Q ss_conf             7899999999649997899689---999999999977984899970588876248999998---7999889997336815
Q gi|254780782|r    3 PDCLEHLIQLIKCPSVTPQDGG---AFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF---GTEAPHLMFAGHIDVV   76 (389)
Q Consensus         3 ~e~v~~l~~lv~ips~s~~e~~---~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~---g~~~~~ill~~H~Dtv   76 (389)
                      .+++++|++||+|.|.|.+..+   +++++.++|+.+|+.+++++......   .++.+++   +.+.|.|+|.+|||||
T Consensus        11 ~~~l~~L~~lV~i~S~s~~~~gv~~~~~~~~~~l~~lG~~ve~~~~~~~~~---~~~~~~~~~~~~g~p~ill~gH~DTV   87 (376)
T PRK07473         11 EAMLQGLRPWVECESPTWDAAAVNRMLDLAARDMAIMGATIERIAGRQGFA---DCVRARFPHPRQGEPGILIAGHLDTV   87 (376)
T ss_pred             HHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCC---CEEEEEECCCCCCCCCEEEEECCCCC
T ss_conf             999999999964879999999999999999999986498489956777778---60899816899999878999256888


Q ss_pred             CCCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCCEECCCCCCCCCCCCC
Q ss_conf             788877725666422452133236544333201245441000000011-3578349997520220110442111110001
Q gi|254780782|r   77 PPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEK  155 (389)
Q Consensus        77 p~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~  155 (389)
                      ++.  ..|...||  .++||++||||++|||||++++|+|+++|.+.+ ...++|.|+|++|||.++ .|++.+++   .
T Consensus        88 ~p~--g~~~~~p~--r~eg~r~yGpGv~DMKgGla~~l~Al~aL~~~g~~~~~~i~~~~t~DEE~Gs-~gsr~li~---~  159 (376)
T PRK07473         88 HPV--GTLEKLPF--RREGNKCYGPGILDMKGGNYLALEAIRQLARASFTTPLPITVLFTPDEEVGT-PSTRDIIE---A  159 (376)
T ss_pred             CCC--CCCCCCCE--EEECCEEECCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCC-CCHHHHHH---H
T ss_conf             899--96667877--9879999888721254459999999999997278889758999973787787-20999999---7


Q ss_pred             CCCCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCC-HHHHCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCE
Q ss_conf             33212035414566543431001232223579999996412310-00000120134554432011223344566442101
Q gi|254780782|r  156 KGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHV-AYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPT  234 (389)
Q Consensus       156 ~~~~~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs-~~p~~g~nAi~~~~~~i~~l~~~~~~~~~~~~~~~  234 (389)
                      .....++++++||+...   ..+++++||..+++++|+|+++|| +.|+.|+|||..++..|.+|+.+..       ..+
T Consensus       160 ~~~~~~~~lv~Ep~~~~---~~iv~~rkG~~~~~l~v~G~aaHAG~~p~~G~nAI~ela~~i~~l~~l~~-------~~~  229 (376)
T PRK07473        160 EAARNKYVLVPEPGRPD---NGVVTGRYAIARFNLEATGRPSHAGATLSEGRSAIREMARQILAIDAMTT-------EDC  229 (376)
T ss_pred             HCCCCCEEEEECCCCCC---CCEEECCCCEEEEEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCC-------CCC
T ss_conf             42038999994898888---87476255348999999700764556701275799999999998774017-------897


Q ss_pred             EEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHH
Q ss_conf             46676554204666554321166513434206779999999999876532420343112322266311257867899999
Q gi|254780782|r  235 NMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSL  314 (389)
Q Consensus       235 ~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~  314 (389)
                      |+|++.|+ |+.+.|+||++|++..+.|.....+.+...+++.+    ......++++++......+|+..+.++..+..
T Consensus       230 T~nvG~I~-GG~~~NvVPd~a~~~~~~~~~~~~~l~~~~~~~~~----~~~~~~~~~~~~~~~~~rP~~~~~~~~~~l~~  304 (376)
T PRK07473        230 TFSVGIVH-GGQWVNCVATTCTGEALSMAKRQADLDRGVARMLA----LSGTSDDVGFEVTRGVTRPVWEPDAGTMALYE  304 (376)
T ss_pred             CEEEEEEE-CCCCCCCCCCEEEEEEEECCCCHHHHHHHHHHHHH----HHCCCCCEEEEEEECCCCCCCCCCCCCHHHHH
T ss_conf             26352586-79876146862599998512566789999999998----53547870799995523677589974499999


Q ss_pred             HHHHHHHHHCCCCEEEECCCCCHHHHHH-HCCCEE-EEEECCCCCCCCCCEEEHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999828995797414543588986-059899-99004787368784047999999999999999987
Q gi|254780782|r  315 LSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVI-EFGLVGRTMHALNENASLQDLEDLTCIYENFLQNW  383 (389)
Q Consensus       315 l~~a~~~~~g~~~~~~~~gg~~d~~~~~-~~iP~v-~fGp~~~~~H~pdE~i~i~~l~~~~~~~~~~i~~~  383 (389)
                      +.+++.+..|..+....++|++|++|++ .++|++ +|||.+.++|++|||+.++++...+++++++|.++
T Consensus       305 ~~~~~~~~lG~~~~~~~~gG~sDanf~a~~GiPtvdglG~~G~~aHt~dE~v~l~sL~~r~~lla~li~~L  375 (376)
T PRK07473        305 KARAIAEQLGVSLPHGSAGGGSDGNFTGAMGIPTLDGLGVRGADYHTLNEHIEVDSLAERGRLMAGLLATL  375 (376)
T ss_pred             HHHHHHHHHCCCCCCCCCCEECHHHHHHHCCCCEEEECCCCCCCCCCCCCEEECCHHHHHHHHHHHHHHHC
T ss_conf             99999998689986676742548888876499979867887678889986998253999999999999854


No 35 
>PRK07079 hypothetical protein; Provisional
Probab=100.00  E-value=0  Score=417.92  Aligned_cols=371  Identities=20%  Similarity=0.188  Sum_probs=295.3

Q ss_pred             HHHHHHHHHHHCCCCCCCCHH------H-HHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEE--CCCCCEEEEECCC
Q ss_conf             789999999964999789968------9-999999999977984899970588876248999998--7999889997336
Q gi|254780782|r    3 PDCLEHLIQLIKCPSVTPQDG------G-AFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF--GTEAPHLMFAGHI   73 (389)
Q Consensus         3 ~e~v~~l~~lv~ips~s~~e~------~-~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~--g~~~~~ill~~H~   73 (389)
                      -++++.|.++|+|||+|.+..      . +++|++++|+++||+++.++.....  .-+.+++++  +++.||||+|+|+
T Consensus        17 ~~fl~~L~~~v~ipSvS~~p~~~~~~~~~~a~~l~~~l~~~G~~~~~~~~~~~~--g~P~v~a~~~~~~~~pTvL~YgHy   94 (468)
T PRK07079         17 GAFFADLARRVALRTESQNPGAAPALRAYLTDEIAPELARLGFTSRIVANPVPG--GGPFLIAERHEDDALPTVLTYGHG   94 (468)
T ss_pred             HHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCC--CCCEEEEEECCCCCCCEEEEECCC
T ss_conf             189999999846788689975138999999999999999679925997468889--997899982479999879997254


Q ss_pred             CCCCCCCHHHCCC--CCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCC--CCCCCCEEEEEEEECCCEECCCCCCC
Q ss_conf             8157888777256--6642245213323654433320124544100000001--13578349997520220110442111
Q gi|254780782|r   74 DVVPPGDFNHWTY--PPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK--YKNFGSISLLITGDEEGPAINGTKKM  149 (389)
Q Consensus        74 Dtvp~~~~~~W~~--~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~--~~~~~~i~~~~~~dEE~~~~~G~~~l  149 (389)
                      ||||+. .+.|++  |||+++++||+|||||++||||+++++|.|++++++.  +.+..+|+|+|+++||+||.    .+
T Consensus        95 DVqP~~-~~~W~~p~dPf~~~~~~g~lygRGa~DdKG~~~~~l~Al~a~l~a~~g~lpvnvk~liEGeEE~GSp----~l  169 (468)
T PRK07079         95 DVVRGY-DEQWRAGLSPWELTVEGDRWYGRGTADNKGQHTINLAALEAVLEARGGKLGFNVKLLIEMGEEIGSP----GL  169 (468)
T ss_pred             CCCCCC-CCCCCCCCCCCEEEEECCEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCC----CH
T ss_conf             677687-3568888899747876998997425677317999999999999972898987659997853304996----47


Q ss_pred             CCCCCCCC--CCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEEC--CCCHH-HHCCCCHHHHHHHHHHCCCCCC-
Q ss_conf             11000133--212035414566543431001232223579999996412--31000-0001201345544320112233-
Q gi|254780782|r  150 LSWIEKKG--EKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQ--GHVAY-PHLTENPIRGLIPLLHQLTNIG-  223 (389)
Q Consensus       150 ~~~~~~~~--~~~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~--~Hs~~-p~~g~nAi~~~~~~i~~l~~~~-  223 (389)
                      .+++.++.  .+.|++++.+.+......+++++|.||.++++|+|+|..  -||+. .....||+..++.+|..|.+.. 
T Consensus       170 ~~~l~~~~~~l~aD~~l~~D~~~~~~~~P~i~~GlRG~~~~el~V~g~~~dlHSG~~GG~v~nP~~~L~~lLasL~D~~G  249 (468)
T PRK07079        170 AELCRAHREALAADVLIASDGPRLSAERPTLFLGSRGGVNFRLSVNLREGAHHSGNWGGLLRNPATVLAHAIASLVDARG  249 (468)
T ss_pred             HHHHHHHHHHHCCCEEEEECCCCCCCCCCEEEEECCCEEEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCC
T ss_conf             99999717873688999917883478996699834770899999981798887765666667889999999997438899


Q ss_pred             ------------------------CC-----------CCC-------CCCCCEEEEEEEEEECC--CCCCCCCCCEEEEE
Q ss_conf             ------------------------44-----------566-------44210146676554204--66655432116651
Q gi|254780782|r  224 ------------------------FD-----------TGN-------TTFSPTNMEITTIDVGN--PSKNVIPAQVKMSF  259 (389)
Q Consensus       224 ------------------------~~-----------~~~-------~~~~~~~~~i~~i~~g~--~~~NvIP~~a~~~~  259 (389)
                                              ++           .+.       ..+..+|++|..|.+|.  ...|+||.+|++++
T Consensus       250 ~I~IpGfyd~~l~~~~r~~l~~~~~~~~~~~~~l~~~~ge~g~s~~er~~~~pTl~V~gi~~G~~~~~~tvIP~~A~aKi  329 (468)
T PRK07079        250 RIRVDGLRPPPIPAAVRAALADITVGGGPGDPAIDPDWGEPGLTPAERVFGWNTLEVLAFKAGNPEAPVNAIPPRARAHC  329 (468)
T ss_pred             CEECCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCEEEEEEECCCCCCCCCEECCEEEEEE
T ss_conf             89537755888998999998568955566651200002877778888860467448986646888776555761029999


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEE-ECCCCCHH
Q ss_conf             34342067799999999998765324203431123222663112578678999999999999828995797-41454358
Q gi|254780782|r  260 NIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLS-TSGGTSDA  338 (389)
Q Consensus       260 diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~l~~a~~~~~g~~~~~~-~~gg~~d~  338 (389)
                      ++|++|+++++++.+.|++++.+...    ..++++......|+.++.++|+++++.+|+++++|.+|... .+||+..+
T Consensus       330 s~RLVP~qdp~~i~~~l~~hL~~~g~----~~v~v~~~~~~~~~~~~~d~P~~~aa~~Al~~~~g~~P~~~~~~GGSIP~  405 (468)
T PRK07079        330 QLRFVVGTDWQNLIAHLRAHLDAHGF----ADVEVRVERGAPATRLDPDDPWVRWALASIARTTGKKPALLPNLGGSLPN  405 (468)
T ss_pred             EEEECCCCCHHHHHHHHHHHHHHCCC----CCEEEEECCCCCCEECCCCCHHHHHHHHHHHHHHCCCCEEECCCCCCCHH
T ss_conf             99967999999999999999985399----95699976897633369999999999999999869995541688850047


Q ss_pred             HHHH--HCCCEEEEEEC--CCCCCCCCCEEEHHHHHHHHHHHHHHHHHHC
Q ss_conf             8986--05989999004--7873687840479999999999999999872
Q gi|254780782|r  339 RFIK--DYCPVIEFGLV--GRTMHALNENASLQDLEDLTCIYENFLQNWF  384 (389)
Q Consensus       339 ~~~~--~~iP~v~fGp~--~~~~H~pdE~i~i~~l~~~~~~~~~~i~~~~  384 (389)
                      ..+.  .++|++.+|-+  ++++|+|||++.+++|.+++++++.++.++=
T Consensus       406 ~~f~~~Lg~p~vl~g~~~~d~~~HaPNE~i~l~~~~~Gi~~~a~ll~eL~  455 (468)
T PRK07079        406 DVFADVLGLPTLWVPHSYPACSQHAPNEHLLASVVREGLQIMAGLFWDLG  455 (468)
T ss_pred             HHHHHHHCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             99999878988993068764667589988568999999999999999985


No 36 
>PRK08262 hypothetical protein; Provisional
Probab=100.00  E-value=0  Score=416.86  Aligned_cols=367  Identities=21%  Similarity=0.309  Sum_probs=282.0

Q ss_pred             HHHHHHHHHHHCCCCCCCCHH-----HHHHHHHHHHHHCCC-----EEEEEEECCCCCCEEEEEEEEECCC--CCEEEEE
Q ss_conf             789999999964999789968-----999999999997798-----4899970588876248999998799--9889997
Q gi|254780782|r    3 PDCLEHLIQLIKCPSVTPQDG-----GAFFILVNTLKLLGF-----SIEEKDFQTKNTSIVKNLYARFGTE--APHLMFA   70 (389)
Q Consensus         3 ~e~v~~l~~lv~ips~s~~e~-----~~~~~l~~~l~~~G~-----~~~~~~~~~~~~~~~~~~~~~~g~~--~~~ill~   70 (389)
                      ...++.|++.|++||+|..+.     ....-+.++|++. |     ..+..     ..+...-||.|.|++  -|.|+|+
T Consensus        47 ~~a~~~l~~~i~~~t~s~~~~~~~~~~~f~~~~~~l~~~-~P~v~~~~~~e-----~v~~~~ll~tw~Gsd~~l~Pill~  120 (489)
T PRK08262         47 DRAAQRLSEAIRFRTISNQDRADDDAAAFRALHAHLEAS-YPAVHAALERE-----VVGGHSLLYTWKGSDPSLKPIVLM  120 (489)
T ss_pred             HHHHHHHHHCCEEEEECCCCCCCCCHHHHHHHHHHHHHH-CHHHHHHEEEE-----EECCCEEEEEEECCCCCCCHHEEE
T ss_conf             999999973404303237887768979999999999986-85868522668-----986830799984768884510254


Q ss_pred             CCCCCCCCC--CHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCCEECCCCC
Q ss_conf             336815788--877725666422452133236544333201245441000000011-35783499975202201104421
Q gi|254780782|r   71 GHIDVVPPG--DFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEGPAINGTK  147 (389)
Q Consensus        71 ~H~Dtvp~~--~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~~~~~G~~  147 (389)
                      ||+||||++  ..+.|++|||+++++||+|||||+.|||++++++|+|++.|++++ +|.++|.++|++|||++|..|++
T Consensus       121 aH~DVVPv~~~t~~~W~~pPFsg~i~dG~IyGRGa~D~Kg~l~a~l~A~e~L~~~g~~P~rtI~l~fg~DEE~gG~~Ga~  200 (489)
T PRK08262        121 AHQDVVPVAPGTEGDWTHPPFSGVIADGYVWGRGALDDKGSLVAILEAAEALAAQGFQPKRTIYFAFGHDEEVGGLRGAK  200 (489)
T ss_pred             EECCEEECCCCCCCCCCCCCCCEEEECCEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCHHH
T ss_conf             00476306999734476699874887998880572666799999999999999809998961899962150105742299


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCC------CCCC--CEEEEEEEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCC
Q ss_conf             11110001332120354145665------4343--100123222357999999641231000000120134554432011
Q gi|254780782|r  148 KMLSWIEKKGEKWDACIVGEPTC------NHII--GDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQL  219 (389)
Q Consensus       148 ~l~~~~~~~~~~~d~~i~~ep~~------~~~~--~~~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l  219 (389)
                      ++.+.+.+++..+++++ .|+..      +...  ...+.+++||.++++|+++|++||||+|.. .|||..+++++.+|
T Consensus       201 ~i~~~l~~~~~~~~~vl-DEG~~v~~g~~~~~~~~~a~i~vaEKG~~~~~l~v~g~gGHSS~P~~-~tai~~La~ai~~L  278 (489)
T PRK08262        201 AIAALLKARGVRLAFVL-DEGGAITEGVFPGVTEPVALIGVAEKGYATLELTARATGGHSSMPPR-QTAIGRLARAVTRL  278 (489)
T ss_pred             HHHHHHHHCCCCCCEEE-CCCCCCCCCCCCCCCCEEEEEEEECEEEEEEEEEEECCCCCCCCCCC-CCHHHHHHHHHHHH
T ss_conf             99999986489863897-48862146766887842568886122689999999524764378888-78999999999999


Q ss_pred             CCCCCCCC-------------------------------------------CCCCCCEEEEEEEEEECCCCCCCCCCCEE
Q ss_conf             22334456-------------------------------------------64421014667655420466655432116
Q gi|254780782|r  220 TNIGFDTG-------------------------------------------NTTFSPTNMEITTIDVGNPSKNVIPAQVK  256 (389)
Q Consensus       220 ~~~~~~~~-------------------------------------------~~~~~~~~~~i~~i~~g~~~~NvIP~~a~  256 (389)
                      ++..++..                                           ...+..+|.+++.|+ |+...|+||++|+
T Consensus       279 e~~~~~~~l~~~~~~~~~~la~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~a~~~TT~a~t~i~-GG~k~NvlP~~a~  357 (489)
T PRK08262        279 EDNPLPMRIRGPVAEMFDTLAPEMSGAQRVVLANLWLFEPLLLRVMAKSPTTAAMLRTTTAPTMLN-GSDKDNVLPQEAE  357 (489)
T ss_pred             HHCCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHCHHHHHHHCCCCCCCCCCCCEEEEEEEC-CCCCCCCCCCEEE
T ss_conf             846686324657999999752432720556765343306778987513866442003336435851-6775751577589


Q ss_pred             EEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCC-EEEECCCC
Q ss_conf             65134342067799999999998765324203431123222663112578678999999999999828995-79741454
Q gi|254780782|r  257 MSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIP-LLSTSGGT  335 (389)
Q Consensus       257 ~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~l~~a~~~~~g~~~-~~~~~gg~  335 (389)
                      +.+|+|+.|+++.+++.+.+++.+.+     .+++++.......++...+.++++++.+.++++++++..+ .+..+.|+
T Consensus       358 a~vn~Ri~P~~s~e~V~~~v~~~i~~-----~~v~v~~~~~~~~p~pvs~~ds~~~~~l~~~i~~~~~~~~v~P~l~~g~  432 (489)
T PRK08262        358 AVVNFRILPGDTVASVIAHVRRAIAD-----DRVEIEVIEGNSEPSPVSDTDSPAFKLLERTIREVFPDVVVAPYLMIAA  432 (489)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHHCC-----CCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEEEECEE
T ss_conf             99975328999999999999998367-----8808999425778888389998799999999999869984465566416


Q ss_pred             CHHHHHHH-CCCEEEEEECC------CCCCCCCCEEEHHHHHHHHHHHHHHHHHH
Q ss_conf             35889860-59899990047------87368784047999999999999999987
Q gi|254780782|r  336 SDARFIKD-YCPVIEFGLVG------RTMHALNENASLQDLEDLTCIYENFLQNW  383 (389)
Q Consensus       336 ~d~~~~~~-~iP~v~fGp~~------~~~H~pdE~i~i~~l~~~~~~~~~~i~~~  383 (389)
                      ||++++.. ..+++.|+|..      .++|++||+|+++++.+++++|+++|++.
T Consensus       433 TDsr~y~~l~~~iyrf~P~~~~~~~~~~iHg~NE~Isi~~~~~~i~fy~~lI~n~  487 (489)
T PRK08262        433 TDSRHYAGIADNVYRFAPLRLTPEDLARFHGTNERISVDNYGRMIRFYRRLIENA  487 (489)
T ss_pred             CHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCEEHHHHHHHHHHHHHHHHHH
T ss_conf             5199999707986987670049851112769999718999999999999999861


No 37 
>TIGR01880 Ac-peptdase-euk N-acyl-L-amino-acid amidohydrolase; InterPro: IPR010159   This entry represents a family of eukaryotic N-acyl-L-amino-acid amidohydrolase (3.5.1.14 from EC) is a homodimeric zinc-binding mammalian enzyme that catalyzes the hydrolysis of N-alpha-acylated amino acids except L-aspartic acid. , . These enzymes are listed as being members of MEROPS peptidase family S20A (clan MH).; GO: 0004046 aminoacylase activity, 0006520 amino acid metabolic process, 0005737 cytoplasm.
Probab=100.00  E-value=0  Score=416.55  Aligned_cols=370  Identities=19%  Similarity=0.233  Sum_probs=303.7

Q ss_pred             HHHHHHHHHHCCCCC--CCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEECCCC--CEEEEECCCCCCCCC
Q ss_conf             899999999649997--8996899999999999779848999705888762489999987999--889997336815788
Q gi|254780782|r    4 DCLEHLIQLIKCPSV--TPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA--PHLMFAGHIDVVPPG   79 (389)
Q Consensus         4 e~v~~l~~lv~ips~--s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g~~~--~~ill~~H~Dtvp~~   79 (389)
                      ..|.++++|+||+|+  .|+...+.+||.+..+.+|+..+.+++..++..  ..|+.+.|.+.  |.|||+||+||||. 
T Consensus        11 ~~vtrFreYLRinTvqPnPdY~a~v~Fl~~~A~~lgL~~~~~E~~~Gq~~--~~~lTW~GsnP~LPSILLNSHtDVVP~-   87 (433)
T TIGR01880        11 EEVTRFREYLRINTVQPNPDYAAAVDFLIKQAKELGLESKTIEFVPGQKP--VVVLTWPGSNPELPSILLNSHTDVVPV-   87 (433)
T ss_pred             CCHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCEE--EEEEEECCCCCCHHHHHHHHCCCCCCC-
T ss_conf             00000112120578885687143799999976750887207887168705--999974589987578987302661056-


Q ss_pred             CHHHCCCCCCCEEEE-CCCCCCCCCCCCCCHHHHHHHHCCCCCCCC--CCCCCEEEEEEEECCCEECCCCCCCCCCCCCC
Q ss_conf             877725666422452-133236544333201245441000000011--35783499975202201104421111100013
Q gi|254780782|r   80 DFNHWTYPPFSATIA-EGKIYGRGIVDMKGSIACFIAAVARFIPKY--KNFGSISLLITGDEEGPAINGTKKMLSWIEKK  156 (389)
Q Consensus        80 ~~~~W~~~Pf~~~~~-~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~--~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~~  156 (389)
                      ..|.|+||||++..+ ||.||+|||.||||--+..|+|+|+|+.++  +++++|++.|++|||.||.+|++.+++  .+.
T Consensus        88 f~E~WTH~Pf~A~~D~~G~IyARGaQDMKCVG~QyLEA~R~Lk~~Gi~~~~RTIHlsfVPDEEiGG~~GM~~Fa~--~~e  165 (433)
T TIGR01880        88 FKEKWTHDPFSAFKDEEGNIYARGAQDMKCVGVQYLEAVRNLKASGIFKFKRTIHLSFVPDEEIGGHDGMEKFAK--TEE  165 (433)
T ss_pred             CCCCCCCCCCCCCCCCCCCEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCHHHHHHCCC--CHH
T ss_conf             588888886203557888877315676412658999999999865734788758998328622366121110028--841


Q ss_pred             CCCCCEEEEC-CCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCCCC-----CCC--
Q ss_conf             3212035414-56654343100123222357999999641231000000120134554432011223344-----566--
Q gi|254780782|r  157 GEKWDACIVG-EPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFD-----TGN--  228 (389)
Q Consensus       157 ~~~~d~~i~~-ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~~-----~~~--  228 (389)
                      +.+.++.+.. |+-..-.....+.+|+|..||+.|++.|.+||+|. -.-..|.+.|.+.+..+.+.+..     +.+  
T Consensus       166 Fk~LN~GFalDEG~asP~d~~~VFYaER~pWwv~~~~~G~PGHGs~-l~~NtAmEkL~k~v~~i~~FR~~q~~~L~~nP~  244 (433)
T TIGR01880       166 FKALNLGFALDEGLASPDDEYRVFYAERSPWWVVVKAEGTPGHGSK-LMENTAMEKLEKSVESIRRFRESQFDLLKSNPE  244 (433)
T ss_pred             HHHHCCEEEEECCCCCCCCCEEEEECCCCEEEEEEEEECCCCCCCC-CCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             3641433333067767687412253352337999853048871011-671157899999999999865888999856995


Q ss_pred             -CCCCCEEEEEEEEEECCCC-------------------CCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             -4421014667655420466-------------------65543211665134342067799999999998765324203
Q gi|254780782|r  229 -TTFSPTNMEITTIDVGNPS-------------------KNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVP  288 (389)
Q Consensus       229 -~~~~~~~~~i~~i~~g~~~-------------------~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~  288 (389)
                       ..-.-+|+|++.+++|.+.                   .|+||.++++.+|+|+.|..|.+.++++|.+.+....   .
T Consensus       245 l~~GdVtsvN~~~L~gGv~~Ptvttfffihimyd~~GFVMNv~P~~~~A~fD~Rl~P~vDf~~~e~~L~~w~~~ag---~  321 (433)
T TIGR01880       245 LAIGDVTSVNLTKLKGGVQSPTVTTFFFIHIMYDSKGFVMNVIPSEAEAGFDIRLAPDVDFEEMEKRLAEWCADAG---E  321 (433)
T ss_pred             EEECCEEEEEEEEECCCCCCCHHHEEEEEEEEECCCCEEEECCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHC---C
T ss_conf             2760258883034357346853201334544542763075235663027641037855687999999999987640---8


Q ss_pred             CCCEEEEE--C---CCCC--CCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHH-CCCEEEEEECCCC---C
Q ss_conf             43112322--2---6631--125786789999999999998289957974145435889860-5989999004787---3
Q gi|254780782|r  289 KLSHTVHF--S---SPVS--PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRT---M  357 (389)
Q Consensus       289 ~~~~~i~~--~---~~~~--p~~~~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~~-~iP~v~fGp~~~~---~  357 (389)
                      ++++++..  .   +...  ....+.+||+|.++++|+++.-|...++....|+||+||++. |||+++|.|.+++   +
T Consensus       322 g~t~ef~~kGKlrd~~~~~~~Tp~ddSNPwW~aF~~a~k~~~G~~~~PEIl~~~TDsRyiR~~GvPAlGFSPm~NTP~LL  401 (433)
T TIGR01880       322 GVTYEFEQKGKLRDKLGKPLVTPVDDSNPWWVAFEKAVKEMGGLTLKPEILPASTDSRYIRAVGVPALGFSPMNNTPVLL  401 (433)
T ss_pred             CCEEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCHHHH
T ss_conf             81699950465100267864464569862799999999870781115420126643144752277542677620011344


Q ss_pred             CCCCCEEEHHHHHHHHHHHHH---HHHH
Q ss_conf             687840479999999999999---9998
Q gi|254780782|r  358 HALNENASLQDLEDLTCIYEN---FLQN  382 (389)
Q Consensus       358 H~pdE~i~i~~l~~~~~~~~~---~i~~  382 (389)
                      |..|||+.-+-+++|+++|..   +|-+
T Consensus       402 HDHnEfL~~~vfLrGieiy~~sPl~isa  429 (433)
T TIGR01880       402 HDHNEFLKEAVFLRGIEIYQKSPLLISA  429 (433)
T ss_pred             HHHHHHCCCEEEECCEEEEECCCEEECC
T ss_conf             0010220670552024776317604401


No 38 
>TIGR01887 dipeptidaselike dipeptidase, putative; InterPro: IPR010964   Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site . The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases .   Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins.   Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule.    This entry represents bacterial zinc dipeptidases or probably dipeptidases, belonging to the MEROPS peptidase family M20 (clan MH), subfamily M20A. Many of the members are incorrectly annotated as 'Xaa-His' and 'carnosinase' due to the early miss-characterisation of the Lactobacillus delbrueckii PepV enzyme. The entry includes unassigned peptidases and non-peptidase homologues. ; GO: 0008270 zinc ion binding, 0016805 dipeptidase activity.
Probab=100.00  E-value=0  Score=363.66  Aligned_cols=363  Identities=28%  Similarity=0.367  Sum_probs=258.1

Q ss_pred             HHHHHHHHHHHCCCCCCCCH------------HHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEEC----CCCCE
Q ss_conf             78999999996499978996------------899999999999779848999705888762489999987----99988
Q gi|254780782|r    3 PDCLEHLIQLIKCPSVTPQD------------GGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG----TEAPH   66 (389)
Q Consensus         3 ~e~v~~l~~lv~ips~s~~e------------~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g----~~~~~   66 (389)
                      =++++.|+.||||+|+-..+            ..+.+++-+..++.||+++..+  +. -+.++  ++.+|    .+...
T Consensus         2 D~~~~dL~~li~i~SV~D~~~~~~~~PFG~gp~~AL~~~L~lak~~GF~t~~~~--~P-kG~aG--y~e~GnGan~G~E~   76 (492)
T TIGR01887         2 DEILEDLKELIRIDSVKDDEEPKEGAPFGEGPKKALDKFLELAKKDGFTTENVD--NP-KGYAG--YIEYGNGANQGEEL   76 (492)
T ss_pred             CHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEC--CC-CEEEE--EEECCCCCCCCCCE
T ss_conf             307888888645524021367888848872089999999988764497478707--88-31899--87417883445433


Q ss_pred             EEEECCCCCCCCCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCCEECCC
Q ss_conf             9997336815788877725666422452133236544333201245441000000011-357834999752022011044
Q gi|254780782|r   67 LMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEGPAING  145 (389)
Q Consensus        67 ill~~H~Dtvp~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~~~~~G  145 (389)
                      |.+.+|+||||+|+..+|++|||+++++||||||||++||||+.++.++|++.|++.+ ++.++|.++|..|||+++. .
T Consensus        77 LGILgHlDVVP~GdeagW~~pPF~~~i~dg~iygRG~~DDKGP~~AalYA~K~l~elG~~~kKkiR~I~GTDEEsgw~-c  155 (492)
T TIGR01887        77 LGILGHLDVVPEGDEAGWTSPPFEATIKDGKIYGRGTLDDKGPTIAALYAMKILKELGLKLKKKIRFIFGTDEESGWK-C  155 (492)
T ss_pred             EEEEEEEEECCCCCCCCCCCCCCCCEEECCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCCCC-C
T ss_conf             678787501138876755788752477467189863167802789999999999965879666799998346565870-0


Q ss_pred             CCCCCCCCCCC----CCCCCE---EEECCCC-----------------CCCC--CC-EEEEEE-----------------
Q ss_conf             21111100013----321203---5414566-----------------5434--31-001232-----------------
Q gi|254780782|r  146 TKKMLSWIEKK----GEKWDA---CIVGEPT-----------------CNHI--IG-DTIKIG-----------------  181 (389)
Q Consensus       146 ~~~l~~~~~~~----~~~~d~---~i~~ep~-----------------~~~~--~~-~~i~~g-----------------  181 (389)
                      ..++.+.+...    +-.||+   +|.+|-+                 ....  .. .++..|                 
T Consensus       156 ~~yYf~~~~E~~P~~GF~PDaeFPii~gEKGi~~~~~v~~~iP~~~~~~~~~aa~~l~~fk~G~A~N~VPd~a~A~i~~~  235 (492)
T TIGR01887       156 IDYYFEHLKEEAPDLGFTPDAEFPIIYGEKGIVTLEIVVKKIPFKEKETEGDAAVVLESFKGGEAFNMVPDHATAVISGK  235 (492)
T ss_pred             HHHHHHHCCCCCCCEEECCCCCCCEEEEEECCEEEEEEEEECCCCCCCCCCCCEEEEEEEEECCEECCCCCEEEEEEECC
T ss_conf             78777650588885654368998736411021899998853157789998762369899850630035756148998032


Q ss_pred             -----------------------EEEEEEEEEEEE--EECCCCHHHHCCCCHHHHHHHHHHCCC--C-------------
Q ss_conf             -----------------------223579999996--412310000001201345544320112--2-------------
Q gi|254780782|r  182 -----------------------RRGSLSGEITIH--GKQGHVAYPHLTENPIRGLIPLLHQLT--N-------------  221 (389)
Q Consensus       182 -----------------------~rG~~~~~i~v~--G~~~Hs~~p~~g~nAi~~~~~~i~~l~--~-------------  221 (389)
                                             +.-.-..+|++.  |+++|++.|+.|+||+..++++|.++.  .             
T Consensus       236 ~~l~~~~~~~~~~~~~k~l~~~~e~~~~~~~~~~~vfGk~AHg~~P~~GiNA~~~L~~fL~~~~l~~~~~~f~~F~~Wlt  315 (492)
T TIGR01887       236 KDLEAVEQKFEAFLEAKELEGDFEVEDGTLTITLEVFGKSAHGSAPEKGINAATYLAKFLAELNLAGGAKAFVKFLAWLT  315 (492)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEEEEECCEEEEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHH
T ss_conf             13588998866776438731799872866799999961046535655206899999997546540311114889999999


Q ss_pred             -----------CCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCEEEEECCCCC---CH---HHHHHHHHHHHHHHHHHH
Q ss_conf             -----------3344566442101466765542046665543211665134342---06---779999999999876532
Q gi|254780782|r  222 -----------IGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFN---DL---WNEKTLKEEIRSRLIKGI  284 (389)
Q Consensus       222 -----------~~~~~~~~~~~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~---~~---~~~~~i~~~i~~~l~~~~  284 (389)
                                 +.....++..+..|+|++.|.-...      +...+.+++|++   ..   .++++-++.+...+.+..
T Consensus       316 ~~~~~d~~G~klg~~~~D~~sG~L~~N~G~i~ye~~------~~g~~~ln~RYPvsi~~fef~~~~t~l~~~~trC~~~~  389 (492)
T TIGR01887       316 EYLGEDTYGEKLGIKFHDEVSGELTMNVGVINYENN------EAGKIGLNIRYPVSIVTFEFADPETKLKNLLTRCAKES  389 (492)
T ss_pred             HHHCCCCCCEEEEEEEEECCCCCEECCCEEEEECCC------CCEEEEEEEECCEEEEEEEECCHHHHHHHHHHHHHHCC
T ss_conf             973365352166577422586522102000221146------76079998515257643550576789988764211024


Q ss_pred             ---HHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCC--CCEEEECCCCCHHHHHHHCCCEEEEEE-CC----
Q ss_conf             ---42034311232226631125786789999999999998289--957974145435889860598999900-47----
Q gi|254780782|r  285 ---QNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGN--IPLLSTSGGTSDARFIKDYCPVIEFGL-VG----  354 (389)
Q Consensus       285 ---~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~l~~a~~~~~g~--~~~~~~~gg~~d~~~~~~~iP~v~fGp-~~----  354 (389)
                         .......+..-......|...++|+|+++.|.+.|++.+|.  .......||+|-+|++..   +|.||| ..    
T Consensus       390 g~~~~~~~~~~~fll~~~~~P~YV~kD~plV~TL~~vY~~~TG~ns~~~~~~IGGGTYAR~~~~---gVAFGAl~Fpg~~  466 (492)
T TIGR01887       390 GIVEVIEDYGYLFLLYSDTKPLYVPKDDPLVQTLMKVYKEQTGDNSEGTEVVIGGGTYARLMEN---GVAFGALLFPGEE  466 (492)
T ss_pred             EEEEEEECCEEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCEEEECCCHHHHHCCC---CEEECCCCCCCCC
T ss_conf             0699987150799997378884227987055778999998568888870124654137743587---3573477821088


Q ss_pred             CCCCCCCCEEEHHHHHHHHHHHHHHH
Q ss_conf             87368784047999999999999999
Q gi|254780782|r  355 RTMHALNENASLQDLEDLTCIYENFL  380 (389)
Q Consensus       355 ~~~H~pdE~i~i~~l~~~~~~~~~~i  380 (389)
                      +.+|+.|||+.+++|.+.+++|++.|
T Consensus       467 d~~Hq~nE~~~~~dL~~~~~IYaEAi  492 (492)
T TIGR01887       467 DTMHQKNEYIEIDDLLKATAIYAEAI  492 (492)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHC
T ss_conf             72124345666778889999999709


No 39 
>KOG2275 consensus
Probab=100.00  E-value=0  Score=360.33  Aligned_cols=371  Identities=21%  Similarity=0.297  Sum_probs=288.0

Q ss_pred             HHHHHHHHHHHCCCCCCCC--HH-HHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEECCC--CCEEEEECCCCCCC
Q ss_conf             7899999999649997899--68-9999999999977984899970588876248999998799--98899973368157
Q gi|254780782|r    3 PDCLEHLIQLIKCPSVTPQ--DG-GAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE--APHLMFAGHIDVVP   77 (389)
Q Consensus         3 ~e~v~~l~~lv~ips~s~~--e~-~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g~~--~~~ill~~H~Dtvp   77 (389)
                      ...+..+++++||||+-|+  .. .+++|++.+.+.+|+..+.+...+.   ....++.+.|++  -+.|+|++|+||||
T Consensus        25 ~~~v~~f~eylRi~Tv~p~~dy~~a~~~Fl~~~a~~l~l~~~~i~~~p~---~~~~l~T~~GS~P~L~silL~SH~DVVP  101 (420)
T KOG2275          25 NISVTRFREYLRIPTVQPNPDYTIACADFLKKYAKSLGLTVQKIESEPG---KYVLLYTWLGSDPELPSILLNSHTDVVP  101 (420)
T ss_pred             CHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCC---EEEEEEEEECCCCCCCCEEEECCCCCCC
T ss_conf             3189999988613522348886278999999998864875058885275---3689999527997766336642455358


Q ss_pred             CCCHHHCCCCCCCEEE-ECCCCCCCCCCCCCCHHHHHHHHCCCCCCC-CCCCCCEEEEEEEECCCEECCCCCCCCCCCCC
Q ss_conf             8887772566642245-213323654433320124544100000001-13578349997520220110442111110001
Q gi|254780782|r   78 PGDFNHWTYPPFSATI-AEGKIYGRGIVDMKGSIACFIAAVARFIPK-YKNFGSISLLITGDEEGPAINGTKKMLSWIEK  155 (389)
Q Consensus        78 ~~~~~~W~~~Pf~~~~-~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~-~~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~  155 (389)
                      + ..+.|++|||+... +||.|||||++|||+..+++|.|++.|+.+ .++.++|.+.|++|||.+|..|++.++... +
T Consensus       102 ~-f~e~W~h~Pfsa~~~~~g~IyaRGaqD~K~~~va~leAir~L~~~g~kp~Rti~lsfvpDEEi~G~~Gm~~fa~~~-~  179 (420)
T KOG2275         102 V-FREKWTHPPFSAFKDEDGNIYARGAQDMKCVGVAYLEAIRNLKASGFKPKRTIHLSFVPDEEIGGHIGMKEFAKTE-E  179 (420)
T ss_pred             C-CCCCCCCCCCCCCCCCCCCEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCHHCCCCCHHHHHHHHH-H
T ss_conf             8-7666766986456567886772366500768999999999998658776733899963760115722688875366-6


Q ss_pred             CCCCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCC------C--CCC
Q ss_conf             33212035414566543431001232223579999996412310000001201345544320112233------4--456
Q gi|254780782|r  156 KGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIG------F--DTG  227 (389)
Q Consensus       156 ~~~~~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~------~--~~~  227 (389)
                      .....-+.++.||......-..+++++||.+|++|+++|.+||||.|-. ..|+.++.+++.++.+..      +  ...
T Consensus       180 ~~~l~~~filDEG~~se~d~~~vfyaEkg~w~~~v~~~G~~GHss~~~~-nTa~~~l~klv~~~~~fr~~q~~~l~~~p~  258 (420)
T KOG2275         180 FKKLNLGFILDEGGATENDFATVFYAEKGPWWLKVTANGTPGHSSYPPP-NTAIEKLEKLVESLEEFREKQVDLLASGPK  258 (420)
T ss_pred             HCCCCEEEEECCCCCCCCCCEEEEEEEECEEEEEEEECCCCCCCCCCCC-CCHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             3566626893589887543136788852216899994478987787898-438999999999999868877787604973


Q ss_pred             CCCCCCEEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEC---CCCCCCC
Q ss_conf             6442101466765542046665543211665134342067799999999998765324203431123222---6631125
Q gi|254780782|r  228 NTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFS---SPVSPVF  304 (389)
Q Consensus       228 ~~~~~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~---~~~~p~~  304 (389)
                      -.....+|.|++.|+ |+.+.|++|++.++.+|+|+.+..+.+++.+++.+.+.+...  .+++++....   ..-++..
T Consensus       259 ~~~~~vtT~Nv~~i~-GGv~~N~~P~~~ea~~dirv~~~~d~~~i~~~l~~~w~~~~~--eg~t~~f~~~~~~~~~~~t~  335 (420)
T KOG2275         259 LALGDVTTINVGIIN-GGVQSNVLPETFEAAFDIRVRPHVDVKAIRDQLEDEWAEEAG--EGVTLEFSQKVILDYPPVTP  335 (420)
T ss_pred             EECCCEEEEEEEEEE-CCCCCCCCCHHHEEEEEEEECCCCCHHHHHHHHHHHHHHHCC--CCEEEECCCCCCCCCCCCCC
T ss_conf             110562688643540-551247676543133226731578879999988877654127--73578546765578899987


Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHH-HCCCEEEEEECCC---CCCCCCCEEEHHHHHHHHHHHHHHH
Q ss_conf             78678999999999999828995797414543588986-0598999900478---7368784047999999999999999
Q gi|254780782|r  305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGR---TMHALNENASLQDLEDLTCIYENFL  380 (389)
Q Consensus       305 ~~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~-~~iP~v~fGp~~~---~~H~pdE~i~i~~l~~~~~~~~~~i  380 (389)
                      .+..+|++..+..++++..++ ..+...+|++|.+|++ .++|++.|.|...   ..|..|||+..+.+.+++++|..+|
T Consensus       336 ~~~s~p~w~~~~~a~~~~~~k-~~~~i~~gstdsr~~rn~gvp~~~fsp~~nt~~~~H~hnE~l~~~~~l~gi~~~~~~i  414 (420)
T KOG2275         336 TDDSNPFWTAFAGALKDEGGK-GYPEIGPGSTDSRHIRNEGVPAIGFSPIINTPMLLHDHNEFLNEKVFLRGIEIYYTII  414 (420)
T ss_pred             CCCCCHHHHHHHHHHHHHCCC-CCEEECCCCCCCCHHHHCCCCHHCCCCCCCCCCEECCHHHHHCCHHHHHHHHHHHHHH
T ss_conf             777770899999999971686-1024325654420113227631100222344310001365518412200466899987


Q ss_pred             HHH
Q ss_conf             987
Q gi|254780782|r  381 QNW  383 (389)
Q Consensus       381 ~~~  383 (389)
                      -++
T Consensus       415 ~~~  417 (420)
T KOG2275         415 VNL  417 (420)
T ss_pred             HHH
T ss_conf             751


No 40 
>PRK06156 hypothetical protein; Provisional
Probab=100.00  E-value=0  Score=348.13  Aligned_cols=364  Identities=21%  Similarity=0.244  Sum_probs=268.2

Q ss_pred             HHHHHHHHHHHCCCCCC-----CCH----HHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEEC-CCCCEEEEECC
Q ss_conf             78999999996499978-----996----899999999999779848999705888762489999987-99988999733
Q gi|254780782|r    3 PDCLEHLIQLIKCPSVT-----PQD----GGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG-TEAPHLMFAGH   72 (389)
Q Consensus         3 ~e~v~~l~~lv~ips~s-----~~e----~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g-~~~~~ill~~H   72 (389)
                      +.+++.|++||+|||+.     +++    -+....++...+++||+.+.++      +.+.  .-..| ++...+.+.+|
T Consensus        48 ~~~~~~l~~lv~~~t~~~~~~~~~~~p~~~~~~~~~~~~a~~~g~~~~~~~------~~v~--~i~l~~~~~~~~gi~~H  119 (522)
T PRK06156         48 AAMVESLRELVAFPTVRVEGVTQHENPEFIGFKALLKSLAQDFGLDYRNVD------YRVL--EIGLGGSGKDKVGIITH  119 (522)
T ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEECCC------CEEE--EEECCCCCCEEEEEEEE
T ss_conf             889999997613673324898999890387799999999997197144268------6899--99608988628999951


Q ss_pred             CCCCCCCCHHHC-----CCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCCEECCCC
Q ss_conf             681578887772-----5666422452133236544333201245441000000011-3578349997520220110442
Q gi|254780782|r   73 IDVVPPGDFNHW-----TYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEGPAINGT  146 (389)
Q Consensus        73 ~Dtvp~~~~~~W-----~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~~~~~G~  146 (389)
                      .||||+ +.+.|     ++|||+++++||+|||||+.||||++++.|+|++.+++.+ ++.++|.++|..|||+++. ++
T Consensus       120 ~DV~Pa-~~~~w~~dg~~~DPF~~t~~dgkLYGRGt~DDKGP~iaALYAlK~lKD~gi~L~krIRlI~GtdEEtg~~-~m  197 (522)
T PRK06156        120 ADVVPA-NPELWVLDGTRLDPFKVTLVGDRLYGRGTEDDKGAIVTALYAMKAIKDSGLPLARRIELLVYTTEETDGD-PL  197 (522)
T ss_pred             CCEEEC-CHHHCCCCCCCCCCCEEEEECCEEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCCCH-HH
T ss_conf             221136-8654246788789954698899999748765848999999999999976949997599999667567975-29


Q ss_pred             CCCCCCCC--CCCCCCCE---EEECCCCCC---------------------------CCCCEE--EEE------------
Q ss_conf             11111000--13321203---541456654---------------------------343100--123------------
Q gi|254780782|r  147 KKMLSWIE--KKGEKWDA---CIVGEPTCN---------------------------HIIGDT--IKI------------  180 (389)
Q Consensus       147 ~~l~~~~~--~~~~~~d~---~i~~ep~~~---------------------------~~~~~~--i~~------------  180 (389)
                      +++.+...  ..+-.+|+   ++.+|-+..                           +.++..  ..+            
T Consensus       198 ~~Y~~~e~~P~~gFTPDa~FPvI~aEKG~~~~~~~~~~~~~~~~~~~i~~~~gG~a~N~VP~~A~a~l~~~~~~~~~~~~  277 (522)
T PRK06156        198 KYYLERYTPPDYNITLDAEYPVVTAEKGWGTIMATFPKRAADGKGAEIVAFTGGAFASQIPQQAVATLSGGDPALLAALL  277 (522)
T ss_pred             HHHHHCCCCCCCCCCCCCCCCEEEEEECCEEEEEEECCCCCCCCCCEEEEEECCCCCCCCCCCEEEEEECCCHHHHHHHH
T ss_conf             99984699987020789998648985012379999645567788617999715733466886139999669889999999


Q ss_pred             ------------------EEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCC---------------------
Q ss_conf             ------------------22235799999964123100000012013455443201122---------------------
Q gi|254780782|r  181 ------------------GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTN---------------------  221 (389)
Q Consensus       181 ------------------g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~---------------------  221 (389)
                                        ..+.-..++|+++|+++|||.|+.|+|||..++.++..+.-                     
T Consensus       278 ~~a~~~~~~~~~~~~~~~~~~~g~~v~i~v~GksAHaS~Pe~GvNAi~~L~~~L~~~~~~~~~~~~~~~~~fl~~~~g~d  357 (522)
T PRK06156        278 QKAGAQFGMKYRGDFSIDAKRDGKDVTITVTGKSAHSSTPEDGVNPVTRLADFLQGGGVALPHNHAALAARYINDLVGLD  357 (522)
T ss_pred             HHHHHHHHHHCCCCCEEEEEEECCEEEEEEEEEECCCCCCCCCCCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHCCCC
T ss_conf             98777787750566227999609879999985784668987880799999999985687754324999999999852888


Q ss_pred             -----CCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             -----334456644210146676554204666554321166513434206779999999999876532420343112322
Q gi|254780782|r  222 -----IGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHF  296 (389)
Q Consensus       222 -----~~~~~~~~~~~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~  296 (389)
                           +.....++..++.|+|++.+....       +...+.+|+|++.+.+.+++.+++.+.+.+.... .+++.+++.
T Consensus       358 ~~Ge~lGIa~~De~sG~LT~n~gii~~~~-------~~~~l~iniRyPv~~~~e~l~~~i~~~l~~~~~~-~~~~l~i~~  429 (522)
T PRK06156        358 YLGEKFGVAYKDDFMGPLTLSPTVVKQTD-------KGTEVTVNLRRPVGKTPELLKGEIAEALAKWQAK-HQVTLDIDT  429 (522)
T ss_pred             CCCCCCCCCCCCCCCCCCEEEEEEEEEEC-------CEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHH-CCCEEEEEE
T ss_conf             77675686111688768479868999979-------8899999996889888899999999999987875-283698752


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHCCCEEEEEECC----CCCCCCCCEEEHHHHHHH
Q ss_conf             2663112578678999999999999828995797414543588986059899990047----873687840479999999
Q gi|254780782|r  297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVG----RTMHALNENASLQDLEDL  372 (389)
Q Consensus       297 ~~~~~p~~~~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~~~iP~v~fGp~~----~~~H~pdE~i~i~~l~~~  372 (389)
                      . ...|...++++|+++.|.++|++++|....+..+||+|.++.+..   +|.|||..    .++|++|||+.+++|.+.
T Consensus       430 ~-~~~P~yv~~dsplVqtLl~vY~e~TG~~~kp~siGGGTYAR~~pN---~VAFGp~fPG~~~~~Hq~nE~i~iddL~~~  505 (522)
T PRK06156        430 Y-WGEPMVRDPKGPWLQTLLDVFGHFTGMDPKPVAIAGSTNSKLFPN---ALSFGPAMPGVKYTGHTENEFKTVEQFMLD  505 (522)
T ss_pred             C-CCCCEEECCCCHHHHHHHHHHHHHHCCCCCEEEEECHHHHHCCCC---EEEECCCCCCCCCCCCCCCCCEEHHHHHHH
T ss_conf             2-688644598998999999999998599985478815387603887---076179898898867587647279999999


Q ss_pred             HHHHHHHHHHHCCCCC
Q ss_conf             9999999998724778
Q gi|254780782|r  373 TCIYENFLQNWFITPS  388 (389)
Q Consensus       373 ~~~~~~~i~~~~~~~~  388 (389)
                      +++|++.|.++...|.
T Consensus       506 ~~IYaeAi~eL~~~~~  521 (522)
T PRK06156        506 LQMYTEMFIRLGNLPK  521 (522)
T ss_pred             HHHHHHHHHHHHCCCC
T ss_conf             9999999999856888


No 41 
>KOG2276 consensus
Probab=100.00  E-value=0  Score=354.78  Aligned_cols=382  Identities=21%  Similarity=0.306  Sum_probs=300.1

Q ss_pred             CHHHHHHHHHHHCCCCCCCCHH------HHHHHHHHHHHHCCCEEEEEEECCCCCC------EEEEEEEEECCC--CCEE
Q ss_conf             8789999999964999789968------9999999999977984899970588876------248999998799--9889
Q gi|254780782|r    2 TPDCLEHLIQLIKCPSVTPQDG------GAFFILVNTLKLLGFSIEEKDFQTKNTS------IVKNLYARFGTE--APHL   67 (389)
Q Consensus         2 ~~e~v~~l~~lv~ips~s~~e~------~~~~~l~~~l~~~G~~~~~~~~~~~~~~------~~~~~~~~~g~~--~~~i   67 (389)
                      +.|+++.|++.|+|+|+|....      +.++|++++|+++|-+++..++......      .-+.+.+++|.+  ++++
T Consensus        15 ~de~~~~L~e~v~iqsvs~dp~~r~~v~rm~~~~~~~l~~lG~~~~l~dlg~q~~~~g~~v~lPpvvl~~~Gsdp~Kktv   94 (473)
T KOG2276          15 KDEFINTLREAVAIQSVSADPTKRLEVRRMADWLRDYLTKLGAPLELVDLGYQSLPDGQIVPLPPVVLGVLGSDPSKKTV   94 (473)
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCHHHHHCCCCCCCCCEE
T ss_conf             79999999987351330468420278999999999999972985066324667888883202680011002688875069


Q ss_pred             EEECCCCCCCCCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCC-CCEEEEEEEECCCEECCCC
Q ss_conf             997336815788877725666422452133236544333201245441000000011357-8349997520220110442
Q gi|254780782|r   68 MFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSISLLITGDEEGPAINGT  146 (389)
Q Consensus        68 ll~~H~Dtvp~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~~~-~~i~~~~~~dEE~~~~~G~  146 (389)
                      ++|+|+||||+...++|.+|||+++++||+|||||+.||||++++++.|++++.+.+..+ -+|.++|.+.||.|+. |.
T Consensus        95 lvYgHlDVqpA~~~DgW~TdPF~Lt~~~GkL~GRG~TDdkGPv~~wi~av~a~~~~g~~lpvnv~f~~EgmEEsgS~-~L  173 (473)
T KOG2276          95 LVYGHLDVQPANLEDGWNTDPFTLTEDDGKLFGRGATDDKGPVLSWIHAVKALQQLGIDLPVNVVFVFEGMEESGSE-GL  173 (473)
T ss_pred             EEEEEEEEEECCCCCCCCCCCEEEEEECCEEECCCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEEEEEECHHCCCC-CH
T ss_conf             99745410315788887679848997789986467677776501799999999873855652089999721010674-37


Q ss_pred             CCCCCCCCCC-CCCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEE--ECCCCHH-HHCCCCHHHHHHHHHHCCCCC
Q ss_conf             1111100013-32120354145665434310012322235799999964--1231000-000120134554432011223
Q gi|254780782|r  147 KKMLSWIEKK-GEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHG--KQGHVAY-PHLTENPIRGLIPLLHQLTNI  222 (389)
Q Consensus       147 ~~l~~~~~~~-~~~~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G--~~~Hs~~-p~~g~nAi~~~~~~i~~l~~~  222 (389)
                      ..+++.-.+. +...|++.+.+-.......+-+++|.||+++++++|.|  +..||+. ...-..|+..+..++..|.+.
T Consensus       174 ~~l~~~~kD~~~~~vD~vciSdnyWlg~kkPcltyGlRG~~yf~i~v~g~~~DlHSGvfGG~~hE~m~dL~~~ms~Lv~~  253 (473)
T KOG2276         174 DELIEKEKDKFFKDVDFVCISDNYWLGTKKPCLTYGLRGVIYFQIEVEGPSKDLHSGVFGGVVHEAMNDLVLVMSSLVDI  253 (473)
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCEECCCCCCCCCCCCCCCEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             88999876544236777983076321678752012565524689999614544455544422677899999999876276


Q ss_pred             C---------------------------CC-------CC---------CC----CCCCEEEEEEEEE---ECCCCCCCCC
Q ss_conf             3---------------------------44-------56---------64----4210146676554---2046665543
Q gi|254780782|r  223 G---------------------------FD-------TG---------NT----TFSPTNMEITTID---VGNPSKNVIP  252 (389)
Q Consensus       223 ~---------------------------~~-------~~---------~~----~~~~~~~~i~~i~---~g~~~~NvIP  252 (389)
                      .                           ++       .+         ..    .+..+++.+..|.   .|.+++++||
T Consensus       254 ~~~Ilipgiy~~vaplteeE~~~y~~I~f~~~e~~~~tg~~~l~~~~k~~~l~~rWryPSLsihgIeGaFs~pG~kTVIP  333 (473)
T KOG2276         254 QGRILIPGIYEDVAPLTEEEDSIYDDIDFDVEEFKEATGSQMLPTDDKKRILMHRWRYPSLSIHGIEGAFSGPGAKTVIP  333 (473)
T ss_pred             CCCEECCCHHHHCCCCCHHHHHHHHCCEEEHHHHHCCCCCCCCCCCCHHHHHHHHCCCCCCCEECCCCEEECCCCEEEEE
T ss_conf             77572456132246888678755520002296661146643145676677766502467554104561020788647830


Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             2116651343420677999999999987653242034-311232226631125786789999999999998289957974
Q gi|254780782|r  253 AQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPK-LSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLST  331 (389)
Q Consensus       253 ~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~-~~~~i~~~~~~~p~~~~~~~~l~~~l~~a~~~~~g~~~~~~~  331 (389)
                      .++...|.+|++|.++.+++++.+.+++++...+... -++++...+...||..+++++.+.++.+|++.++|.+|.+..
T Consensus       334 ~kVigkfSiRlVP~md~e~verlv~~yl~~~f~~~nS~N~l~~~~~~~~~~Wv~d~~~~~y~a~krA~~~v~gvePd~~R  413 (473)
T KOG2276         334 AKVVGKFSIRLVPNMDPEQVERLVTRYLEKVFAELNSPNKLKVSMGHAGAPWVSDPDDPHYLALKRAIETVYGVEPDFTR  413 (473)
T ss_pred             HHHEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCEECCCCCHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             23221368995377898999999999999988742799815876347888325589966678888888886177887113


Q ss_pred             CCCCCHH-HHHHH--CCCEEE--EEECCCCCCCCCCEEEHHHHHHHHHHHHHHHHHHC
Q ss_conf             1454358-89860--598999--90047873687840479999999999999999872
Q gi|254780782|r  332 SGGTSDA-RFIKD--YCPVIE--FGLVGRTMHALNENASLQDLEDLTCIYENFLQNWF  384 (389)
Q Consensus       332 ~gg~~d~-~~~~~--~iP~v~--fGp~~~~~H~pdE~i~i~~l~~~~~~~~~~i~~~~  384 (389)
                      .||+... +.++.  +.+++.  +|.+++++|+.||++.+.++.+++++++.++.++-
T Consensus       414 eGgSIPvt~tfQ~~~~~~V~llP~G~~dD~aHsqNEkl~i~N~~~G~k~l~ay~~el~  471 (473)
T KOG2276         414 EGGSIPVTLTFQDITGKSVLLLPYGASDDGAHSQNEKLNITNYVEGTKVLAAYISELA  471 (473)
T ss_pred             CCCCCCEEHHHHHHHCCCEEEECCCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             4785122228889749975882356456510221000017777646999999999974


No 42 
>pfam01546 Peptidase_M20 Peptidase family M20/M25/M40. This family includes a range of zinc metallopeptidases belonging to several families in the peptidase classification. Family M20 are Glutamate carboxypeptidases. Peptidase family M25 contains X-His dipeptidases.
Probab=100.00  E-value=0  Score=356.63  Aligned_cols=305  Identities=30%  Similarity=0.378  Sum_probs=233.7

Q ss_pred             EEECCCCCCCCCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCEECCCCC
Q ss_conf             99733681578887772566642245213323654433320124544100000001135783499975202201104421
Q gi|254780782|r   68 MFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTK  147 (389)
Q Consensus        68 ll~~H~Dtvp~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~~~~~i~~~~~~dEE~~~~~G~~  147 (389)
                      +|+|||||||+++ ++|++|||+++++||+|||||+.||||+++++++|++.|.+..+++++|.|+|++|||+++..|++
T Consensus         1 ll~gH~DvVp~~~-~~w~~~pf~~~~~dg~l~GrG~~D~Kg~~a~~l~al~~l~~~~~~~~~i~~~~~~dEE~g~~~G~~   79 (310)
T pfam01546         1 LLRGHMDVVPIGE-TGWTHPPFSWTIEDGKMYGRGHDDMKGGLLAALEALRALKAGGKLKGTVKLLFQPDEEGGGFEGAR   79 (310)
T ss_pred             CCCCCCCCCCCCC-CCCCCCCCCCEEECCEEEECHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECHHHCCCCCCHH
T ss_conf             9543507279998-877579985299899999382787279999999999999865999860899985112226754589


Q ss_pred             CCCCCCCCCCCCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCCCCCC
Q ss_conf             11110001332120354145665434310012322235799999964123100000012013455443201122334456
Q gi|254780782|r  148 KMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTG  227 (389)
Q Consensus       148 ~l~~~~~~~~~~~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~~~~  227 (389)
                      ++++.....+..+|+++++||+...     +++++||..+++++++|+++|++.|+.+.|++..++.++..+........
T Consensus        80 ~l~~~~~~~~~~~~~~~~~e~~~~~-----~~~~~~G~~~~~i~v~G~~~H~s~~~~g~~a~~~~~~~~~~~~~~~~~~~  154 (310)
T pfam01546        80 ALIEDGAIFGLHPDQGVVGEPTGLP-----GGTGIRGSLWLFLTVIGGAGHHGSPPHGGNAIALAAAALILLLQLIVSRG  154 (310)
T ss_pred             HHHHCCHHHCCCCCCCEECCCCCCC-----CCCEEEEEEEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHC
T ss_conf             9986534418886710324744565-----30015502679999990775556786665479999999999875544304


Q ss_pred             CCCCCCEEEEEEEEEECCC-CCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCC
Q ss_conf             6442101466765542046-665543211665134342067799999999998765324203431123222663112578
Q gi|254780782|r  228 NTTFSPTNMEITTIDVGNP-SKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLT  306 (389)
Q Consensus       228 ~~~~~~~~~~i~~i~~g~~-~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~  306 (389)
                      .........+++.+..+++ ..|++|..+.+..++|..+.... ...+.+...+.+............  ....++....
T Consensus       155 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~  231 (310)
T pfam01546       155 VDPLDPAVVGIGTVGGGGGSNNNVIPEAAFLRGRRRTLDEELR-ALVEEEEEAIAAGAAAAGVVEEEE--DYRPPYPVTV  231 (310)
T ss_pred             CCCCCCCEEEEEEEEEECCCCCCCCCCEEEEEEEEECCCCCHH-HHHHHHHHHHHHHCCCCCEEEEEE--ECCCCCCCCC
T ss_conf             5777886799834468536423446631499989936982179-999999999986255446179998--4034687767


Q ss_pred             CHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHH---CCCEEEEEECCC-CCCCCCCEEEHHHHHHHHHHHHHHHHH
Q ss_conf             6789999999999998289957974145435889860---598999900478-736878404799999999999999998
Q gi|254780782|r  307 HDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD---YCPVIEFGLVGR-TMHALNENASLQDLEDLTCIYENFLQN  382 (389)
Q Consensus       307 ~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~~---~iP~v~fGp~~~-~~H~pdE~i~i~~l~~~~~~~~~~i~~  382 (389)
                      .+.++++.+.++++++. ..+.+..++|++|++|++.   ++|++.|||++. ++|+||||++++++.+++++|+++|++
T Consensus       232 ~~~~~~~~l~~~~~~~~-~~~~~~~~~ggtD~~~~~~~~~~~~~v~~Gpg~~~~~H~~~E~i~i~~l~~~~~i~~~li~~  310 (310)
T pfam01546       232 NDPALVAALEEAAKELG-LGPEPEPSGGGEDAAFFAEVGLGIPMLGFGPGDGALAHSPNEYVDLDDLEKGAKVLARLLEE  310 (310)
T ss_pred             CCHHHHHHHHHHHHHHC-CCCCCEEEEEECHHHHHHHHCCCCEEEEECCCCCCCCCCCCCEEEHHHHHHHHHHHHHHHCC
T ss_conf             99899999999999967-99851687443589999976899639998999942368989588899999999999999569


No 43 
>TIGR01902 dapE-lys-deAc N-acetyl-ornithine/N-acetyl-lysine deacetylase; InterPro: IPR010175   This clade of mainly archaeal and related bacterial species contains two characterised enzymes, an deacetylase with specificity for both N-acetyl-ornithine and N-acetyl-lysine from Thermus  which is found within a lysine biosynthesis operon, and a fusion protein with acetyl-glutamate kinase (an enzyme of ornithine biosynthesis) from Lactobacillus. It is possible that all of the sequences within this clade have dual specificity, or that a mix of specificities have evolved within this clade.; GO: 0008270 zinc ion binding, 0016811 hydrolase activity acting on carbon-nitrogen (but not peptide) bonds in linear amides, 0050897 cobalt ion binding, 0009085 lysine biosynthetic process, 0005737 cytoplasm.
Probab=100.00  E-value=0  Score=329.67  Aligned_cols=346  Identities=22%  Similarity=0.285  Sum_probs=279.2

Q ss_pred             HHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEECCCCCEEEEECCCCCCCCCCHHHCCC
Q ss_conf             99999964999789968999999999997798489997058887624899999879998899973368157888777256
Q gi|254780782|r    7 EHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDVVPPGDFNHWTY   86 (389)
Q Consensus         7 ~~l~~lv~ips~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g~~~~~ill~~H~Dtvp~~~~~~W~~   86 (389)
                      ++|++++.|||+|.+|..++.|+++.++++|++.+.+|       ...|++...|.+.+.|||.||+||||-    .   
T Consensus         1 ~lL~~~l~IyspS~~E~~~a~fl~~~~~~~g~k~e~iD-------~~~n~~l~~g~g~~~ilL~gHvDTV~g----y---   66 (352)
T TIGR01902         1 ELLKDLLEIYSPSGKEEEAAKFLEELKKELGLKAEFID-------EAGNVILKKGDGGKKILLLGHVDTVPG----Y---   66 (352)
T ss_pred             CCHHCCEECCCCCCCHHHHHHHHHHHHHHHCCCEEECC-------CCCCEEEEECCCCCEEEEEEEECCCCC----C---
T ss_conf             90243754379871189999999999997088341046-------747478421688516998321211388----0---


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCEECCCCCCCCCCCCCCCCCCCEE--E
Q ss_conf             66422452133236544333201245441000000011357834999752022011044211111000133212035--4
Q gi|254780782|r   87 PPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDAC--I  164 (389)
Q Consensus        87 ~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~~~~~~d~~--i  164 (389)
                        |.+.+|+|.|||||+.|.||++++||.|+.-|........+|.|+--.|||+.+.-|++.+++..    ....++  |
T Consensus        67 --i~vkiE~~~L~GRGAVDAKGPl~a~l~a~~~L~~~~~~~~~v~~~Gl~dEEs~~SkGA~~~~~~~----~~~kyvyii  140 (352)
T TIGR01902        67 --IPVKIEGGLLYGRGAVDAKGPLVAMLFALVLLKVKVEKDIKVIVVGLVDEESSSSKGAREVLDKL----KPEKYVYII  140 (352)
T ss_pred             --CCCEECCCCEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEEECCCCCCHHHHHHHHCC----CCCCEEEEE
T ss_conf             --34178164100243302226799999999751312357867999976504676546689886202----688716999


Q ss_pred             ECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCCCCCCC-CCCCCEEEEEEEEEE
Q ss_conf             1456654343100123222357999999641231000000120134554432011223344566-442101466765542
Q gi|254780782|r  165 VGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGN-TTFSPTNMEITTIDV  243 (389)
Q Consensus       165 ~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~~~~~-~~~~~~~~~i~~i~~  243 (389)
                      +|||++..    .|++|.||.+.+++..++...|||. +.+++|++.+.+...+++..-.+..+ ..+++..+.-+-+..
T Consensus       141 vGEPSg~~----~it~gY~G~L~l~~~~~~~~~HSa~-~~~~saa~~Li~~~~~I~~~~~~~~nvGq~~~~~~~~~i~~~  215 (352)
T TIGR01902       141 VGEPSGVE----GITLGYKGSLKLKLVCEVEKFHSAS-KGAISAAEKLIDYSKKIKEEYKEAYNVGQYDKDKVVSTIIDF  215 (352)
T ss_pred             EECCCCCC----CEEEEEECEEEEEEEEECCCCCCCC-CCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEE
T ss_conf             84667986----1376330228998775037577665-522468999999999989977232467876776663235552


Q ss_pred             CCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             04666554321166513434206779999999999876532420343112322266311257867899999999999982
Q gi|254780782|r  244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTT  323 (389)
Q Consensus       244 g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~l~~a~~~~~  323 (389)
                       ..+.+..+....+.||+|.++....+++.+.+.++        ...+..+++....+|+..+.++|++.++.++++++.
T Consensus       216 -~~~~~~~~~~~~l~~~~r~~~~~~~eeaik~~tay--------~~~~i~Le~~~~~pa~~~~~~~pl~~af~~a~~~~~  286 (352)
T TIGR01902       216 -SESKSDLEAKLELIFDLRLPPKLKPEEAIKELTAY--------DKKNISLEILDETPAYKVKRSNPLVRAFVRAIRKVG  286 (352)
T ss_pred             -ECCHHHHCEEEEEEEEEECCCCCCCCCCCCCCCCC--------CCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHC
T ss_conf             -01500001356778875306898842122001235--------899613884155488434576677999999999834


Q ss_pred             CCCCEEEECCCCCHHHHHHH--CCCEEEEEECCCCC-CCCCCEEEHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             89957974145435889860--59899990047873-68784047999999999999999987247
Q gi|254780782|r  324 GNIPLLSTSGGTSDARFIKD--YCPVIEFGLVGRTM-HALNENASLQDLEDLTCIYENFLQNWFIT  386 (389)
Q Consensus       324 g~~~~~~~~gg~~d~~~~~~--~iP~v~fGp~~~~~-H~pdE~i~i~~l~~~~~~~~~~i~~~~~~  386 (389)
                      -..|.+....||+|||.++.  .+|++.||||++.. |++-|.|++++|..++++|-..|+.|.++
T Consensus       287 k~~P~l~~K~GTSDMNiLa~~~~v~~vaYGPGdS~LdHT~~E~v~l~ey~~Gi~~l~~al~~l~~k  352 (352)
T TIGR01902       287 KMKPKLKKKTGTSDMNILAPRWTVPMVAYGPGDSTLDHTPYEKVSLAEYLLGIEVLKEALEELLQK  352 (352)
T ss_pred             CCCCEEEEECCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCEEEHHHHHHHHHHHHHHHHHHHCC
T ss_conf             777458871177641004645686737758778855775642220888875699999999997269


No 44 
>PRK13381 peptidase T; Provisional
Probab=100.00  E-value=0  Score=320.11  Aligned_cols=357  Identities=18%  Similarity=0.124  Sum_probs=274.5

Q ss_pred             CCHHHHHHHHHHHCCCCCCCCHH----------HHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEE-CC--CCCEE
Q ss_conf             98789999999964999789968----------9999999999977984899970588876248999998-79--99889
Q gi|254780782|r    1 MTPDCLEHLIQLIKCPSVTPQDG----------GAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF-GT--EAPHL   67 (389)
Q Consensus         1 l~~e~v~~l~~lv~ips~s~~e~----------~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~-g~--~~~~i   67 (389)
                      |++.+++.|.+||+|+|.|..+.          ..+++|++.|+++|++.-..  .     .-++++|+. ++  +.|+|
T Consensus         5 ~~erl~~rFl~yv~Ids~S~~~~~~~Pst~~q~~la~~L~~eL~~lGl~~v~~--d-----~~g~v~a~lp~n~~~~p~i   77 (413)
T PRK13381          5 LSEQLVERFFRYLKVNTQSDAASGTLPSTPGQVELAKLLAKELRELGLEDIVI--D-----EHAIVTARLPGNTPNAPRI   77 (413)
T ss_pred             HHHHHHHHHHHHEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEE--C-----CCEEEEEEECCCCCCCCEE
T ss_conf             79999999886488746778878879898779999999999999769936886--6-----9759999951678999989


Q ss_pred             EEECCCCCCCCCCHHHCCCCCC---------------------------CEEEECCCCCCCCC----CCCCCHHHHHHHH
Q ss_conf             9973368157888777256664---------------------------22452133236544----3332012454410
Q gi|254780782|r   68 MFAGHIDVVPPGDFNHWTYPPF---------------------------SATIAEGKIYGRGI----VDMKGSIACFIAA  116 (389)
Q Consensus        68 ll~~H~Dtvp~~~~~~W~~~Pf---------------------------~~~~~~g~l~GrG~----~D~Kg~ia~~l~a  116 (389)
                      +|.+||||||++...+  -.|-                           +..+.++.|...|+    +|||+|||++|+|
T Consensus        78 ~f~aHmDT~~~~~g~~--vkP~i~~y~G~di~l~~~~~~~l~~~~~p~l~~~~g~~iI~SDGtTlLGADDKAGIA~Ilea  155 (413)
T PRK13381         78 GFIAHLDTVDVGLSPD--IHPQVLRYTGGDLCLNAEQGIVLRTAEHPELLRYQGETIIFSDGTSVLGADNKAAIAVIMTL  155 (413)
T ss_pred             EEEEECCCCCCCCCCC--CCCEEEEECCCEEECCCCCCEEECHHHCHHHHHHCCCCEEECCCCCCCCCCCHHHHHHHHHH
T ss_conf             9998657798778998--66649610695233267677477656481578616997897899713332028899999999


Q ss_pred             CCCCCCCC-CCCCCEEEEEEEECCCEECCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEE
Q ss_conf             00000011-35783499975202201104421111100013321203541456654343100123222357999999641
Q gi|254780782|r  117 VARFIPKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGK  195 (389)
Q Consensus       117 ~~~l~~~~-~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~~~~~~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~  195 (389)
                      ++.|+++. .+|++|.++|++|||.| ..|++++--  .  ....+++++.+.+..   + .+.+...+...++++++|+
T Consensus       156 ~~~L~e~~~i~Hg~I~i~FT~dEEiG-L~Gak~~D~--~--~~~a~~aytlD~g~~---G-~i~~e~~~a~~~~i~I~G~  226 (413)
T PRK13381        156 LEYLTAHPEVEHGDIVVAFVPDEEIG-LRGAKALDL--A--RFPVDFAYTLDCCEL---G-EFVYENFNAASAEITITGV  226 (413)
T ss_pred             HHHHHHCCCCCCCCEEEEEECCHHHH-HHHHHHCCH--H--HCCCCEEEEECCCCC---C-EEEEECCCCCEEEEEEEEE
T ss_conf             99998779999988899995055653-021444798--7--869888999508987---6-5898268741599999976


Q ss_pred             CCCCHH-HHCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             231000-0001201345544320112233445664421014667655420466655432116651343420677999999
Q gi|254780782|r  196 QGHVAY-PHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKE  274 (389)
Q Consensus       196 ~~Hs~~-p~~g~nAi~~~~~~i~~l~~~~~~~~~~~~~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~  274 (389)
                      ++|++. |+.|+|||..++++++.|.....+.      .++.+.|.++.++...|  +++|++.+.+|..+.+..+...+
T Consensus       227 ~aHaG~a~e~giNAi~iA~~~i~~lp~~r~pe------~T~~~~G~i~~~~~~g~--v~~~~~~~eiRs~d~~k~~~~~~  298 (413)
T PRK13381        227 SAHPMSAKGVLVNPILLANDFISAFPRQETPE------HTEGREGYFWVKDLTGN--VDKAKLKIIIRDFDWDSFEARKA  298 (413)
T ss_pred             ECCCCCCHHHHHHHHHHHHHHHHHCCCCCCCC------CCCCCCCEEEECCCCCC--EEHEEEEEEEEECCHHHHHHHHH
T ss_conf             46987674456629999999997589767877------63214255873151124--30579999987688899999999


Q ss_pred             HHHHHHHHHHHHHCCCCEEEEECCCCCC--CCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHH-HCCCEEEEE
Q ss_conf             9999876532420343112322266311--2578678999999999999828995797414543588986-059899990
Q gi|254780782|r  275 EIRSRLIKGIQNVPKLSHTVHFSSPVSP--VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFG  351 (389)
Q Consensus       275 ~i~~~l~~~~~~~~~~~~~i~~~~~~~p--~~~~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~-~~iP~v~fG  351 (389)
                      .+++.+.+..+......++++....|..  ...+.+.++++.+.+|+++ .|..|....++|++|++++. .|+||+.+|
T Consensus       299 ~~~~~~~~~~~~~~~~~v~~~~~~~Y~n~~~~l~~~~~vv~~a~~A~~~-~Gi~p~~~~~rGGtDgn~ls~~Gipt~nl~  377 (413)
T PRK13381        299 FIEEVVAKLNAKYGTARVSLSLTDQYSNISNSIKEDPRPVDLALDAYKE-LGIEPKVIPMRGGTDGAALSAKGLPTPNLF  377 (413)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEEEEEEHHHHHHCCCCCHHHHHHHHHHHH-CCCCEEEEECCCCCHHHHHHHCCCCCCEEC
T ss_conf             9999999999877997799999986130453246884899999999997-599827874588418999872899875785


Q ss_pred             ECCCCCCCCCCEEEHHHHHHHHHHHHHHHHHHC
Q ss_conf             047873687840479999999999999999872
Q gi|254780782|r  352 LVGRTMHALNENASLQDLEDLTCIYENFLQNWF  384 (389)
Q Consensus       352 p~~~~~H~pdE~i~i~~l~~~~~~~~~~i~~~~  384 (389)
                      .|..++|+++||+.++++.+.++++.++++.|-
T Consensus       378 tG~~n~Ht~~E~i~i~~m~ka~evv~~ii~~~a  410 (413)
T PRK13381        378 TGAHNFHSRFEFLPVSSFVKSYEVTKTICLLAA  410 (413)
T ss_pred             CCCCCCCCCCEEEEHHHHHHHHHHHHHHHHHHH
T ss_conf             354577675516699999999999999999985


No 45 
>TIGR01883 PepT-like peptidase T-like protein; InterPro: IPR010162   Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site . The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases .   Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins.   Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule.    This entry represents metallopeptidases belonging to MEROPS peptidase family M20 (clan MH), subfamily M20B. They are tripeptide aminopeptidases, commonly referred to as peptidase T, which have a substrate preference for hydrophobic peptides. .
Probab=100.00  E-value=0  Score=331.70  Aligned_cols=352  Identities=20%  Similarity=0.259  Sum_probs=296.5

Q ss_pred             HHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEECC-C--CCEEEEECCCCCCCCCCH
Q ss_conf             9999999964999789968999999999997798489997058887624899999879-9--988999733681578887
Q gi|254780782|r    5 CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT-E--APHLMFAGHIDVVPPGDF   81 (389)
Q Consensus         5 ~v~~l~~lv~ips~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g~-~--~~~ill~~H~Dtvp~~~~   81 (389)
                      ++++|.+||+|||.|++|+.++.+|++.|.+||++++..++.+..+..-.||++|+.. .  -++|+|.+||||||++..
T Consensus         2 l~~~FleLiQIdS~sg~Ek~i~~~lk~q~~~Lg~~v~~d~~~~e~G~~~~nLiarl~gtt~~~dtI~F~~H~DTv~pg~g   81 (363)
T TIGR01883         2 LVEEFLELIQIDSESGKEKKILKVLKKQLTELGIDVKKDDVMDEVGSNDNNLIARLKGTTVKFDTIFFSGHMDTVKPGAG   81 (363)
T ss_pred             CHHHHHHEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCHHHCCCCCCCEEEEECCEECCCEEEEECCCCCCCCCCC
T ss_conf             00230100413788742789999999975442850012674021046898515862032213770488213254789888


Q ss_pred             HHCCCCCCCEEEECCCCCCCCC----CCCCCHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCEECCCCCCCCCCCCCCC
Q ss_conf             7725666422452133236544----333201245441000000011357834999752022011044211111000133
Q gi|254780782|r   82 NHWTYPPFSATIAEGKIYGRGI----VDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKG  157 (389)
Q Consensus        82 ~~W~~~Pf~~~~~~g~l~GrG~----~D~Kg~ia~~l~a~~~l~~~~~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~~~  157 (389)
                             -+|+++||.+...|.    +|||+++|+||+|++.|.++..+|+.|.|+|+..||.|. -|+++|-.    ..
T Consensus        82 -------~epvvEdGi~~s~g~TiLGaDDKag~AAmleA~~vl~~e~~~Hg~IEfifTv~EE~Gl-iG~~~fd~----~k  149 (363)
T TIGR01883        82 -------VEPVVEDGIVKSKGGTILGADDKAGVAAMLEAVKVLKEEETEHGTIEFIFTVKEELGL-IGAKLFDE----EK  149 (363)
T ss_pred             -------CCCEEECCEEEECCCEECCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCCC-HHHHHCCH----HH
T ss_conf             -------7506606578707854205511889999999999864137687618999970433411-21122671----12


Q ss_pred             CCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCCHH-HHCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCEEE
Q ss_conf             21203541456654343100123222357999999641231000-00012013455443201122334456644210146
Q gi|254780782|r  158 EKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAY-PHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNM  236 (389)
Q Consensus       158 ~~~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~-p~~g~nAi~~~~~~i~~l~~~~~~~~~~~~~~~~~  236 (389)
                      .+..+.++.+.+  ..+| .+..+.-+...++.++.|+.+|+|. |+.|++||..++.+|.+++-.+.|..      +++
T Consensus       150 itA~ygy~LD~~--G~vG-ni~~aApt~~kv~a~I~gk~A~aG~~PE~GiSaI~vA~~Ai~~~~lgRIDeE------tta  220 (363)
T TIGR01883       150 ITAAYGYVLDAD--GEVG-NIVLAAPTQVKVDATIAGKDAHAGLVPEDGISAISVAAKAISKMRLGRIDEE------TTA  220 (363)
T ss_pred             HHHHHCEEECCC--CCEE-EEEECCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCC------CCC
T ss_conf             112111165286--8622-0687187102544553178665576667676889999999862889775541------320


Q ss_pred             EEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHH
Q ss_conf             67655420466655432116651343420677999999999987653242034311232226631125786789999999
Q gi|254780782|r  237 EITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLS  316 (389)
Q Consensus       237 ~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~l~  316 (389)
                      ||+.++ ||.+.|++-++......-|.......+.-...+++..++.+++ .|.+.+++...-|+.+-..+++++++.++
T Consensus       221 nIg~f~-GG~~tniv~de~~ivaearsl~~~K~ea~vQ~~~e~Fe~aaek-~Gat~e~e~~~~Y~gfK~~~~~~~~~i~k  298 (363)
T TIGR01883       221 NIGSFE-GGVNTNIVQDELKIVAEARSLSDRKLEAQVQKMRERFEQAAEK-YGATVEVETRLIYEGFKLEEDDALVEIIK  298 (363)
T ss_pred             CCEEEE-CCCCCHHCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHH-CCCEEEEHHHHHCCCCCCCCCCHHHHHHH
T ss_conf             000332-8724000250899999874036200115777899999999986-08825431222211025488867999999


Q ss_pred             HHHHHHHCCCCEEEECCCCCHHHHHH-HCCCEEEEEECCCCCCCCCCEEEHHHHHHHHHHHHHHH
Q ss_conf             99999828995797414543588986-05989999004787368784047999999999999999
Q gi|254780782|r  317 KSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMHALNENASLQDLEDLTCIYENFL  380 (389)
Q Consensus       317 ~a~~~~~g~~~~~~~~gg~~d~~~~~-~~iP~v~fGp~~~~~H~pdE~i~i~~l~~~~~~~~~~i  380 (389)
                      +|+++. |.++....++|++|+|.+. +|+||+.+..|...+|+.+|+++|++|.|.+++...++
T Consensus       299 kaa~k~-g~~~~~~~sgGGsDANv~n~kG~pTv~Ls~Gy~~~Ht~~E~i~ie~lvK~ae~V~a~~  362 (363)
T TIGR01883       299 KAAKKI-GLKTEEKLSGGGSDANVLNEKGVPTVNLSAGYVKVHTEKEKISIEELVKLAELVVALA  362 (363)
T ss_pred             HHHHHH-CCCCHHHHCCCCCCHHHHHCCCCCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHC
T ss_conf             999861-7770033137874067651477323547531452225567224899998999998741


No 46 
>PRK05469 peptidase T; Provisional
Probab=100.00  E-value=0  Score=311.00  Aligned_cols=350  Identities=18%  Similarity=0.128  Sum_probs=261.3

Q ss_pred             HHHHHHHHHHHCCCCCCC----------CHHHHHHHHHHHHHHCCCE-EEEEEECCCCCCEEEEEEEEEC----CCCCEE
Q ss_conf             789999999964999789----------9689999999999977984-8999705888762489999987----999889
Q gi|254780782|r    3 PDCLEHLIQLIKCPSVTP----------QDGGAFFILVNTLKLLGFS-IEEKDFQTKNTSIVKNLYARFG----TEAPHL   67 (389)
Q Consensus         3 ~e~v~~l~~lv~ips~s~----------~e~~~~~~l~~~l~~~G~~-~~~~~~~~~~~~~~~~~~~~~g----~~~~~i   67 (389)
                      ..+++.|.+||+|+|.|.          .+...+++|++.|+++|++ ++..        .-+++++++.    .+.|+|
T Consensus         2 erl~~rFl~yv~Ids~S~~~~~~~PSt~~q~~la~~L~~eL~~lG~~dv~~d--------~~g~v~a~lp~n~~~~~p~i   73 (405)
T PRK05469          2 DKLLERFLRYVKIDTQSDENSTTVPSTEGQWDLAKLLVEELKELGLSDVTLD--------ENGYVMATLPANTDKDVPTI   73 (405)
T ss_pred             HHHHHHHHHHEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEC--------CCCEEEEEECCCCCCCCCEE
T ss_conf             2788998875887155688777798987899999999999997699658777--------98389999547778899869


Q ss_pred             EEECCCCCCCCCCHHHCCCCCCCEEEE--C---------------------------CCCCCCCC----CCCCCHHHHHH
Q ss_conf             997336815788877725666422452--1---------------------------33236544----33320124544
Q gi|254780782|r   68 MFAGHIDVVPPGDFNHWTYPPFSATIA--E---------------------------GKIYGRGI----VDMKGSIACFI  114 (389)
Q Consensus        68 ll~~H~Dtvp~~~~~~W~~~Pf~~~~~--~---------------------------g~l~GrG~----~D~Kg~ia~~l  114 (389)
                      +|.+||||||+++..+  -.|-  +++  |                           +.|...|+    +|||+|||++|
T Consensus        74 ~f~AHmDTv~~~~g~~--v~P~--v~~nYdG~di~l~~~~~~l~~~~~P~L~~~~G~~iI~sdGtTlLGADDKAGIA~Im  149 (405)
T PRK05469         74 GFIAHMDTAPDFSGKN--VKPQ--IIENYDGGDIALGIGNEVLSPAEFPELKNYIGQTLITTDGTTLLGADDKAGIAEIM  149 (405)
T ss_pred             EEEEECCCCCCCCCCC--CCCE--EEECCCCCCEEECCCCCEECHHHCCHHHHHCCCCEEECCCCCCCCCCCHHHHHHHH
T ss_conf             9998615678889998--6786--97367887234068870765564813676159857967997112343388999999


Q ss_pred             HHCCCCCCCC-CCCCCEEEEEEEECCCEECCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEE
Q ss_conf             1000000011-357834999752022011044211111000133212035414566543431001232223579999996
Q gi|254780782|r  115 AAVARFIPKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIH  193 (389)
Q Consensus       115 ~a~~~l~~~~-~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~~~~~~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~  193 (389)
                      ++++.|+++. .+|++|.++|++|||.| . |++++--  .+  ...++++..+.+...    .+.+..-....++++++
T Consensus       150 e~~~~L~e~~~ipHg~I~i~FT~~EEiG-~-Gak~~D~--~~--~~a~~aytlDgg~~G----~i~~e~f~a~~~~i~i~  219 (405)
T PRK05469        150 TALEYLIAHPEIKHGDIRVAFTPDEEIG-R-GADKFDV--EK--FGADFAYTVDGGPLG----ELEYENFNAASAKITIT  219 (405)
T ss_pred             HHHHHHHHCCCCCCCCEEEEEECCHHHC-C-CHHHCCH--HH--CCCCEEEECCCCCCC----EEEEECCCCCEEEEEEE
T ss_conf             9999998689998888899993252315-6-7334798--78--498789990389776----58982587642799999


Q ss_pred             EECCCCHH-HHCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHH
Q ss_conf             41231000-00012013455443201122334456644210146676554204666554321166513434206779999
Q gi|254780782|r  194 GKQGHVAY-PHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTL  272 (389)
Q Consensus       194 G~~~Hs~~-p~~g~nAi~~~~~~i~~l~~~~~~~~~~~~~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i  272 (389)
                      |+++|++. |++|+|||..+++++..|.....++.+.      -+.|.++.+.-..+  .++|++.+.+|..+.+..+..
T Consensus       220 G~~aHaG~ape~ginAi~iAa~~i~~lp~~~~pE~T~------g~~Gf~~~~~~~G~--~~~~~~~~~iRs~d~~kl~~~  291 (405)
T PRK05469        220 GVNVHPGTAKGKMVNALLLAADFHAMLPADETPETTE------GYEGFYHLTSMKGT--VEEAELSYIIRDFDREGFEAR  291 (405)
T ss_pred             EEECCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCC------CCCCEEEEECCEEE--EEEEEEEEEECCCCHHHHHHH
T ss_conf             7754887773213779999999997389878975454------53544666430400--446999999826789999999


Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEEECCCCCCC--CCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHH-HCCCEEE
Q ss_conf             9999998765324203431123222663112--578678999999999999828995797414543588986-0598999
Q gi|254780782|r  273 KEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV--FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIE  349 (389)
Q Consensus       273 ~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~--~~~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~-~~iP~v~  349 (389)
                      .+.+++.+++...+....+++++....|+..  ..+++.++++.+.+|+++ .|..|....++|++|++++. .|+||+.
T Consensus       292 ~~~m~~~~~~~~~~~g~~~v~~ev~~~Y~nm~~~l~~~~~vV~~a~~A~~~-~Gl~p~~~~~rGGtDgn~l~~~Gipt~n  370 (405)
T PRK05469        292 KALMQEIAKKVNAKYGEGRVELEIKDQYYNMREKIEPHPHIVDLAKQAMED-LGIEPIIKPIRGGTDGSQLSFMGLPCPN  370 (405)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEEEECHHHHHCCCCCHHHHHHHHHHHHH-CCCCEEEEECCCCCHHHHHHCCCCCCCE
T ss_conf             999999999999876996799998050131553036781999999999997-5998588646887188898608998626


Q ss_pred             EEECCCCCCCCCCEEEHHHHHHHHHHHHHHHHHH
Q ss_conf             9004787368784047999999999999999987
Q gi|254780782|r  350 FGLVGRTMHALNENASLQDLEDLTCIYENFLQNW  383 (389)
Q Consensus       350 fGp~~~~~H~pdE~i~i~~l~~~~~~~~~~i~~~  383 (389)
                      +|.|..++|+.+||++++++.+.++++.++++.|
T Consensus       371 L~tG~~n~Ht~~E~i~v~~m~ka~evvl~ii~l~  404 (405)
T PRK05469        371 IFTGGENFHGRYEFVSLESMEKAVDVIVKIAELT  404 (405)
T ss_pred             ECCCCCCCCCCCEEEEHHHHHHHHHHHHHHHHHH
T ss_conf             8437636767561569999999999999999964


No 47 
>TIGR01886 dipeptidase dipeptidase PepV; InterPro: IPR011291   Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site . The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases .   Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins.   Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule.    This entry represents a small clade of dipeptidase enzymes from the Lactobacillaceae, which belong to MEROPS peptidase family M20A. The Lactococcus lactis enzyme has been shown to act on a wide range of dipeptides, but not larger peptides. The enzyme from Lactobacillus delbrueckii was originally characterised as a Xaa-His dipeptidase, specifically a carnosinase (beta-Ala-His) by complementation of an Escherichia coli mutant. Further study, including the crystallisation of the enzyme , has shown it to also be a non-specific dipeptidase. This group also includes enzymes from Streptococcus and Enterococcus..
Probab=100.00  E-value=0  Score=306.92  Aligned_cols=351  Identities=23%  Similarity=0.308  Sum_probs=255.2

Q ss_pred             HHHHHHHHHHHCCCCCCCCHH------------HHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEE--ECCCC----
Q ss_conf             789999999964999789968------------999999999997798489997058887624899999--87999----
Q gi|254780782|r    3 PDCLEHLIQLIKCPSVTPQDG------------GAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR--FGTEA----   64 (389)
Q Consensus         3 ~e~v~~l~~lv~ips~s~~e~------------~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~--~g~~~----   64 (389)
                      =++++.|.+|+||+|-...|.            .+...+-++.++=||+++..          .|..++  +|.+.    
T Consensus        13 Dall~DL~~LlrIdS~~D~e~At~E~PfGpGPv~al~~fL~~a~RDGfttkN~----------dNYaGh~eyg~Gdnada   82 (480)
T TIGR01886        13 DALLEDLEELLRIDSSEDLENATEEAPFGPGPVDALKKFLSFAERDGFTTKNF----------DNYAGHVEYGEGDNADA   82 (480)
T ss_pred             HHHHHHHHHHHHHCCHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCCCEECCC----------CCCEEEEECCCCCCCCC
T ss_conf             37899999997515255575067688788876899999988645689500000----------14333543477874230


Q ss_pred             CEEEEECCCCCCCCCCHHHCCCCCCCEEEEC-CCCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCCEE
Q ss_conf             8899973368157888777256664224521-33236544333201245441000000011-357834999752022011
Q gi|254780782|r   65 PHLMFAGHIDVVPPGDFNHWTYPPFSATIAE-GKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEGPA  142 (389)
Q Consensus        65 ~~ill~~H~Dtvp~~~~~~W~~~Pf~~~~~~-g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~~~  142 (389)
                      ++|.+.|||||||+|  ++|++|||+++|++ |+|||||++||||+=++..+|++.|++.+ ++..+|.|++..+||+ +
T Consensus        83 ~~LGIiGHmDVVPAG--~GW~~dPf~peI~~eG~iYaRGasDDKGPs~aaYYamkilKElglp~~KKIrFvvGtnEEt-g  159 (480)
T TIGR01886        83 ERLGIIGHMDVVPAG--EGWERDPFEPEIKEEGRIYARGASDDKGPSLAAYYAMKILKELGLPLSKKIRFVVGTNEET-G  159 (480)
T ss_pred             CCCCEEECCCEEECC--CCCCCCCCCCEECCCCCEEECCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEEEEECCCCC-C
T ss_conf             104412030133278--7878864823164688687313665666128999999999980888654176786076566-7


Q ss_pred             CCCCCCCCCCCCCCCCCCCEEE---------ECCCCC--------------------------CCCCC---EEEEEE---
Q ss_conf             0442111110001332120354---------145665--------------------------43431---001232---
Q gi|254780782|r  143 INGTKKMLSWIEKKGEKWDACI---------VGEPTC--------------------------NHIIG---DTIKIG---  181 (389)
Q Consensus       143 ~~G~~~l~~~~~~~~~~~d~~i---------~~ep~~--------------------------~~~~~---~~i~~g---  181 (389)
                      ..++-|+.++..-  ..||.+.         -||-+.                          .+.++   ..++.|   
T Consensus       160 W~d~DYYf~Hee~--PlPDfgFSPDAEfPIINGEkG~~T~~l~F~g~dn~gdyvL~~FKaGlaeN~vP~~a~Avisg~sa  237 (480)
T TIGR01886       160 WVDMDYYFKHEET--PLPDFGFSPDAEFPIINGEKGNVTLELSFKGDDNKGDYVLDSFKAGLAENMVPEVARAVISGASA  237 (480)
T ss_pred             CCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCEEEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCCEEEECCCH
T ss_conf             6342300023788--87883448887776212675308899986258753344760010452227898854127834574


Q ss_pred             ---------------------EEEEE-----EEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCC---------------
Q ss_conf             ---------------------22357-----9999996412310000001201345544320112---------------
Q gi|254780782|r  182 ---------------------RRGSL-----SGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLT---------------  220 (389)
Q Consensus       182 ---------------------~rG~~-----~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~---------------  220 (389)
                                           .+|..     ..+|++.|+++|+|.|..|+|+-.=++.+|++..               
T Consensus       238 d~a~~l~aa~E~F~a~~a~knl~g~~E~~D~~ati~l~GkgAHga~Pq~G~N~ATfLalFLnqy~FA~ga~~Fi~~~AE~  317 (480)
T TIGR01886       238 DDAEALKAAYESFVADKAKKNLDGDLELADESATIVLIGKGAHGAAPQKGINSATFLALFLNQYAFADGAKAFIKVLAEV  317 (480)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCEEECCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             24899999987888887530554321431774689987355223688777508889987641030314568988865433


Q ss_pred             --------CCCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCE
Q ss_conf             --------233445664421014667655420466655432116651343420677999999999987653242034311
Q gi|254780782|r  221 --------NIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSH  292 (389)
Q Consensus       221 --------~~~~~~~~~~~~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~  292 (389)
                              ++..-...+.+..++.|.+.++-...  |  +....+..++|++-+.+++.+.+++......        .+
T Consensus       318 ~hEDfyG~KLG~af~DelMg~l~~nag~~~fd~~--n--~e~s~~~lNfRyPqGtspe~m~~~v~~~~g~--------~v  385 (480)
T TIGR01886       318 LHEDFYGEKLGVAFEDELMGDLAMNAGVFDFDEA--N--KESSKVLLNFRYPQGTSPEEMQKKVLDKVGE--------VV  385 (480)
T ss_pred             HCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCC--C--CCCCEEEEECCCCCCCCHHHHHHHHHHHCCC--------EE
T ss_conf             1013056320036541242121157750243356--8--7665765421588888889999999974397--------89


Q ss_pred             EEEECC-CCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHCCCEEEEEEC----CCCCCCCCCEEEHH
Q ss_conf             232226-6311257867899999999999982899579741454358898605989999004----78736878404799
Q gi|254780782|r  293 TVHFSS-PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLV----GRTMHALNENASLQ  367 (389)
Q Consensus       293 ~i~~~~-~~~p~~~~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~~~iP~v~fGp~----~~~~H~pdE~i~i~  367 (389)
                      +++... ...|...+.+.|+|+.|.+.|++.+|..-.-...||+|-+|.+.+||   .||..    .+.+|+-||+..++
T Consensus       386 ~vt~~~~~~ePHYVP~sDPlV~TLl~VYEk~TG~kG~E~iIGGGTyGRLleRGV---AyGA~feg~pd~MH~ANEf~~ld  462 (480)
T TIGR01886       386 DVTLNDRLEEPHYVPVSDPLVATLLKVYEKHTGKKGYEVIIGGGTYGRLLERGV---AYGAMFEGEPDVMHQANEFMELD  462 (480)
T ss_pred             EEEECCCCCCCCEECCCCHHHHHHHHHHHHHCCCCCCEEEECCCCHHHHHHHCC---EECCCCCCCCCHHHHHHCCCHHH
T ss_conf             997668348895335886388889999875078986148974752012432031---11267832686045432141078


Q ss_pred             HHHHHHHHHHHHHHHH
Q ss_conf             9999999999999987
Q gi|254780782|r  368 DLEDLTCIYENFLQNW  383 (389)
Q Consensus       368 ~l~~~~~~~~~~i~~~  383 (389)
                      +|.+.+.+||..|.++
T Consensus       463 dl~~a~aIYAeAIYeL  478 (480)
T TIGR01886       463 DLYKAAAIYAEAIYEL  478 (480)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999999999851


No 48 
>TIGR01893 aa-his-dipept aminoacyl-histidine dipeptidase; InterPro: IPR001160   Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site . The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases .   Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins.   Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule.    This majority of this group of proteins are aminoacyl-histidine dipeptidases (3.4.13.3 from EC, Xaa-His dipeptidases), which are zinc-containing metallopeptidases that belong to MEROPS peptidase family M20 (clan MH), subfamily M20C . Proteins of this clan have two catalytic zinc ions at the active site, bound by His/Asp, Asp, Glu, Asp/Glu and His , . The catalysed reaction involves the release of an N-terminal amino acid, usually neutral or hydrophobic, from a polypeptide..    The X-His dipeptidases cleave Xaa-His dipeptides (where Xaa is any hydrophobic residue). The amino acid sequence deduced from Escherichia coli reveals that peptidase D is a slightly hydrophilic protein of 485 residues that contains no extended domains of marked hydrophobicity .   Also contained within this family of proteins are acetylornithine deactylases which belong to MEROPS peptidase family M20, subfamily M20A non-peptidase homologues. ; GO: 0008769 X-His dipeptidase activity, 0006508 proteolysis.
Probab=100.00  E-value=5.9e-43  Score=282.81  Aligned_cols=362  Identities=21%  Similarity=0.250  Sum_probs=262.9

Q ss_pred             CCHH-HHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEEC-CCCCEEEEECCCCCCCC
Q ss_conf             9878-999999996499978996899999999999779848999705888762489999987-99988999733681578
Q gi|254780782|r    1 MTPD-CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG-TEAPHLMFAGHIDVVPP   78 (389)
Q Consensus         1 l~~e-~v~~l~~lv~ips~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g-~~~~~ill~~H~Dtvp~   78 (389)
                      |+|. +.+.|.++-+||-.|.+|+++++||.+|.|++||+++...    .+|.+-..+|+.| .+.|.|+|.||||.||.
T Consensus         1 L~~~~V~~~F~EiskIPR~S~nek~~~~F~~~~AK~lgle~~~D~----~~Nv~IrkPAT~GyEn~p~ivLQ~H~DMVCE   76 (506)
T TIGR01893         1 LKPSRVLKYFEEISKIPRPSKNEKEVSNFIVNWAKKLGLEVKQDE----VGNVLIRKPATPGYENKPGIVLQGHMDMVCE   76 (506)
T ss_pred             CCCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE----ECCEEEEECCCCCCCCCCCEEEECCCCCCCC
T ss_conf             960157787888731789884277899999984442187478743----1558898077537888787488124377354


Q ss_pred             CCHH---HCCCCCCCEEEECCCCCCCC-C---CCCCCHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCEECCCCCCCCC
Q ss_conf             8877---72566642245213323654-4---333201245441000000011357834999752022011044211111
Q gi|254780782|r   79 GDFN---HWTYPPFSATIAEGKIYGRG-I---VDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLS  151 (389)
Q Consensus        79 ~~~~---~W~~~Pf~~~~~~g~l~GrG-~---~D~Kg~ia~~l~a~~~l~~~~~~~~~i~~~~~~dEE~~~~~G~~~l~~  151 (389)
                      .+.+   ..+.||-++.+||+||+++| |   |||.-|+|.+|+.++--.+....|++|.++||.|||+|. .||..|-.
T Consensus        77 K~~d~~HDF~KDPI~~~~dG~~l~A~grTTLGADNGIgVA~~lA~le~~ik~~l~HPplElL~T~~EE~gm-~GA~gL~~  155 (506)
T TIGR01893        77 KNEDSEHDFEKDPIELIVDGDWLKARGRTTLGADNGIGVAMGLAILEDAIKNNLKHPPLELLFTVDEETGM-DGALGLEE  155 (506)
T ss_pred             CCCCCCCCCCCCCEEEEECCCEEECCCEEECCCCCHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCC-HHHHHCCC
T ss_conf             57877888745861089828578727605504550799999999998853025787864588860000452-23321255


Q ss_pred             CCCCCCCC--CC-----EEEEC-CCCCCCCC-----CEEEEEE-EEEEEEEEEEEEE-ECCCCHH-HHCCC-CHHHHHHH
Q ss_conf             00013321--20-----35414-56654343-----1001232-2235799999964-1231000-00012-01345544
Q gi|254780782|r  152 WIEKKGEK--WD-----ACIVG-EPTCNHII-----GDTIKIG-RRGSLSGEITIHG-KQGHVAY-PHLTE-NPIRGLIP  214 (389)
Q Consensus       152 ~~~~~~~~--~d-----~~i~~-ep~~~~~~-----~~~i~~g-~rG~~~~~i~v~G-~~~Hs~~-p~~g~-nAi~~~~~  214 (389)
                      .+.+-..-  .|     ..++| -++.....     ....... -.|...++|+++| ++||||. =|+++ ||+..|+.
T Consensus       156 ~~~~G~~LiNiDsEeeG~~~vGCAGG~~~~~~lp~~~e~~~~~~GsG~~~~~I~~~GL~GGHSG~dIH~~RANankLm~~  235 (506)
T TIGR01893       156 NLLEGKILINIDSEEEGELLVGCAGGINVEITLPVKYEKFEKDEGSGFKGYRISLKGLKGGHSGADIHKGRANANKLMAR  235 (506)
T ss_pred             CCCCCCEEEECCCEEEEEEEEEECCCEEEEEEECCCEEEEECCCCCCEEEEEEEEECCCCCCCCCHHCCCHHHHHHHHHH
T ss_conf             50016501213753334899972276046788255002323366641247999965376687554011122358999999


Q ss_pred             HHHCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCC----------------------------------------
Q ss_conf             3201122334456644210146676554204666554321----------------------------------------
Q gi|254780782|r  215 LLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQ----------------------------------------  254 (389)
Q Consensus       215 ~i~~l~~~~~~~~~~~~~~~~~~i~~i~~g~~~~NvIP~~----------------------------------------  254 (389)
                      +|.+|++.. +.       -.+.+..|. ||...|.||.+                                        
T Consensus       236 ~L~~~~~n~-~k-------e~~~L~~i~-GGS~~NAIPrEA~a~ia~~~~d~~~~~~~v~~~~~~~K~~Y~~~~~~~~~~  306 (506)
T TIGR01893       236 VLSELKENL-DK-------ENFRLSDIK-GGSKRNAIPREAKALIAIDEEDVKKLEELVKNFQSKFKKEYSELEPNITLE  306 (506)
T ss_pred             HHHHHHHCC-CC-------CCEEEEEEE-CCCCCCCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             999998337-92-------405787741-787256774414799998152089999998889998766653118883189


Q ss_pred             -------------------------------------------------------------------------EEEEECC
Q ss_conf             -------------------------------------------------------------------------1665134
Q gi|254780782|r  255 -------------------------------------------------------------------------VKMSFNI  261 (389)
Q Consensus       255 -------------------------------------------------------------------------a~~~~di  261 (389)
                                                                                               ..+.+.+
T Consensus       307 ~~~~E~~iifeasGGkitrkev~~~~v~s~~~~~k~i~~~~~~p~GV~~~~~~~~~~VeSS~NL~~~~~~~~~~~~~~~~  386 (506)
T TIGR01893       307 VSKEENSIIFEASGGKITRKEVKSEKVFSEETTEKLINALNLLPNGVQRVSDELPGLVESSLNLAVVKTKENKVIVVFLI  386 (506)
T ss_pred             EEEECCEEEEECCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHCCCCEEEEECCEEEEEEECCEEEEEEEE
T ss_conf             98632617884378723310047654474257899999997358983105530598266304438899847679999887


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHH
Q ss_conf             34206779999999999876532420343112322266311257867899999999999982899579741454358898
Q gi|254780782|r  262 RFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFI  341 (389)
Q Consensus       262 R~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~  341 (389)
                      |..-....+.|.+.|.....     ..  ..++++...||.|..+.++.+.+.+.++|++.+|+.|...+..++--++.+
T Consensus       387 RSs~~~~k~~v~~~i~~~~~-----l~--GA~~e~~~~YP~W~p~~~S~ll~~~~kvY~e~~ge~~~v~viHAGLECG~i  459 (506)
T TIGR01893       387 RSSVESDKDYVTEKIESIAK-----LA--GAEVEVSAGYPSWQPDPDSNLLDVARKVYKEMFGEDPEVKVIHAGLECGII  459 (506)
T ss_pred             ECCCCCHHHHHHHHHHHHHH-----HH--CCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCHHHCCC
T ss_conf             42561107899889989998-----72--974999838887661677618899999875540789579999664110400


Q ss_pred             HHCC-C---EEEEEECCCCCCCCCCEEEHHHHHHHHHHHHHHHHHH
Q ss_conf             6059-8---9999004787368784047999999999999999987
Q gi|254780782|r  342 KDYC-P---VIEFGLVGRTMHALNENASLQDLEDLTCIYENFLQNW  383 (389)
Q Consensus       342 ~~~i-P---~v~fGp~~~~~H~pdE~i~i~~l~~~~~~~~~~i~~~  383 (389)
                      ...+ |   ++.|||--...|+|+|+++|++..+..++|.++|+++
T Consensus       460 ~~~~q~~~dmIS~GP~i~d~HsP~ERv~I~Sv~~vw~fL~~~L~~~  505 (506)
T TIGR01893       460 SEKIQPDIDMISIGPNIYDPHSPNERVEISSVEKVWDFLVKVLERL  505 (506)
T ss_pred             HHCCCCCCCEEEECCCCCCCCCCCCCEEECHHHHHHHHHHHHHHHC
T ss_conf             0015898414781760268988865055222134568999998625


No 49 
>TIGR01900 dapE-gram_pos succinyl-diaminopimelate desuccinylase; InterPro: IPR010174   This entry represents a clade of succinyl-diaminopimelate desuccinylases from actinobacteria (high-GC Gram-positives) and is based on the characterisation of the enzyme from Corynebacterium glutamicum . This enzyme is involved in the biosynthesis of lysine, and is related to the enzyme acetylornithine deacetylase and other amidases and peptidases. They are classified as non-peptidases homologs belonging to MEROPS peptidase family M20A.
Probab=100.00  E-value=5.6e-45  Score=295.31  Aligned_cols=340  Identities=24%  Similarity=0.294  Sum_probs=249.8

Q ss_pred             HHHHHHCCCCCCCCHHHHHHHHHHHHHHC---CCEEEEEEECCCCCCEEEEEEEEECCCCC-EEEEECCCCCCCCCCH--
Q ss_conf             99999649997899689999999999977---98489997058887624899999879998-8999733681578887--
Q gi|254780782|r    8 HLIQLIKCPSVTPQDGGAFFILVNTLKLL---GFSIEEKDFQTKNTSIVKNLYARFGTEAP-HLMFAGHIDVVPPGDF--   81 (389)
Q Consensus         8 ~l~~lv~ips~s~~e~~~~~~l~~~l~~~---G~~~~~~~~~~~~~~~~~~~~~~~g~~~~-~ill~~H~Dtvp~~~~--   81 (389)
                      ++++|+.+||+|.+|+.+++-+++.|+.+   ++++.+.  .       .+++|+-..+.+ +|+|-||+||||+-|.  
T Consensus         1 L~~~~~~~~S~S~~E~~~~DE~E~~L~nl~~~~~~V~R~--~-------~~V~A~T~~G~~SRV~LAGH~DTVP~~DNlP   71 (373)
T TIGR01900         1 LLTRLVDIFSVSDQEKQLADEVEDALRNLELEGLEVFRF--N-------DTVLARTDFGKASRVILAGHLDTVPVIDNLP   71 (373)
T ss_pred             CCCCEECCCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEE--C-------CEEEEEECCCCCCEEEEECCCCCCCCCCCCC
T ss_conf             942100036888887630378999998517887179970--7-------8379750788842145524445204213778


Q ss_pred             HHCCCCCCC--------EEEECCCCCCCCCCCCCCHHHHHHHHCCCCC---CCCCCCCCEEEEEEEECCC-EECCCCCCC
Q ss_conf             772566642--------2452133236544333201245441000000---0113578349997520220-110442111
Q gi|254780782|r   82 NHWTYPPFS--------ATIAEGKIYGRGIVDMKGSIACFIAAVARFI---PKYKNFGSISLLITGDEEG-PAINGTKKM  149 (389)
Q Consensus        82 ~~W~~~Pf~--------~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~---~~~~~~~~i~~~~~~dEE~-~~~~G~~~l  149 (389)
                      -+|-.|--+        ...+|+.|||||+.|||++.|.+|+.+..|-   .+..++..++++|.-.||+ ...+|.+++
T Consensus        72 PkWlePGdslireeiah~~~ED~~lyG~G~~DMK~~~AV~L~~~ATLdGr~~~T~~K~DLT~~~Y~~EEV~~~~NGL~~~  151 (373)
T TIGR01900        72 PKWLEPGDSLIREEIAHARVEDRVLYGRGAVDMKASLAVYLYLAATLDGRATETELKVDLTLVAYDHEEVVDEKNGLRKV  151 (373)
T ss_pred             CCCCCCCCHHHHHHHHHCCCCCCEEECCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEECHHHHHHHCCCCCHH
T ss_conf             43247650355654542465463574377521011468999998721677877754520245542113567542662005


Q ss_pred             CCCCCCCCCCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCCCCCCC-
Q ss_conf             1100013321203541456654343100123222357999999641231000000120134554432011223344566-
Q gi|254780782|r  150 LSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGN-  228 (389)
Q Consensus       150 ~~~~~~~~~~~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~~~~~-  228 (389)
                      .+...+ =...|++|+||||+..     |..||.|.++++|+.||..+||++.|+|.|||++++++|+++..++-..-+ 
T Consensus       152 ~~~HP~-W~~~DlA~~GEPT~~~-----IE~GC~G~~R~~V~~HGV~AHSAR~WlG~NA~HK~~~I~~~~~AY~~A~VN~  225 (373)
T TIGR01900       152 VDEHPD-WLAADLALLGEPTNSG-----IEAGCNGTLRIDVVAHGVAAHSARAWLGDNAIHKLADILSKLAAYKAAEVNV  225 (373)
T ss_pred             HHCCCC-HHHHCEEEECCCCCCC-----CCCCCCCCEEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             341765-0112411330676873-----3344455248999854621223443421125767888987765057653540


Q ss_pred             -CCCCCEEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHH-----------HHCCCC-EEEE
Q ss_conf             -442101466765542046665543211665134342067799999999998765324-----------203431-1232
Q gi|254780782|r  229 -TTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQ-----------NVPKLS-HTVH  295 (389)
Q Consensus       229 -~~~~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~-----------~~~~~~-~~i~  295 (389)
                       .+--+--+|++-|++ +.+.||||+.|.+.+++||.|..++...+...--. ...++           ...+.. ++++
T Consensus       226 DGL~YREGLN~~l~~~-G~~~NVIPD~~~~~~NyRFAP~~~L~EAkalmmGa-daGaelGn~EHV~~~~~l~G~~Gie~~  303 (373)
T TIGR01900       226 DGLDYREGLNIVLIES-GKATNVIPDLARVNLNYRFAPDKDLAEAKALMMGA-DAGAELGNIEHVVETLVLDGYDGIEIE  303 (373)
T ss_pred             CCCCCCCCCEEEEECC-CCCCCCCCCCEEEEEEEECCCCCCHHHHHHHHHCC-CCCCCCCCCCEEEEEEEECCCCCEEEE
T ss_conf             5633323530788617-84244156512674212018872578898886302-234211572146740164177744799


Q ss_pred             ECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHCCCEEEEEECCCC-CCCCCCEEE
Q ss_conf             2266311257867899999999999982899579741454358898605989999004787-368784047
Q gi|254780782|r  296 FSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRT-MHALNENAS  365 (389)
Q Consensus       296 ~~~~~~p~~~~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~~~iP~v~fGp~~~~-~H~pdE~i~  365 (389)
                      .....+....--+.++.+-|.+++++..+..|.. -.|.|+-+||.+.|||++.||.|+-. +|..||++.
T Consensus       304 ~~D~~~~A~PGL~~~~~~~L~~~V~~~~~RdPlA-KlGWTDV~RFS~lGIPA~NlGAGDP~lAHK~DEQ~P  373 (373)
T TIGR01900       304 VKDEAGSALPGLNAQLASDLVDLVKRRKIRDPLA-KLGWTDVARFSALGIPALNLGAGDPLLAHKRDEQVP  373 (373)
T ss_pred             EECCCCCCCCCCCCHHHHHHHHHHHHCCCCCCHH-HCCCHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCC
T ss_conf             8628888788776356789999863114666222-325303566653276602137787220023226799


No 50 
>PRK12893 allantoate amidohydrolase; Reviewed
Probab=100.00  E-value=1.1e-41  Score=275.00  Aligned_cols=341  Identities=20%  Similarity=0.248  Sum_probs=259.9

Q ss_pred             HHHHHHHHHCCCC----------CCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEE-CC--CCCEEEEEC
Q ss_conf             9999999964999----------7899689999999999977984899970588876248999998-79--998899973
Q gi|254780782|r    5 CLEHLIQLIKCPS----------VTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF-GT--EAPHLMFAG   71 (389)
Q Consensus         5 ~v~~l~~lv~ips----------~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~-g~--~~~~ill~~   71 (389)
                      +.+.|.+|-+|-+          .|+.+..+.+|+.+||+++|++++..        .++|+|+++ |.  +.|.|++.|
T Consensus        12 l~~~l~~l~~~g~~~~gGvtR~~~s~~~~~a~~~~~~~m~~~Gl~v~~D--------~~GNl~g~~~G~~~~~p~i~~GS   83 (408)
T PRK12893         12 LWDSLMALARIGATPPGGVTRLALTDADREARDLFAQWMEEAGLTVSVD--------AVGNLFGRRAGTDPDAPPVLIGS   83 (408)
T ss_pred             HHHHHHHHHHCCCCCCCCEEECCCCHHHHHHHHHHHHHHHHCCCEEEEE--------CCCCEEEEECCCCCCCCEEEECC
T ss_conf             9999999985589999965646189999999999999999869989980--------78888999358888988278625


Q ss_pred             CCCCCCCCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCCE----ECCCC
Q ss_conf             36815788877725666422452133236544333201245441000000011-35783499975202201----10442
Q gi|254780782|r   72 HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEGP----AINGT  146 (389)
Q Consensus        72 H~Dtvp~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~~----~~~G~  146 (389)
                      |+||||.|-                      -.|.--|+++.|++++.|.+++ +++.+|.++...+||+.    ++.||
T Consensus        84 HlDTVp~GG----------------------~~DG~lGV~~~Le~~~~l~e~g~~~~~~l~vv~f~~EEg~RF~~~~~GS  141 (408)
T PRK12893         84 HLDTQPTGG----------------------RFDGALGVLAALEVVRTLNDAGIRTRRPIEVVSWTNEEGARFAPAMLGS  141 (408)
T ss_pred             CCCCCCCCC----------------------CCCCHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCCCCCCCCCCH
T ss_conf             535442898----------------------6574256889999999999739988999589998355455467653252


Q ss_pred             CCCCCCCCC--------------------CCCCC---------CEEE--ECCCCC---CCCCCEEEEEEEEEEEEEEEEE
Q ss_conf             111110001--------------------33212---------0354--145665---4343100123222357999999
Q gi|254780782|r  147 KKMLSWIEK--------------------KGEKW---------DACI--VGEPTC---NHIIGDTIKIGRRGSLSGEITI  192 (389)
Q Consensus       147 ~~l~~~~~~--------------------~~~~~---------d~~i--~~ep~~---~~~~~~~i~~g~rG~~~~~i~v  192 (389)
                      +.+.-.+..                    .+...         .+.+  .-|-+-   .....-.|+++-.|..++++++
T Consensus       142 ~~~~G~l~~~~~~~~~D~~G~tl~~al~~~G~~~~~~~~~~~i~a~lElHIEQGpvLe~~~~~iGiVt~I~G~~r~~v~v  221 (408)
T PRK12893        142 GVFTGELPLDDALARRDADGVTLGEALARIGYRGTARVGGRAVDAYFELHIEQGPVLEAEGLDIGVVTGIQGIRWFEVTV  221 (408)
T ss_pred             HHHCCCCCHHHHHHHHCCCCCCHHHHHHHCCCCCCCCCCCCCCCEEEEEEECCCCCHHHCCCCEEEEEEECCEEEEEEEE
T ss_conf             67426769999974007788769999997588764457743530699998526750010599532783003516899999


Q ss_pred             EEECCCCH-HH-HCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHH
Q ss_conf             64123100-00-00120134554432011223344566442101466765542046665543211665134342067799
Q gi|254780782|r  193 HGKQGHVA-YP-HLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEK  270 (389)
Q Consensus       193 ~G~~~Hs~-~p-~~g~nAi~~~~~~i~~l~~~~~~~~~~~~~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~  270 (389)
                      +|+++||+ +| +...+|+..+++++.++.+......    ..++.+|+.|+..+++.|+||++|++++|+|.......+
T Consensus       222 ~G~a~HAGttPM~~R~DAl~aAa~~i~~v~~~a~~~~----~~~vaTVG~i~~~P~a~NvIPg~v~f~lDiRs~~~~~l~  297 (408)
T PRK12893        222 TGQAAHAGTTPMAMRRDALVAAAQIILAVERIAAALA----PRGVATVGRVEVSPNSRNVIPGKVVFTVDLRHPDDARLD  297 (408)
T ss_pred             EEECCCCCCCCHHHCCCHHHHHHHHHHHHHHHHHHHC----CCCEEEEEEEEECCCCCCEECCEEEEEEEECCCCHHHHH
T ss_conf             9778988888702203899999999999999998609----884898789982576554308868999980379989999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHCCCEE-E
Q ss_conf             999999998765324203431123222663112578678999999999999828995797414543588986059899-9
Q gi|254780782|r  271 TLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVI-E  349 (389)
Q Consensus       271 ~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~~~iP~v-~  349 (389)
                      .+.+++++.+.+... ..+++++++.....+|...  +..+++.+.+++++ .|.++....+|+++|+.+++..+|+. .
T Consensus       298 ~~~~~i~~~~~~ia~-~~g~~~~~~~~~~~~pv~~--d~~l~~~~~~aa~~-~g~~~~~m~SGAGHDA~~~a~~~Pt~Mi  373 (408)
T PRK12893        298 AMEAEIRAACAEIAA-ARGVEITVETVWDFPPVPF--DPALVALVRQAAEA-LGLSHMRMVSGAGHDAMHLARVCPAAMI  373 (408)
T ss_pred             HHHHHHHHHHHHHHH-HCCCEEEEEEEEECCCCCC--CHHHHHHHHHHHHH-CCCCCCEECCCHHHHHHHHHHHCCEEEE
T ss_conf             999999999999998-7197499999983798678--99999999999997-4999605365176999998725888999


Q ss_pred             EEECCCC-CCCCCCEEEHHHHHHHHHHHHHHHHHH
Q ss_conf             9004787-368784047999999999999999987
Q gi|254780782|r  350 FGLVGRT-MHALNENASLQDLEDLTCIYENFLQNW  383 (389)
Q Consensus       350 fGp~~~~-~H~pdE~i~i~~l~~~~~~~~~~i~~~  383 (389)
                      |-|.-++ .|.|+||.+.+|+.++++++.+.+.++
T Consensus       374 FVps~~GiSH~p~E~t~~eD~~~g~~vL~~~l~~L  408 (408)
T PRK12893        374 FVPCVGGISHNEAEDTAPADLAAGANVLLHAVLEL  408 (408)
T ss_pred             EEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             71079998799222699999999999999999859


No 51 
>PRK09290 allantoate amidohydrolase; Reviewed
Probab=100.00  E-value=6.1e-42  Score=276.57  Aligned_cols=345  Identities=20%  Similarity=0.240  Sum_probs=262.3

Q ss_pred             HHHHHHHHHCCCC----------CCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEE-CC--CCCEEEEEC
Q ss_conf             9999999964999----------7899689999999999977984899970588876248999998-79--998899973
Q gi|254780782|r    5 CLEHLIQLIKCPS----------VTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF-GT--EAPHLMFAG   71 (389)
Q Consensus         5 ~v~~l~~lv~ips----------~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~-g~--~~~~ill~~   71 (389)
                      +.+.|.+|-+|-+          .|+.+..+.+|+.+||+++||+++..        .++|+++++ |.  +.|.|++.|
T Consensus         9 l~~~l~~l~~ig~~~~gG~tR~~~s~~~~~a~~~~~~~~~~~Gl~v~~D--------~~GNl~~~~~G~~~~~p~i~~GS   80 (412)
T PRK09290          9 LWASLMELAKIGATPKGGVTRLALSPEDLQARDLFAKWMEAAGLTVRVD--------AVGNLFGRLEGRDPDAPAVLTGS   80 (412)
T ss_pred             HHHHHHHHHHCCCCCCCCEEECCCCHHHHHHHHHHHHHHHHCCCEEEEE--------CCCCEEEEECCCCCCCCEEEECC
T ss_conf             9999999984589999965516499999999999999999869978982--------78888999358888988178766


Q ss_pred             CCCCCCCCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCC----EECCCC
Q ss_conf             36815788877725666422452133236544333201245441000000011-3578349997520220----110442
Q gi|254780782|r   72 HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEG----PAINGT  146 (389)
Q Consensus        72 H~Dtvp~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~----~~~~G~  146 (389)
                      |+||||.|                      |-.|..-|+++.|++++.|.+++ +++.+|.++...+||+    .++.||
T Consensus        81 HlDTVp~G----------------------G~yDG~lGV~aale~~~~l~e~g~~~~~~i~vv~f~~EEg~RF~~~~~GS  138 (412)
T PRK09290         81 HLDTVPNG----------------------GRFDGPLGVLAGLEVVRTLNDQGIRPRRPIEVVNFTNEEGSRFGPAMLGS  138 (412)
T ss_pred             CCCCCCCC----------------------CCCCCHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCCCCCCCCCCH
T ss_conf             43546589----------------------76576688999999999999759998999689998065455457652034


Q ss_pred             CCCCCCCC--------------------CCCCCCCE-----------EE--ECCCC-C--CCCCCEEEEEEEEEEEEEEE
Q ss_conf             11111000--------------------13321203-----------54--14566-5--43431001232223579999
Q gi|254780782|r  147 KKMLSWIE--------------------KKGEKWDA-----------CI--VGEPT-C--NHIIGDTIKIGRRGSLSGEI  190 (389)
Q Consensus       147 ~~l~~~~~--------------------~~~~~~d~-----------~i--~~ep~-~--~~~~~~~i~~g~rG~~~~~i  190 (389)
                      +.+.-.+.                    +.+..++.           .+  .-|-+ .  .....-.|+++-.|..++++
T Consensus       139 ~~~~G~l~~~~~~~~~D~~G~sl~~al~~~G~~~~~~~~~~~~~~~a~lElHIEQGpvLe~~~~~iGIVt~i~g~~r~~v  218 (412)
T PRK09290        139 RVFAGALTLEDALARRDADGISLAEALAAIGYDGAELVGRAPEDIKAFVELHIEQGPVLEAEGKPIGVVTGIVGQRRYRV  218 (412)
T ss_pred             HHHHCCCCHHHHHHCCCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCEEEEEEECCCCHHHHCCCCEEEEEEECCEEEEEE
T ss_conf             87718879999961618799899999997699930024556434424446520345335546995537730044069999


Q ss_pred             EEEEECCCCHH-H-HCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHH
Q ss_conf             99641231000-0-001201345544320112233445664421014667655420466655432116651343420677
Q gi|254780782|r  191 TIHGKQGHVAY-P-HLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWN  268 (389)
Q Consensus       191 ~v~G~~~Hs~~-p-~~g~nAi~~~~~~i~~l~~~~~~~~~~~~~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~  268 (389)
                      +++|+++||+. | ....||+.++++++.++.+......    ..++.+++.|+..+++.|+||+++++++|+|....+.
T Consensus       219 ~i~G~a~HAGttPM~~R~DAl~aaa~~i~~v~~~a~~~~----~~~vaTvG~i~~~P~a~NvIPg~v~ftvDiRs~~~~~  294 (412)
T PRK09290        219 TFTGEANHAGTTPMALRRDALLAAAEIILAVERIAAAHG----PDLVATVGRLEVYPNSRNVIPGEVTFTLDIRHPDDAV  294 (412)
T ss_pred             EEEECCCCCCCCCHHHCCCHHHHHHHHHHHHHHHHHHHC----CCCEEEEEEEEECCCCCCCCCCEEEEEEEECCCCHHH
T ss_conf             998438888989635340799999999999999999729----9838987899835874642188689999822789999


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHCCCE-
Q ss_conf             9999999999876532420343112322266311257867899999999999982899579741454358898605989-
Q gi|254780782|r  269 EKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPV-  347 (389)
Q Consensus       269 ~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~~~iP~-  347 (389)
                      .+++.+++++.+.+...+ .+++++++.....+|...  +..+++.+.+++++ .|..+....+|+++|+.+++..+|+ 
T Consensus       295 l~~~~~~i~~~~~~ia~~-~g~~~e~~~~~~~~pv~~--d~~l~~~~~~aa~~-~g~~~~~m~SGAGHDA~~~a~~~Pt~  370 (412)
T PRK09290        295 LDAMVAELRAAAEAIAAR-RGVGIEIELISDFAPVPF--DPALVAALERAAEA-LGLSYRRLPSGAGHDAQILAAVVPTA  370 (412)
T ss_pred             HHHHHHHHHHHHHHHHHH-HCCEEEEEEEEECCCCCC--CHHHHHHHHHHHHH-CCCCCEECCCCHHHHHHHHHCCCCEE
T ss_conf             999999999999999997-297699999983598567--99999999999997-59995140550678999986518878


Q ss_pred             EEEEECCCC-CCCCCCEEEHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             999004787-3687840479999999999999999872477
Q gi|254780782|r  348 IEFGLVGRT-MHALNENASLQDLEDLTCIYENFLQNWFITP  387 (389)
Q Consensus       348 v~fGp~~~~-~H~pdE~i~i~~l~~~~~~~~~~i~~~~~~~  387 (389)
                      +.|-|.-++ .|.|+||.+.+|+..++++|.+++.++...+
T Consensus       371 MiFVps~~GiSH~p~E~t~~eD~~~g~~vL~~~l~~la~~~  411 (412)
T PRK09290        371 MIFVPSVGGISHNPAEFTSPEDCAAGANVLLHALLELAEAV  411 (412)
T ss_pred             EEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99827899866891215999999999999999999998864


No 52 
>PRK12890 allantoate amidohydrolase; Reviewed
Probab=100.00  E-value=8e-41  Score=269.72  Aligned_cols=342  Identities=18%  Similarity=0.194  Sum_probs=259.4

Q ss_pred             HHHHHHHHHHCCCC---------CCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEE-CC--CCCEEEEEC
Q ss_conf             89999999964999---------7899689999999999977984899970588876248999998-79--998899973
Q gi|254780782|r    4 DCLEHLIQLIKCPS---------VTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF-GT--EAPHLMFAG   71 (389)
Q Consensus         4 e~v~~l~~lv~ips---------~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~-g~--~~~~ill~~   71 (389)
                      .+.+.|.+|-+|=.         .|+.+..+.+|+.+||+++|++++..        .++|+++++ |.  +.|.|++.|
T Consensus        10 Rl~~~l~~l~~ig~~~~G~tR~a~s~~d~~ar~~l~~~~~~~Gl~v~~D--------~~GNl~g~~~G~~~~~p~v~~GS   81 (412)
T PRK12890         10 RLLARLEALAAIGEDGPGLTRLALSDEERAARALLAAWMRAAGLTVRRD--------AAGNLFGRREGRDPDAPPLMTGS   81 (412)
T ss_pred             HHHHHHHHHHCCCCCCCCEEECCCCHHHHHHHHHHHHHHHHCCCEEEEC--------CCCCEEEEECCCCCCCCEEEECC
T ss_conf             9999999997178999965626379999999999999999869989980--------78888999457889988579714


Q ss_pred             CCCCCCCCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCCE----ECCCC
Q ss_conf             36815788877725666422452133236544333201245441000000011-35783499975202201----10442
Q gi|254780782|r   72 HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEGP----AINGT  146 (389)
Q Consensus        72 H~Dtvp~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~~----~~~G~  146 (389)
                      |+||||.|-                      -.|.--|+++.|++++.|.+++ ++..+|.++...+||+.    ++.||
T Consensus        82 HlDTVp~GG----------------------~~DG~lGV~a~Lev~~~l~e~g~~~~~~i~vv~f~~EEG~RF~~~~~GS  139 (412)
T PRK12890         82 HLDTVPEGG----------------------RYDGIYGVLAGLEVVATLNEQGIRPPHPLEVIAFTNEEGVRFPPSMIGS  139 (412)
T ss_pred             CCCCCCCCC----------------------CCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCCCCCCH
T ss_conf             535156887----------------------5577255799999999999719977888599997266466668886203


Q ss_pred             CCCCCCCC--------------------CCCCCCCE-----------EE--ECCCC-C--CCCCCEEEEEEEEEEEEEEE
Q ss_conf             11111000--------------------13321203-----------54--14566-5--43431001232223579999
Q gi|254780782|r  147 KKMLSWIE--------------------KKGEKWDA-----------CI--VGEPT-C--NHIIGDTIKIGRRGSLSGEI  190 (389)
Q Consensus       147 ~~l~~~~~--------------------~~~~~~d~-----------~i--~~ep~-~--~~~~~~~i~~g~rG~~~~~i  190 (389)
                      +.+.-.+.                    +.+..++.           .+  .-|-+ -  .....-.|+++-.|..+++|
T Consensus       140 ~~~~G~l~~~~~~~~~D~~G~t~~~al~~~G~~~~~~~~~~~~~~~ay~ElHIEQGpvLe~~~~~iGIVt~i~G~~r~~v  219 (412)
T PRK12890        140 RALAGTLDVEAALATRDDDGTTLAEALRRIGGDPDALPGALRPDPAAFLELHIEQGPVLEAEGLPIGVVTAIQGIRRQAV  219 (412)
T ss_pred             HHHHCCCCHHHHHHHHCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCEEEEEECCCCCCHHHCCCCCEEEECCCCEEEEEE
T ss_conf             55537789999975327689889999998499930013444456412157501347502316986206621355079999


Q ss_pred             EEEEECCCCHH-HHC-CCCHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHH
Q ss_conf             99641231000-000-1201345544320112233445664421014667655420466655432116651343420677
Q gi|254780782|r  191 TIHGKQGHVAY-PHL-TENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWN  268 (389)
Q Consensus       191 ~v~G~~~Hs~~-p~~-g~nAi~~~~~~i~~l~~~~~~~~~~~~~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~  268 (389)
                      +++|+++||+. |.. ..+|+..+++++.++.+......    ..++.+++.|+..+++.|+||++|++++|+|......
T Consensus       220 ~i~G~a~HAGtTPM~~R~DAl~aAa~~i~~i~~~a~~~~----~~~v~TVG~i~v~P~~~NvIPg~v~f~lDiRs~d~~~  295 (412)
T PRK12890        220 TVEGLANHAGTTPMDLRRDALVAAAEVVTAVERRARALP----GELVATVGRLDVEPNAINVIPGRAVFTVDLRSPDDAV  295 (412)
T ss_pred             EEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCC----CCEEEEEEEEEECCCCCCEECCEEEEEEEEECCCHHH
T ss_conf             998237889888832134899999999999999998539----8718998679842775542087589999910799999


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHCCCEE
Q ss_conf             99999999998765324203431123222663112578678999999999999828995797414543588986059899
Q gi|254780782|r  269 EKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVI  348 (389)
Q Consensus       269 ~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~~~iP~v  348 (389)
                      .+.+.+.+++.+++... ..+++++++.....+|...  +..+++.+.+++++ .|.+.....+|+++|+.+++..+|+.
T Consensus       296 l~~~~~~i~~~~~~ia~-~~gv~~~~~~~~~~~pv~~--d~~l~~~~~~aa~~-~g~~~~~m~SGAGHDA~~~a~~~P~~  371 (412)
T PRK12890        296 LEAAEAALLAELEAIAA-RRGVRIDLERTSRSRPVPC--DPALVDAVEAAAAR-LGYASRRLPSGAGHDAAAIARIAPAA  371 (412)
T ss_pred             HHHHHHHHHHHHHHHHH-HCCCEEEEEEEEECCCCCC--CHHHHHHHHHHHHH-CCCCCCEECCCHHHHHHHHHHHCCEE
T ss_conf             99999999999999999-7498499999884787577--99999999999997-59997252750569999997058889


Q ss_pred             -EEEECCCC-CCCCCCEEEHHHHHHHHHHHHHHHHHH
Q ss_conf             -99004787-368784047999999999999999987
Q gi|254780782|r  349 -EFGLVGRT-MHALNENASLQDLEDLTCIYENFLQNW  383 (389)
Q Consensus       349 -~fGp~~~~-~H~pdE~i~i~~l~~~~~~~~~~i~~~  383 (389)
                       .|-|.-++ .|.|+||.+.+|+..++++|.+.+.++
T Consensus       372 MiFvps~~GiSH~p~E~t~~eD~~~g~~vL~~~l~~l  408 (412)
T PRK12890        372 MIFVPCRGGISHNPEEATEPEDLAAGARVLLDAVLRL  408 (412)
T ss_pred             EEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             9981489985689121699999999999999999999


No 53 
>PRK12892 allantoate amidohydrolase; Reviewed
Probab=100.00  E-value=6e-40  Score=264.33  Aligned_cols=342  Identities=18%  Similarity=0.233  Sum_probs=259.9

Q ss_pred             HHHHHHHHHCCC---------CCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEE-CC--CCCEEEEECC
Q ss_conf             999999996499---------97899689999999999977984899970588876248999998-79--9988999733
Q gi|254780782|r    5 CLEHLIQLIKCP---------SVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF-GT--EAPHLMFAGH   72 (389)
Q Consensus         5 ~v~~l~~lv~ip---------s~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~-g~--~~~~ill~~H   72 (389)
                      +.+.|.+|-+|=         +.|+.+..+.+|+.+||+++|++++..        .++|+++++ |.  +.|.|++.||
T Consensus        12 l~~~l~~l~~ig~~~~GvtR~a~s~~d~~ar~~l~~~~~~~Gl~v~~D--------~~GNl~g~~~G~~~~~p~v~~GSH   83 (413)
T PRK12892         12 ILDDLMELAAIGTAKTGVHRPTLSDAHRAARRRLAAWCEAAGLAVRID--------GIGNVFGRLPGPGPHLPAIMVGSH   83 (413)
T ss_pred             HHHHHHHHHCCCCCCCCEECCCCCHHHHHHHHHHHHHHHHCCCEEEEE--------CCCCEEEEECCCCCCCCEEEECCC
T ss_conf             999999996237999952317589999999999999999869979880--------788889993488888870565143


Q ss_pred             CCCCCCCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCC----EECCCCC
Q ss_conf             6815788877725666422452133236544333201245441000000011-3578349997520220----1104421
Q gi|254780782|r   73 IDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEG----PAINGTK  147 (389)
Q Consensus        73 ~Dtvp~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~----~~~~G~~  147 (389)
                      +||||.|-    .|        ||.          -|+++.|++++.|.+++ +++.+|.++...+||+    .++.||+
T Consensus        84 lDTVp~GG----~f--------DG~----------lGVlaale~~~~l~e~g~~~~~~i~Vv~f~~EEGsRF~~~~~GS~  141 (413)
T PRK12892         84 LDSQPLGG----RY--------DGA----------LGVVAGLEAARALNEHGIATRHPLDVVAWCDEEGSRFTGGFLGSR  141 (413)
T ss_pred             CCCCCCCC----CC--------CCH----------HHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCCCCCCCCCCHH
T ss_conf             12467886----53--------735----------677999999999997399678996799970665654676532368


Q ss_pred             CCCCCCCCC----------CCCCC-----EEEEC------CCCC----------------CCCCCEEEEEEEEEEEEEEE
Q ss_conf             111100013----------32120-----35414------5665----------------43431001232223579999
Q gi|254780782|r  148 KMLSWIEKK----------GEKWD-----ACIVG------EPTC----------------NHIIGDTIKIGRRGSLSGEI  190 (389)
Q Consensus       148 ~l~~~~~~~----------~~~~d-----~~i~~------ep~~----------------~~~~~~~i~~g~rG~~~~~i  190 (389)
                      .+.-.+...          +....     +.+.+      ++..                .....-.|+.+-.|..+++|
T Consensus       142 ~~~G~l~~~~~~~~~d~~dG~sl~~al~~~G~~~~~~~~~~~~~~~a~lElHIEQGpvLe~~~~~iGIVt~I~G~~r~~v  221 (413)
T PRK12892        142 VYAGALDPADLDAARDRTTGVPLRDALAAAGLAGRPRLAADRARPKGYLEAHIEQGPVLEAAGLPVGVVTGIVGIWQYRI  221 (413)
T ss_pred             HHHCCCCHHHHHHCCCCCCCCCHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHCCCHHHHCCCCEEEEEEECCEEEEEE
T ss_conf             88288899999735046689599999997699986333467100247999988617268768984568842134068999


Q ss_pred             EEEEECCCCHH-H-HCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHH
Q ss_conf             99641231000-0-001201345544320112233445664421014667655420466655432116651343420677
Q gi|254780782|r  191 TIHGKQGHVAY-P-HLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWN  268 (389)
Q Consensus       191 ~v~G~~~Hs~~-p-~~g~nAi~~~~~~i~~l~~~~~~~~~~~~~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~  268 (389)
                      +++|+++||+. | ....+|+..++.++..+.+......    ..+..+++.|+..+++.|+||++|++++|+|......
T Consensus       222 ~i~G~a~HAGtTPM~~R~DAl~aAa~~i~~~~~~~~~~~----~~~v~TVG~i~v~P~~~NvIPg~v~ftvDiR~~d~~~  297 (413)
T PRK12892        222 TVTGEANHAGTTPMAVRRDAMGLAAAMIAALIEHPHACG----PDAVVTVGRVALDPGSPSIIPGKVEFSFDIRHPSPPV  297 (413)
T ss_pred             EEEEECCCCCCCCHHHHCCHHHHHHHHHHHHHHHHHHCC----CCCEEEEEEEEECCCCCEECCCEEEEEEECCCCCHHH
T ss_conf             998537888998624411489999999999999998609----9828986489735874133265479999815799899


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHCCCE-
Q ss_conf             9999999999876532420343112322266311257867899999999999982899579741454358898605989-
Q gi|254780782|r  269 EKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPV-  347 (389)
Q Consensus       269 ~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~~~iP~-  347 (389)
                      .+++.+++++.+.+... ..+++++++.....+|...  +..+++.+.+++++ .|.......+|+++|+.+++..+|+ 
T Consensus       298 l~~~~~~i~~~~~~ia~-~~gv~~~~~~~~~~~p~~~--d~~l~~~i~~aa~~-~g~~~~~m~SGAGHDA~~~a~~~Pt~  373 (413)
T PRK12892        298 LQRLVALLEALCNEIAA-RRGCRVDVDRIAEYAPAPC--DAALVDAIRAAAEA-AGGPYLEMPSGAGHDAQNLARIAPAA  373 (413)
T ss_pred             HHHHHHHHHHHHHHHHH-HCCCEEEEEEEECCCCCCC--CHHHHHHHHHHHHH-CCCCCEEECCCHHHHHHHHHHHCCEE
T ss_conf             99999999999999999-7197189999860798587--99999999999996-69997264750579999987448889


Q ss_pred             EEEEECCCCC-CCCCCEEEHHHHHHHHHHHHHHHHHHC
Q ss_conf             9990047873-687840479999999999999999872
Q gi|254780782|r  348 IEFGLVGRTM-HALNENASLQDLEDLTCIYENFLQNWF  384 (389)
Q Consensus       348 v~fGp~~~~~-H~pdE~i~i~~l~~~~~~~~~~i~~~~  384 (389)
                      +.|-|.-+++ |.|+||.+.+|+..++++|++++.++.
T Consensus       374 MiFVps~~GiSH~p~E~t~~eD~~~g~~vL~~~l~~LA  411 (413)
T PRK12892        374 MLFVPSKGGISHNPAEDTSIDDLVQGARVLADTLRRLA  411 (413)
T ss_pred             EEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             99804899846892326999999999999999999984


No 54 
>PRK12891 allantoate amidohydrolase; Reviewed
Probab=100.00  E-value=1.7e-38  Score=255.47  Aligned_cols=342  Identities=17%  Similarity=0.156  Sum_probs=256.8

Q ss_pred             HHHHHHHHHCCC----------CCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEE-CC--CCCEEEEEC
Q ss_conf             999999996499----------97899689999999999977984899970588876248999998-79--998899973
Q gi|254780782|r    5 CLEHLIQLIKCP----------SVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF-GT--EAPHLMFAG   71 (389)
Q Consensus         5 ~v~~l~~lv~ip----------s~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~-g~--~~~~ill~~   71 (389)
                      +.+.|.+|-+|=          +.|+.+..+.+|+.+||+++|++++..        .++|+|+++ |.  +.|.|++.|
T Consensus        12 l~~~l~~l~~iG~~p~gGvtR~a~s~ed~~ar~~~~~~~~~~Gl~v~~D--------~~GNl~g~~~g~~~~~p~il~GS   83 (414)
T PRK12891         12 LWASLERMAQIGATPKGGVCRLALTDLDRRARDLFVAWARDAGCTVRVD--------AMGNVFARRAGRRPDAAPVMTGS   83 (414)
T ss_pred             HHHHHHHHHHCCCCCCCCEEECCCCHHHHHHHHHHHHHHHHCCCEEEEC--------CCCCEEEEECCCCCCCCEEEECC
T ss_conf             9999999983389999975635289999999999999999869989882--------78888999258888988367645


Q ss_pred             CCCCCCCCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCCE----ECCCC
Q ss_conf             36815788877725666422452133236544333201245441000000011-35783499975202201----10442
Q gi|254780782|r   72 HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEGP----AINGT  146 (389)
Q Consensus        72 H~Dtvp~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~~----~~~G~  146 (389)
                      |+||||.|-    .|                  |---|+++.|++++.|.+++ ++..+|.++...+||+.    ++.||
T Consensus        84 HlDTVp~GG----~f------------------DG~lGVlaalev~~~l~~~g~~~~~~i~vv~f~~EEG~RF~~~~~GS  141 (414)
T PRK12891         84 HADSQPTGG----RY------------------DGIYGVLGGLEVVRALNDAGIETERPVDVVIWTNEEGSRFAPAMVSS  141 (414)
T ss_pred             CCCCCCCCC----CC------------------CCHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCCCCCCCCCCC
T ss_conf             435578887----51------------------63678899999999999739978999489998756476168753455


Q ss_pred             CCCCCCCCC--------------------CCCCCC---------EEE--ECCCCC---CCCCCEEEEEEEEEEEEEEEEE
Q ss_conf             111110001--------------------332120---------354--145665---4343100123222357999999
Q gi|254780782|r  147 KKMLSWIEK--------------------KGEKWD---------ACI--VGEPTC---NHIIGDTIKIGRRGSLSGEITI  192 (389)
Q Consensus       147 ~~l~~~~~~--------------------~~~~~d---------~~i--~~ep~~---~~~~~~~i~~g~rG~~~~~i~v  192 (389)
                      +.+.-.+..                    .+..++         +.+  .-|-+-   .....-.|+++-.|..++++++
T Consensus       142 ~~~~G~l~~e~~~~~~D~~G~sl~eal~~~G~~~~~~~~~~~i~a~lElHIEQGpvLe~~g~~iGIVtgI~G~~~~~v~~  221 (414)
T PRK12891        142 GVFFGVYTLEYGLSRRDDTGRTLGEELARIGYAGAEPVGGYPVHAAYELHIEQGAILERAGKTIGVVTAGQGQRWYEVTL  221 (414)
T ss_pred             HHHCCCCCHHHHHHCCCCCCCCHHHHHHHCCCCCCCCCCCCCCCEEEEEEECCCCCHHHCCCCEEEEEECCCCEEEEEEE
T ss_conf             01025789999972408789799999997499973346766743699998558750543699523884024526899999


Q ss_pred             EEECCCCHH-H-HCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHH
Q ss_conf             641231000-0-00120134554432011223344566442101466765542046665543211665134342067799
Q gi|254780782|r  193 HGKQGHVAY-P-HLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEK  270 (389)
Q Consensus       193 ~G~~~Hs~~-p-~~g~nAi~~~~~~i~~l~~~~~~~~~~~~~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~  270 (389)
                      +|+++|++. | +...+|+.++++++.++.+......    +.++.+++.|+.-+++.|+||++|++++|+|.......+
T Consensus       222 ~G~a~HAGtTPM~~R~DAl~aAa~~i~~~~~~a~~~~----~~~vaTvG~i~v~P~~~NvIPg~v~~~~DiR~~d~~~l~  297 (414)
T PRK12891        222 TGVDAHAGTTPMAFRRDALVGAARMIAFLDALGRRHA----PDARATVGMIDARPNSRNTVPGGCFFTVEFRHPDDAVLD  297 (414)
T ss_pred             EECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHC----CCEEEEEEEEEECCCCCCCCCCEEEEEEECCCCCHHHHH
T ss_conf             8348888888821212499999999999999999729----880786579995489745157558999986679989999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHCCCE-EE
Q ss_conf             99999999876532420343112322266311257867899999999999982899579741454358898605989-99
Q gi|254780782|r  271 TLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPV-IE  349 (389)
Q Consensus       271 ~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~~~iP~-v~  349 (389)
                      ++.+.+++.+.+... ..+++++++.....+|...  +..+.+.+.+++++ .|..+....+|+++|+.+++..+|+ +.
T Consensus       298 ~~~~~i~~~~~~ia~-~~g~~~~~~~~~~~~p~~~--d~~l~~~l~~aa~~-~g~~~~~m~SGAGHDA~~~a~~~Pt~Mi  373 (414)
T PRK12891        298 ELDAALRAELARIAD-ETGLGADIEPIFTYAPVPF--APRCIDAVRDAARA-LGLSHMDIVSGAGHDACYFARVAPTGMI  373 (414)
T ss_pred             HHHHHHHHHHHHHHH-HCCCEEEEEEEECCCCCCC--CHHHHHHHHHHHHH-CCCCCCEECCCHHHHHHHHHHHCCEEEE
T ss_conf             999999999999999-7298299999742898577--99999999999997-3999743065147999998734888899


Q ss_pred             EEECCCC-CCCCCCEEEHHHHHHHHHHHHHHHHHHC
Q ss_conf             9004787-3687840479999999999999999872
Q gi|254780782|r  350 FGLVGRT-MHALNENASLQDLEDLTCIYENFLQNWF  384 (389)
Q Consensus       350 fGp~~~~-~H~pdE~i~i~~l~~~~~~~~~~i~~~~  384 (389)
                      |-|.-++ .|.|+||.+.+|+.+++++|.+.+..+-
T Consensus       374 FVps~~GiSH~p~E~t~~eDi~~G~~vL~~~ll~lA  409 (414)
T PRK12891        374 FVPCVDGLSHNEAEAITPEWATAGADVLLRAVLASA  409 (414)
T ss_pred             EEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             727889987890117999999999999999999997


No 55 
>TIGR03176 AllC allantoate amidohydrolase. This enzyme catalyzes the breakdown of allantoate, first to ureidoglycine by hydrolysis and then decarboxylation of one of the two equivalent ureido groups. Ureidoglycine then spontaneously exchanges ammonia for water resulting in ureidoglycolate. This enzyme is an alternative to allantoicase (3.5.3.4) which releases urea.
Probab=100.00  E-value=2.6e-38  Score=254.27  Aligned_cols=344  Identities=18%  Similarity=0.232  Sum_probs=255.5

Q ss_pred             CHHHHHHHHHHHCC---CC-------CCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEE-CCC--CCEEE
Q ss_conf             87899999999649---99-------7899689999999999977984899970588876248999998-799--98899
Q gi|254780782|r    2 TPDCLEHLIQLIKC---PS-------VTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF-GTE--APHLM   68 (389)
Q Consensus         2 ~~e~v~~l~~lv~i---ps-------~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~-g~~--~~~il   68 (389)
                      -+.+.+.|.+|-+|   |.       .|+.+..+.+|+.+|++++|++++..        .++|+|+++ |.+  .|.|+
T Consensus         2 ~~Rl~~~l~~l~~ig~~~~gG~tRl~~s~~d~~ar~~~~~~~~~~Gl~v~~D--------~~GN~~g~~~G~~~~~p~v~   73 (406)
T TIGR03176         2 IKHFRQAIEELSSFGADPAGGMTRLLYSPEWLAAQQQFKKRMAESGLETRFD--------DVGNLYGRLVGTEFPEETIL   73 (406)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCEEECCCCHHHHHHHHHHHHHHHHCCCEEEEC--------CCCCEEEEECCCCCCCCEEE
T ss_conf             4899999999996189999955637279999999999999999869978882--------78878999448888988477


Q ss_pred             EECCCCCCCCCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCCE----EC
Q ss_conf             97336815788877725666422452133236544333201245441000000011-35783499975202201----10
Q gi|254780782|r   69 FAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEGP----AI  143 (389)
Q Consensus        69 l~~H~Dtvp~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~~----~~  143 (389)
                      +.||+||||.|-    .|                  |---|+++.|++++.|.+++ .+..+|.++.-.+||+.    ++
T Consensus        74 ~GSHlDTVp~GG----~y------------------DG~lGVla~le~l~~l~e~~~~~~~~i~vv~f~~EEg~RF~~~~  131 (406)
T TIGR03176        74 TGSHIDTVVNGG----NL------------------DGQFGALAAWLAVDYLKEKYGAPLRTVEVLSMAEEEGSRFPYVF  131 (406)
T ss_pred             EECCCCCCCCCC----CC------------------CCHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCCCCCCC
T ss_conf             734614577888----54------------------64778899999999999808988898699998367555556654


Q ss_pred             CCCCCCCCCCCC---------CCCCC---------C------------EEE--ECCCC-C--CCCCCEEEEEEEEEEEEE
Q ss_conf             442111110001---------33212---------0------------354--14566-5--434310012322235799
Q gi|254780782|r  144 NGTKKMLSWIEK---------KGEKW---------D------------ACI--VGEPT-C--NHIIGDTIKIGRRGSLSG  188 (389)
Q Consensus       144 ~G~~~l~~~~~~---------~~~~~---------d------------~~i--~~ep~-~--~~~~~~~i~~g~rG~~~~  188 (389)
                      -||+.+.-.+..         .+...         |            +.+  .-|-+ .  .....-.|+++-.|..++
T Consensus       132 lGS~~~~G~~~~~~~~~~~D~~G~tl~~al~~~G~~~~~~~~~~~~i~a~lElHIEQGpvLe~~~~~iGIVtgI~g~~r~  211 (406)
T TIGR03176       132 WGSKNIFGLAKPEDVRTIEDAKGIKFVDAMHACGFDLRKAPTVRDDIKAFVELHIEQGCVLESEGQSIGVVNAIVGQRRY  211 (406)
T ss_pred             CCHHHHHCCCCHHHHHHCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCEEEEEEEECCCCHHHHCCCCEEEEECCCCCEEE
T ss_conf             32577767999999960506688799999998188854465554461047899964775176679967797234552489


Q ss_pred             EEEEEEECCCCHH-H-HCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCEEEEECCCCCCH
Q ss_conf             9999641231000-0-0012013455443201122334456644210146676554204666554321166513434206
Q gi|254780782|r  189 EITIHGKQGHVAY-P-HLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDL  266 (389)
Q Consensus       189 ~i~v~G~~~Hs~~-p-~~g~nAi~~~~~~i~~l~~~~~~~~~~~~~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~  266 (389)
                      +++++|+++||+. | ....+|+..+++++.++.+......    .+...+++.|+.-+++.|+||+++++++|+|....
T Consensus       212 ~v~~~G~a~HaGtTPM~~R~DAl~aaa~~i~~~~~~a~~~~----~~~v~TvG~i~~~Pn~~NvIPg~v~f~lDiR~~d~  287 (406)
T TIGR03176       212 TVNLKGEANHAGTTPMSYRRDTVYAFSRICTQSIERAKEIG----DPLVLTFGKVEPVPNTVNVVPGETTFTIDCRHTDA  287 (406)
T ss_pred             EEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHC----CCEEEEEEEEEECCCCCCCCCCEEEEEEEEECCCH
T ss_conf             99983357987768846764269999999999999999619----98278999998159982333886899999216988


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHCCC
Q ss_conf             77999999999987653242034311232226631125786789999999999998289957974145435889860598
Q gi|254780782|r  267 WNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP  346 (389)
Q Consensus       267 ~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~~~iP  346 (389)
                      ...+.+.+++++.+.+... ..+++++++.....+|...  +..+++.+.+++++ .|..+....+|+++|+.+++..+|
T Consensus       288 ~~l~~~~~~l~~~~~~i~~-~~g~~~~~~~~~~~~p~~~--d~~l~~~i~~~a~~-~g~~~~~m~SGAGHDA~~~a~~~P  363 (406)
T TIGR03176       288 AVLRNFTKELENDMKAIAD-EMDITIDIDLWMDEAPVPM--NKEIVAIIEQLAKA-EKLNYRLMHSGAGHDAQIFAPRVP  363 (406)
T ss_pred             HHHHHHHHHHHHHHHHHHH-HHCCEEEEEEEEECCCCCC--CHHHHHHHHHHHHH-CCCCCCCCCCHHHHHHHHHHCCCC
T ss_conf             9999999999999999999-8198499999761798567--99999999999996-699975547507999999875098


Q ss_pred             EE-EEEECCCC-CCCCCCEEEHHHHHHHHHHHHHHHHHH
Q ss_conf             99-99004787-368784047999999999999999987
Q gi|254780782|r  347 VI-EFGLVGRT-MHALNENASLQDLEDLTCIYENFLQNW  383 (389)
Q Consensus       347 ~v-~fGp~~~~-~H~pdE~i~i~~l~~~~~~~~~~i~~~  383 (389)
                      +. .|-|.-++ .|.|.||.+.+|+.++++++.+++.++
T Consensus       364 taMIFVps~~GiSH~p~E~t~~eD~~~G~~vL~~~l~~L  402 (406)
T TIGR03176       364 TAMIFVPSIGGISHNPAERTNIEDLVEGVKTLADMLYEL  402 (406)
T ss_pred             EEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             899981389983699232799999999999999999998


No 56 
>PRK13799 unknown domain/N-carbamoyl-L-amino acid hydrolase fusion protein; Provisional
Probab=100.00  E-value=9.4e-38  Score=250.86  Aligned_cols=326  Identities=18%  Similarity=0.190  Sum_probs=244.7

Q ss_pred             CHHHHHHHHHHHHHHCCC-EEEEEEECCCCCCEEEEEEEEE-C--CCCCEEEEECCCCCCCCCCHHHCCCCCCCEEEECC
Q ss_conf             968999999999997798-4899970588876248999998-7--99988999733681578887772566642245213
Q gi|254780782|r   21 QDGGAFFILVNTLKLLGF-SIEEKDFQTKNTSIVKNLYARF-G--TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEG   96 (389)
Q Consensus        21 ~e~~~~~~l~~~l~~~G~-~~~~~~~~~~~~~~~~~~~~~~-g--~~~~~ill~~H~Dtvp~~~~~~W~~~Pf~~~~~~g   96 (389)
                      ....+++.+..||++.|| ++++        ..++|+++++ |  ++.|+|++.||+||||.|-    .|        ||
T Consensus       212 ~h~~~~~~~~~wMr~aG~deV~I--------DAvGNl~GR~eG~~p~ap~l~~GSHlDTVpnGG----~y--------DG  271 (591)
T PRK13799        212 AHRACANQISDWMRDAGFDEVEI--------DAVGNVVGRYKAADDDAKTLITGSHYDTVRNGG----KY--------DG  271 (591)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEE--------CCCCCEEEEECCCCCCCCEEEEECCCCCCCCCC----CC--------CC
T ss_conf             99999999999999809977998--------677546888037999998888877603677886----57--------71


Q ss_pred             CCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCCE----ECCCCCCCCCCCCC----------------
Q ss_conf             3236544333201245441000000011-35783499975202201----10442111110001----------------
Q gi|254780782|r   97 KIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEGP----AINGTKKMLSWIEK----------------  155 (389)
Q Consensus        97 ~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~~----~~~G~~~l~~~~~~----------------  155 (389)
                      .          -|+++.|++++.|.+++ .++.+|.|+...|||+.    ++.||+.+.-.+..                
T Consensus       272 ~----------LGVla~le~v~~L~e~g~~~~~~iEVV~F~dEEGsRF~~s~lGS~alaG~~~~~~l~~~D~dGitl~eA  341 (591)
T PRK13799        272 R----------EGIFLAIACVKELHEQGERLPFHFEVIAFAEEEGQRFKATFLGSGALIGDFNMELLDIKDADGISLREA  341 (591)
T ss_pred             H----------HHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCCCEEHHHHHCCCCHHHHHCCCCCCCCHHHH
T ss_conf             8----------999999999999998099999986999874667766788640289886799989983528899899999


Q ss_pred             ---CCCCCCE-------------EE--ECCCC---CCCCCCEEEEEEEEEEEEEEEEEEEECCCCHH-H-HCCCCHHHHH
Q ss_conf             ---3321203-------------54--14566---54343100123222357999999641231000-0-0012013455
Q gi|254780782|r  156 ---KGEKWDA-------------CI--VGEPT---CNHIIGDTIKIGRRGSLSGEITIHGKQGHVAY-P-HLTENPIRGL  212 (389)
Q Consensus       156 ---~~~~~d~-------------~i--~~ep~---~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~-p-~~g~nAi~~~  212 (389)
                         .+..++.             .+  .-|=+   ........|+++-.|..+++|+++|+++|+|. | ....+|+..+
T Consensus       342 l~~~Gl~~~~i~~~~r~~~~i~aFlELHIEQGPVLE~~glpIGVVTgI~G~~r~~vtv~G~a~HAGTTPM~~RrDAl~AA  421 (591)
T PRK13799        342 IQHAGHCIDAIPKIARDPADVLGFIEVHIEQGPVLLELDIPLGIVTSIAGSARYICEFIGMASHAGTTPMDMRKDAAAAA  421 (591)
T ss_pred             HHHCCCCHHHCCCCCCCHHHHEEEEEEEECCCHHHHHCCCCEEEEEEECCCEEEEEEEEEECCCCCCCCHHHHHHHHHHH
T ss_conf             99859995772210278142105689885468588878996668821136368999999777888898725431099999


Q ss_pred             HHHHHCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCE
Q ss_conf             44320112233445664421014667655420466655432116651343420677999999999987653242034311
Q gi|254780782|r  213 IPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSH  292 (389)
Q Consensus       213 ~~~i~~l~~~~~~~~~~~~~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~  292 (389)
                      ++++..+++......   ......+||.++.-+++.|+||++|++++|+|.......+.+.+.+++.+.+...+ .++++
T Consensus       422 Aelil~ve~~a~~~~---~~~~VaTVG~i~v~Pns~NVIPG~V~ftlDiR~~d~~~ld~~~~~i~~~i~~Ia~~-rgv~~  497 (591)
T PRK13799        422 AEIALYIEKRAAQDQ---HASLVATMGQLNVPSGSTNVIPGRCQFSLDIRAATDEIRDAAVADILAEIAAIAAR-RGIEY  497 (591)
T ss_pred             HHHHHHHHHHHHHHC---CCCEEEEEEEEEECCCCCCEECCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHH-HCCEE
T ss_conf             999999999998606---99857998899726998665897179999842899899999999999999999998-09838


Q ss_pred             EEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHCCCEE-EEEEC-CCC-CCCCCCEEEHHHH
Q ss_conf             23222663112578678999999999999828995797414543588986059899-99004-787-3687840479999
Q gi|254780782|r  293 TVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVI-EFGLV-GRT-MHALNENASLQDL  369 (389)
Q Consensus       293 ~i~~~~~~~p~~~~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~~~iP~v-~fGp~-~~~-~H~pdE~i~i~~l  369 (389)
                      +++.....+|...  +..+.+.+.+++++ .|.++....+|+++|+.+++..+|+. .|-|. +.+ .|.|.|+.+.+|+
T Consensus       498 ~~e~~~~~~pv~~--d~~l~~~le~aa~~-lG~~~~~mpSGAGHDA~~mA~v~PtaMIFVps~~gGISHnP~E~ts~eDi  574 (591)
T PRK13799        498 KAELAMKAAAAPC--APELMKQLEAATDA-AGVPLFELASGAGHDAMKIAEIMDQAMLFTRCGNAGISHNPLESMTADDM  574 (591)
T ss_pred             EEEEEECCCCCCC--CHHHHHHHHHHHHH-CCCCCEEECCCCHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCCHHHH
T ss_conf             9998732898678--99999999999997-79996242777369999997448878998311899869890317999999


Q ss_pred             HHHHHHHHHHHHHH
Q ss_conf             99999999999987
Q gi|254780782|r  370 EDLTCIYENFLQNW  383 (389)
Q Consensus       370 ~~~~~~~~~~i~~~  383 (389)
                      ..+++++.++|.++
T Consensus       575 ~lav~al~~~L~~L  588 (591)
T PRK13799        575 ELSADAFLDFLNNF  588 (591)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999999999998


No 57 
>TIGR01879 hydantase amidase, hydantoinase/carbamoylase family; InterPro: IPR010158   Enzymes in this subfamily hydrolyse the amide bonds of compounds containing carbamoyl groups or hydantoin rings . These enzymes are members of the broader family of amidases.; GO: 0016813 hydrolase activity acting on carbon-nitrogen (but not peptide) bonds in linear amidines, 0008152 metabolic process.
Probab=100.00  E-value=4.7e-38  Score=252.72  Aligned_cols=341  Identities=18%  Similarity=0.211  Sum_probs=257.9

Q ss_pred             HHHHHHHHCCC-------CCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEEC-CC--CCEEEEECCCCC
Q ss_conf             99999996499-------978996899999999999779848999705888762489999987-99--988999733681
Q gi|254780782|r    6 LEHLIQLIKCP-------SVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG-TE--APHLMFAGHIDV   75 (389)
Q Consensus         6 v~~l~~lv~ip-------s~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g-~~--~~~ill~~H~Dt   75 (389)
                      +..|++.=+-|       +.|.++.++.+++++||++.|+.++..        .++|||+|+. .+  .+.|++.||+||
T Consensus         7 L~~l~evG~~~~~G~~RL~~S~E~r~~~~~~~~~mr~~Gl~v~~D--------~~GNL~gr~~G~~p~~~~vl~GSHlDt   78 (406)
T TIGR01879         7 LMELGEVGADPEGGVTRLALSEEDREAKDLVKKRMRAAGLEVEID--------EVGNLIGRKEGTEPDLEVVLVGSHLDT   78 (406)
T ss_pred             HHHHHCCCCCCCCCCEECCCCHHHHHHHHHHHHHHHHCCCEEEEC--------CCCCCEECCCCCCCCCCEEEEECCHHC
T ss_conf             666530365786542222478778999999999998659817652--------522302106787888772788222102


Q ss_pred             CCCCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCCE----ECCCCCCCC
Q ss_conf             5788877725666422452133236544333201245441000000011-35783499975202201----104421111
Q gi|254780782|r   76 VPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEGP----AINGTKKML  150 (389)
Q Consensus        76 vp~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~~----~~~G~~~l~  150 (389)
                      |+.|-                      -.|--=|+.|-+.++++|.++. .+.++|.|+.-++||+.    ++.||+.+.
T Consensus        79 v~nGG----------------------~fDG~lGvLAg~evv~~l~~~~v~~~h~ieVvA~~~EEGSRF~~~~~GS~~~~  136 (406)
T TIGR01879        79 VVNGG----------------------KFDGVLGVLAGIEVVRALKEASVVPAHPIEVVAFTEEEGSRFAYGMIGSRAMV  136 (406)
T ss_pred             CCCCC----------------------CCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCCCCCHHHCCHHHC
T ss_conf             37987----------------------20636678999999999874679724766799841777661330131102311


Q ss_pred             CCCCCC---------CCC----CCEE-EECCCCCCC-----------CC---------------CEEEEEEEEEEEEEEE
Q ss_conf             100013---------321----2035-414566543-----------43---------------1001232223579999
Q gi|254780782|r  151 SWIEKK---------GEK----WDAC-IVGEPTCNH-----------II---------------GDTIKIGRRGSLSGEI  190 (389)
Q Consensus       151 ~~~~~~---------~~~----~d~~-i~~ep~~~~-----------~~---------------~~~i~~g~rG~~~~~i  190 (389)
                      -.....         +..    .+.+ +=.+|+..+           ++               .-.|+.|-.|..|++|
T Consensus       137 G~~~P~~v~~~cd~~G~S~~~Alk~~GfG~Dpd~~~~~~~~~~~~kaYvELHIEQG~vLE~~G~~iGvV~ai~G~~w~~v  216 (406)
T TIGR01879       137 GALKPEDVEAVCDKKGISLAEALKAIGFGLDPDLANQALREIGDIKAYVELHIEQGPVLEENGLPIGVVEAIAGVIWLKV  216 (406)
T ss_pred             CCCCHHHHHHHHHHCCCCHHHHHHHCCCCCCCCCCCCCCCCCCCEEEEEEEEECCCCHHHHCCCCEEEEEECCCCEEEEE
T ss_conf             48885799986221288389999845887476878878888751578998632013044546881578871345278998


Q ss_pred             EEEEECCCCHH-HH-CCCCHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHH
Q ss_conf             99641231000-00-01201345544320112233445664421014667655420466655432116651343420677
Q gi|254780782|r  191 TIHGKQGHVAY-PH-LTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWN  268 (389)
Q Consensus       191 ~v~G~~~Hs~~-p~-~g~nAi~~~~~~i~~l~~~~~~~~~~~~~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~  268 (389)
                      ++.|.++|||. |. ...+|+.++++++.+....-..   ..-.|+..++|+++.-+++.||||++++|++|+|....+.
T Consensus       217 ~~~G~s~HAG~~PM~lR~D~l~Aas~i~~~~e~~A~~---d~~~p~VGTvG~v~~~Pn~~NviPg~v~f~~D~R~~~~~~  293 (406)
T TIGR01879       217 TLAGESEHAGTTPMSLRRDPLVAASKIILEVEEKAKR---DMGDPTVGTVGKVEAAPNGVNVIPGKVTFTLDLRDLDAAV  293 (406)
T ss_pred             EECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH---CCCCCCEECCEEEEECCCCEEEECCCEEEEEECCCCCHHH
T ss_conf             8626366678889864102899999999999999741---5787810000347506896642068268998426714789


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHCCCE-
Q ss_conf             9999999999876532420343112322266311257867899999999999982899579741454358898605989-
Q gi|254780782|r  269 EKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPV-  347 (389)
Q Consensus       269 ~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~~~iP~-  347 (389)
                      .+++.++|.+.++..+ +..++.++++......|...  +..+++.+.+.+++ .+..+....+|+++|+.+++..+|+ 
T Consensus       294 l~~~~~~l~~~~~~is-~er~~~~~i~~~~~~~PV~~--~~~~v~a~~~~c~~-l~~~~~~~~SGAGHDA~~lA~i~p~~  369 (406)
T TIGR01879       294 LSKLTKELEEEIKAIS-DERDIELEIERVMEKEPVLC--SEELVDALKELCEE-LGYDARVMVSGAGHDAVILAPIVPIG  369 (406)
T ss_pred             HHHHHHHHHHHHHHHC-CCCCCHHHHHHHHHCCCCCC--CHHHHHHHHHHHHH-CCCCCCEEECCCHHHHHHHCCCCCEE
T ss_conf             9999999999998630-20473355566642589653--87999999998986-08998534026320156541688510


Q ss_pred             EEEEECCCCC-CCCCCEEEHHHHHHHHHHHHHHHHHH
Q ss_conf             9990047873-68784047999999999999999987
Q gi|254780782|r  348 IEFGLVGRTM-HALNENASLQDLEDLTCIYENFLQNW  383 (389)
Q Consensus       348 v~fGp~~~~~-H~pdE~i~i~~l~~~~~~~~~~i~~~  383 (389)
                      ++|=|..+++ |+|-||..++|+..|+++|+..+.++
T Consensus       370 MiFipS~nGiSH~p~E~s~~~d~a~G~~vL~~~v~~l  406 (406)
T TIGR01879       370 MIFIPSINGISHNPAEWSEIEDCAEGAKVLYEAVLQL  406 (406)
T ss_pred             EEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             3786364885367001378888888999999999619


No 58 
>PRK13590 putative bifunctional OHCU decarboxylase/allantoate amidohydrolase; Provisional
Probab=100.00  E-value=6.4e-37  Score=245.76  Aligned_cols=324  Identities=16%  Similarity=0.167  Sum_probs=243.9

Q ss_pred             CHHHHHHHHHHHHHHCCC-EEEEEEECCCCCCEEEEEEEEE-C--CCCCEEEEECCCCCCCCCCHHHCCCCCCCEEEECC
Q ss_conf             968999999999997798-4899970588876248999998-7--99988999733681578887772566642245213
Q gi|254780782|r   21 QDGGAFFILVNTLKLLGF-SIEEKDFQTKNTSIVKNLYARF-G--TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEG   96 (389)
Q Consensus        21 ~e~~~~~~l~~~l~~~G~-~~~~~~~~~~~~~~~~~~~~~~-g--~~~~~ill~~H~Dtvp~~~~~~W~~~Pf~~~~~~g   96 (389)
                      ....+++.+..||++.|| ++++        ..++|+++++ |  ++.|+|++.||+||||.|-    .|        ||
T Consensus       211 ~h~~~~~~~~~wMr~aG~deV~i--------DavGNl~GR~eG~~P~ap~l~~GSHlDTVpnGG----~y--------DG  270 (590)
T PRK13590        211 AHRACAQQLSHWMRDCGFDEVHI--------DAVGNVVGRYHGSDPSARRLLTGSHYDTVRNGG----KY--------DG  270 (590)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEE--------CCCCCEEEEECCCCCCCCEEEEECCCCCCCCCC----CC--------CC
T ss_conf             99999999999999809976988--------777657887048999998888877613688886----57--------71


Q ss_pred             CCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCCE----ECCCCCCCCCCCCCC--------CCCC---
Q ss_conf             3236544333201245441000000011-35783499975202201----104421111100013--------3212---
Q gi|254780782|r   97 KIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEGP----AINGTKKMLSWIEKK--------GEKW---  160 (389)
Q Consensus        97 ~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~~----~~~G~~~l~~~~~~~--------~~~~---  160 (389)
                      .          -|+++-|++++.|.+++ .++.+|.|+...|||+.    ++-||+.+.-.+...        +...   
T Consensus       271 ~----------lGVl~~le~v~~L~~~G~~l~~~iEVV~F~dEEG~RF~~~~lGSralaG~~~~~~L~~~D~dGisl~eA  340 (590)
T PRK13590        271 R----------LGIFVPMACVRELHRAGRRLPFGLEVVGFAEEEGQRYKATFLGSGALIGDFDPAWLDQKDADGITMREA  340 (590)
T ss_pred             H----------HHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCCCCCHHHHHCCCCHHHHHCCCCCCCCHHHH
T ss_conf             8----------999999999999998389999876999972667767787642389886799979982628799899999


Q ss_pred             --CEEEEC--------CCCC----------------CCCCCEEEEEEEEEEEEEEEEEEEECCCCHH-H-HCCCCHHHHH
Q ss_conf             --035414--------5665----------------4343100123222357999999641231000-0-0012013455
Q gi|254780782|r  161 --DACIVG--------EPTC----------------NHIIGDTIKIGRRGSLSGEITIHGKQGHVAY-P-HLTENPIRGL  212 (389)
Q Consensus       161 --d~~i~~--------ep~~----------------~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~-p-~~g~nAi~~~  212 (389)
                        .+.+..        .|..                .......|+++-.|..+++++++|+++|+|. | ....+|+..+
T Consensus       341 l~~~Gl~~~~i~~~~r~~~~i~afvELHIEQGPVLE~~g~pIGVVtgI~G~~r~~vtv~G~a~HAGTTPM~~RrDAl~aA  420 (590)
T PRK13590        341 MQQAGLCIDDIPKLRRDAARYLGFVEVHIEQGPVLNELDLPLGVVTSINGSVRYVGEIIGMASHAGTTPMDRRRDAATAV  420 (590)
T ss_pred             HHHCCCCHHHCCHHCCCCHHHHEEEEEHHHCCHHHHHCCCCEEEECCCCCCEEEEEEEEEECCCCCCCCHHHHCCHHHHH
T ss_conf             99749894672021168211002021030037688977997779821156278999998418998888745522399999


Q ss_pred             HHHHHCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCE
Q ss_conf             44320112233445664421014667655420466655432116651343420677999999999987653242034311
Q gi|254780782|r  213 IPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSH  292 (389)
Q Consensus       213 ~~~i~~l~~~~~~~~~~~~~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~  292 (389)
                      ++++..+++.....     +.+..+||.++.-+++.|+||++|++++|+|.+.....+.+.+++++.+.+.+. ..++++
T Consensus       421 Aelil~ve~~a~~~-----~~~VaTVG~i~v~Pns~NVIPG~v~ftlDiR~~~d~~~~~~~~~i~~~~~~Ia~-~rgl~~  494 (590)
T PRK13590        421 AELALYVEQRAAAD-----GDSVGTVGMLEVPGGSINVVPGRCRFSLDLRAPTDAQRDALAADVLAQLEAIAE-RRGLHY  494 (590)
T ss_pred             HHHHHHHHHHHHHC-----CCEEEEEEEEEECCCCCCEECCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHH-HCCCCE
T ss_conf             99999999998637-----986999999960699754168748999982489989999999999999999999-849937


Q ss_pred             EEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHCCCEE-EEEECCC-CC-CCCCCEEEHHHH
Q ss_conf             23222663112578678999999999999828995797414543588986059899-9900478-73-687840479999
Q gi|254780782|r  293 TVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVI-EFGLVGR-TM-HALNENASLQDL  369 (389)
Q Consensus       293 ~i~~~~~~~p~~~~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~~~iP~v-~fGp~~~-~~-H~pdE~i~i~~l  369 (389)
                      +++.....+|...  +..+.+.+.+++++ .|.+.....+|+++|+.+++..+|+. .|-|..+ ++ |.|.||.+.+|+
T Consensus       495 ~~e~~~~~~p~~~--d~~l~~~le~aa~~-lG~~~~~m~SGAGHDA~~ma~i~PtaMIFVps~dGGISHnP~E~ts~eDi  571 (590)
T PRK13590        495 TLEETMRAAAAPS--APAWQRRWEAAVAA-LGLPVHRMPSGAGHDAMKLHEIMPQAMLFVRGENAGISHNPLESTTSDDM  571 (590)
T ss_pred             EEEEEECCCCCCC--CHHHHHHHHHHHHH-CCCCCCCCCCCCHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCHHHH
T ss_conf             9999851799779--99999999999997-69997401877269999997548879996002999839791426899999


Q ss_pred             HHHHHHHHHHHHHH
Q ss_conf             99999999999987
Q gi|254780782|r  370 EDLTCIYENFLQNW  383 (389)
Q Consensus       370 ~~~~~~~~~~i~~~  383 (389)
                      ..+++++.++|.++
T Consensus       572 ~lav~~~~~~l~~L  585 (590)
T PRK13590        572 QLAVEAFSHLLNQL  585 (590)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999999999998


No 59 
>COG1473 AbgB Metal-dependent amidase/aminoacylase/carboxypeptidase [General function prediction only]
Probab=100.00  E-value=1.2e-35  Score=237.91  Aligned_cols=365  Identities=21%  Similarity=0.269  Sum_probs=267.5

Q ss_pred             CCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEECC--CCCEEEEECCCCCCCC
Q ss_conf             98789999999964999789968999999999997798489997058887624899999879--9988999733681578
Q gi|254780782|r    1 MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT--EAPHLMFAGHIDVVPP   78 (389)
Q Consensus         1 l~~e~v~~l~~lv~ips~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g~--~~~~ill~~H~Dtvp~   78 (389)
                      +.+++++.-++|.++|..|.+|...++|++++|+++|+++..  ......+    +.+++++  ++|+|.|.+-||-.|.
T Consensus        10 ~~~~l~~~rr~lH~~PEL~f~E~~Ta~~i~~~L~~~g~~~~~--~~~~~TG----vva~~~~g~~g~tIalRAD~DALPi   83 (392)
T COG1473          10 LKDELIEWRRDLHEHPELGFEEYRTAAYIAEKLEELGFEVVE--VGGGKTG----VVATLKGGKPGPTIALRADMDALPI   83 (392)
T ss_pred             HHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCEEEE--CCCCCEE----EEEEECCCCCCCEEEEEEECCCCCC
T ss_conf             369999999998638764415899999999999976983673--1677628----9999737999977999961366752


Q ss_pred             CCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCC-CCCCCCEEEEEEEECCCEECCCCCCCCCCCCCCC
Q ss_conf             887772566642245213323654433320124544100000001-1357834999752022011044211111000133
Q gi|254780782|r   79 GDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK-YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKG  157 (389)
Q Consensus        79 ~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~-~~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~~~  157 (389)
                      -+..+   -||.- ..+|++++.|- |  +..+..|.|++.|.+. ....++|.|+|++.||+++  |++.+++.-.-..
T Consensus        84 ~E~t~---~~~~S-~~~G~mHACGH-D--~Hta~lLgaA~~L~~~~~~~~Gtv~~ifQPAEE~~~--Ga~~mi~~G~~~~  154 (392)
T COG1473          84 QEETG---LPFAS-KNPGVMHACGH-D--GHTAILLGAALALAEHKDNLPGTVRLIFQPAEEGGG--GAKAMIEDGVFDD  154 (392)
T ss_pred             CCCCC---CCCCC-CCCCCCCCCCC-H--HHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCC--CHHHHHHCCCCCC
T ss_conf             01358---97545-89997602776-5--999999999999995264089579999365014653--2799986677556


Q ss_pred             CCCCEEEECCCCCCCCCCEE-EEEE--EEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCE
Q ss_conf             21203541456654343100-1232--22357999999641231000000120134554432011223344566442101
Q gi|254780782|r  158 EKWDACIVGEPTCNHIIGDT-IKIG--RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPT  234 (389)
Q Consensus       158 ~~~d~~i~~ep~~~~~~~~~-i~~g--~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~~~~~~~~~~~  234 (389)
                      . +|+++-.++......+.. +.-|  .-+...++++++|+++|++.||.++||+.+++.++..|+.+.....+. ..+.
T Consensus       155 ~-vD~v~g~H~~p~~~~g~v~~~~G~~~aa~d~~~i~~~GkggH~a~Ph~~~d~i~aa~~~v~~lq~ivsr~~~p-~~~~  232 (392)
T COG1473         155 F-VDAVFGLHPGPGLPVGTVALRPGALMAAADEFEITFKGKGGHAAAPHLGIDALVAAAQLVTALQTIVSRNVDP-LDSA  232 (392)
T ss_pred             C-CCEEEEECCCCCCCCCEEEEECCCCEEECCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC-CCCE
T ss_conf             6-5579996588999886078404652256145899999677665786445298999999999999987445687-6670


Q ss_pred             EEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHH
Q ss_conf             46676554204666554321166513434206779999999999876532420343112322266311257867899999
Q gi|254780782|r  235 NMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSL  314 (389)
Q Consensus       235 ~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~  314 (389)
                      .++++.+++| .+.||||+++++.+.+|....+..+++.+++++ +.+......++++++++...+++...  +..+.+.
T Consensus       233 vv~vg~~~aG-~a~NVIpd~A~l~gtvR~~~~~~~~~~~~~i~~-ia~g~a~~~g~~~ei~~~~~~p~~~N--d~~~~~~  308 (392)
T COG1473         233 VVTVGKIEAG-TAANVIPDSAELEGTIRTFSDEVREKLEARIER-IAKGIAAAYGAEAEIDYERGYPPVVN--DPALTDL  308 (392)
T ss_pred             EEEEEEECCC-CCCCCCCCEEEEEEEEECCCHHHHHHHHHHHHH-HHHHHHHHHCCEEEEEECCCCCCCCC--CHHHHHH
T ss_conf             8999995278-758858873699999605998999999999999-99999998697699996378987037--9999999


Q ss_pred             HHHHHHHHHCCCC---EEE-ECCCCCHHHHHHHCCCEEEE--EECC-CC----CCCCCCEEEHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999828995---797-41454358898605989999--0047-87----368784047999999999999999987
Q gi|254780782|r  315 LSKSIYNTTGNIP---LLS-TSGGTSDARFIKDYCPVIEF--GLVG-RT----MHALNENASLQDLEDLTCIYENFLQNW  383 (389)
Q Consensus       315 l~~a~~~~~g~~~---~~~-~~gg~~d~~~~~~~iP~v~f--Gp~~-~~----~H~pdE~i~i~~l~~~~~~~~~~i~~~  383 (389)
                      +.+++++..+..-   ... .+.|++|..++.+.+|...|  |.+. ..    .|.|.=-++-+.+..++++++.+..+|
T Consensus       309 ~~~~~~~~~~~~~~~~~~~~~~~gsEDf~~~~~~~Pg~~~~lG~~~~~~~~~~~H~p~~~~de~~l~~g~~~~~~~~~~~  388 (392)
T COG1473         309 LAEAAEEVGGEEVVVVELPPSMAGSEDFGYYLEKVPGAFFFLGTGSADGGTYPLHHPKFDFDEAALATGVKLLAALALLY  388 (392)
T ss_pred             HHHHHHHHCCCCCEECCCCCCCCCCCHHHHHHHHCCEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             99999985164401025677887634288999867835999506867788666658767778899999999999999987


Q ss_pred             CCC
Q ss_conf             247
Q gi|254780782|r  384 FIT  386 (389)
Q Consensus       384 ~~~  386 (389)
                      +..
T Consensus       389 ~~~  391 (392)
T COG1473         389 LAK  391 (392)
T ss_pred             HCC
T ss_conf             612


No 60 
>TIGR01891 amidohydrolases amidohydrolase; InterPro: IPR010168   Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site . The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases .   Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins.   Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule.    This entry represents a clade of the amidohydrolases. They classified as metallopeptidases belonging to MEROPS peptidase family M20 (clan MH), subfamily M20D. Included within this group are hydrolases of hippurate (N-benzylglycine), indoleacetic acid (IAA) N-conjugates of amino acids, N-acetyl-L-amino acids and aminobenzoylglutamate. These hydrolases are of the carboxypeptidase-type, most likely utilizing a zinc ion in the active site.   In higher plants, the growth hormone indole-3-acetic acid (IAA or auxin) is stored conjugated to sugar moieties via an ester linkage or to amino acids or peptides via an amide. More than 950f the hormone in a plant can be found in the conjugated form, leaving only a small amount of free hormone available to stimulate and control cellular growth. The overall levels of active IAA in a plant can be controlled not only by the amount of IAA synthesized, but also by the quantity of IAA that is released from the conjugated state into the free state. Amidohydrolases cleave the amide bond between the auxin and the conjugated amino acid. Several IAA amidohydrolases have been isolated from Aarabidopsis thaliana, each of these enzymes has different substrate specificities. The A. thaliana IAA amidohydrolase, IAR3, is able to cleave IAA-Alanine, while products of the other amidohydrolase genes, known as the ILR1-like family of hydrolases (ILR1, ILL1, ILL2, ILL3, and ILL5), cleave primarily IAA-Phenylalanine and IAA-Leucine ..
Probab=100.00  E-value=3.4e-34  Score=229.03  Aligned_cols=332  Identities=20%  Similarity=0.252  Sum_probs=243.6

Q ss_pred             HHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHC-CCEEEE-EEECCCCCCEEEEEEEEECCC--CC-EEEEECCCCCCCCC
Q ss_conf             99999999649997899689999999999977-984899-970588876248999998799--98-89997336815788
Q gi|254780782|r    5 CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLL-GFSIEE-KDFQTKNTSIVKNLYARFGTE--AP-HLMFAGHIDVVPPG   79 (389)
Q Consensus         5 ~v~~l~~lv~ips~s~~e~~~~~~l~~~l~~~-G~~~~~-~~~~~~~~~~~~~~~~~~g~~--~~-~ill~~H~Dtvp~~   79 (389)
                      +++.-++|.+.|-.|.+|-..+.+|++.|+++ |++++. ..-...   ...-++++++.+  +| +|.|.+-||--|..
T Consensus         1 l~~iRr~lH~~PEls~~Ef~T~~~~a~~L~~~~G~~v~~g~~~~k~---~ltgv~~~~~~~~pgp~~vALRAD~DALP~~   77 (384)
T TIGR01891         1 LVDIRRHLHEHPELSFEEFKTSALIAEALESLGGIEVRRGVGGAKE---ALTGVVATIGGGKPGPPVVALRADMDALPIE   77 (384)
T ss_pred             CHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCEEEECCCCCCCC---CCEEEEEEECCCCCCCCEEEEEEEECCCCCC
T ss_conf             9046889870787652555538999999972698297468898865---2248999815897897179998101027765


Q ss_pred             CHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCC--C-CCCCCEEEEEEEECCCE--ECCCCCCCCCCCC
Q ss_conf             87772566642245213323654433320124544100000001--1-35783499975202201--1044211111000
Q gi|254780782|r   80 DFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK--Y-KNFGSISLLITGDEEGP--AINGTKKMLSWIE  154 (389)
Q Consensus        80 ~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~--~-~~~~~i~~~~~~dEE~~--~~~G~~~l~~~~~  154 (389)
                      +...--.-||+ ...+|.+.++|- |   .+++++.++..++++  . ...|+|+|+|+|.||.+  |..|+.++++.  
T Consensus        78 e~~~G~~~p~~-S~~~GvmHACGH-D---~H~A~lLG~A~~L~~~~~~~~~G~v~liFQPAEE~~~~G~~Ga~~mi~~--  150 (384)
T TIGR01891        78 EQTDGFALPYK-SKNPGVMHACGH-D---LHTAILLGTAKLLKKLADRLLEGTVRLIFQPAEEGGPEGLGGATKMIED--  150 (384)
T ss_pred             CCCCCEECCCC-CCCCCEEEECCH-H---HHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCHHCCCCCCCCHHHHHHH--
T ss_conf             45453342620-148875663661-5---8999999999998862276556468997206300467874444899970--


Q ss_pred             CCCCC-CCEEEECCCCCCCCCCEEEE-EE--EEEEEEEEEEEEEECCCC-HHHHCCCCHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             13321-20354145665434310012-32--223579999996412310-000001201345544320112233445664
Q gi|254780782|r  155 KKGEK-WDACIVGEPTCNHIIGDTIK-IG--RRGSLSGEITIHGKQGHV-AYPHLTENPIRGLIPLLHQLTNIGFDTGNT  229 (389)
Q Consensus       155 ~~~~~-~d~~i~~ep~~~~~~~~~i~-~g--~rG~~~~~i~v~G~~~Hs-~~p~~g~nAi~~~~~~i~~l~~~~~~~~~~  229 (389)
                      -.... +|+++-.++......+..-+ .+  .-+.-.++++++|++||+ +.||.|+|||.++++++.+|..+.... -.
T Consensus       151 G~lddfVD~~~g~H~~p~~~~g~~~~~~g~~~A~~D~F~~~~~G~gaHa~a~Ph~g~da~~~~~~~~~~l~~i~sR~-~~  229 (384)
T TIGR01891       151 GVLDDFVDAILGLHVDPSIPAGTVGLRPGTIMAAADKFEVTIKGKGAHAAARPHLGKDAIDAAAQLVVALQQIVSRN-VD  229 (384)
T ss_pred             CCCCCCEEEEEEECCCCCCCCCEEEEECCCEEEECCEEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHEEE-CC
T ss_conf             36575040123422458856556674055212100258999997521434788665576999999998774443100-35


Q ss_pred             CCCCEEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCC--CCCCCCCC
Q ss_conf             4210146676554204666554321166513434206779999999999876532420343112322266--31125786
Q gi|254780782|r  230 TFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP--VSPVFLTH  307 (389)
Q Consensus       230 ~~~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~--~~p~~~~~  307 (389)
                      -..+..++++.|++|+.+.||||++|++.+++|....+..+++.+++++. .+......++++++++...  +.|..++ 
T Consensus       230 p~~~~V~~~g~~~aG~~~~NVIPd~A~~~gt~R~~~~~~~~~~~~r~~~i-~~~~a~~~g~~~e~~~~~~~~~~P~~~N-  307 (384)
T TIGR01891       230 PLEPAVVSVGKIEAGNIAPNVIPDKASMSGTVRSLDPEVRDQIEDRIERI-VEGAAAAYGAKVELNYDRGKSYLPAVTN-  307 (384)
T ss_pred             CCCCCEEEEEEECCCCCCCCEECCEEEEEEEEECCCHHHHHHHHHHHHHH-HHHHHHHHCCEEEEEECCCCCCCCCCCC-
T ss_conf             33573477899616864785540548999997348989999999999999-9998876475489986268542664567-


Q ss_pred             HHHHHHHHHHHHHHHHCCCCE---EEECCCCCHHHHHHHCCCEEE
Q ss_conf             789999999999998289957---974145435889860598999
Q gi|254780782|r  308 DRKLTSLLSKSIYNTTGNIPL---LSTSGGTSDARFIKDYCPVIE  349 (389)
Q Consensus       308 ~~~l~~~l~~a~~~~~g~~~~---~~~~gg~~d~~~~~~~iP~v~  349 (389)
                      |..+.+.+.++.+++.+....   +...-|++|..++...+|...
T Consensus       308 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GsEDF~~~~~~~P~~~  352 (384)
T TIGR01891       308 DPALTEILKEAAREVVGEEEVAEDPEVTMGSEDFAYYLQKVPGAF  352 (384)
T ss_pred             CHHHHHHHHHHHHHHCCHHHHHCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             689999999998852051343105786534223889999840122


No 61 
>COG2195 PepD Di- and tripeptidases [Amino acid transport and metabolism]
Probab=100.00  E-value=2.2e-33  Score=224.01  Aligned_cols=362  Identities=17%  Similarity=0.116  Sum_probs=262.5

Q ss_pred             CCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE-----ECCCCCCEEEEEEEEE-CC--CCCEEEEECC
Q ss_conf             98789999999964999789968999999999997798489997-----0588876248999998-79--9988999733
Q gi|254780782|r    1 MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKD-----FQTKNTSIVKNLYARF-GT--EAPHLMFAGH   72 (389)
Q Consensus         1 l~~e~v~~l~~lv~ips~s~~e~~~~~~l~~~l~~~G~~~~~~~-----~~~~~~~~~~~~~~~~-g~--~~~~ill~~H   72 (389)
                      +.+.+++.+.+|++||+.|.++..++.++++|++.+|+.++ .+     +.+.....-..+.++. +.  .-|++.|.+|
T Consensus         3 ~~~~l~~~F~~~~kI~~~S~~e~~~~p~~~~~~k~~~~~v~-dE~~~i~~~~~a~~~~~~~~~~L~a~~d~V~~i~~~sh   81 (414)
T COG2195           3 KMERLLDRFLELVKIPTQSKHEKAVAPSTVGQAKLLGLLVE-DELGNIGLKKPATAGENYVPAVLQAHLDMVPEIGFISH   81 (414)
T ss_pred             CHHHHHHHHHHHEECCCCCCCCCCCCCCCHHHHHHCCCHHH-HHHCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCCCC
T ss_conf             47899999887720777887643136022889987176134-44056664345557777046885236676661355455


Q ss_pred             CCCCCCCC----HHHC------------------C---CCCCCEEEEC-CCCCCCCC----CCCCCHHHHHHHHCCCCCC
Q ss_conf             68157888----7772------------------5---6664224521-33236544----3332012454410000000
Q gi|254780782|r   73 IDVVPPGD----FNHW------------------T---YPPFSATIAE-GKIYGRGI----VDMKGSIACFIAAVARFIP  122 (389)
Q Consensus        73 ~Dtvp~~~----~~~W------------------~---~~Pf~~~~~~-g~l~GrG~----~D~Kg~ia~~l~a~~~l~~  122 (389)
                      |||+|...    ...|                  -   +.|......+ +-+.-.|+    +|+|+|++.++.|+..+.+
T Consensus        82 ~Dt~~d~~~~~v~~~~l~~~~Gad~i~~~~~~a~L~~~~~P~~~~~t~~~ei~~dGa~LLgaD~kAGia~i~~al~~~~~  161 (414)
T COG2195          82 HDTVPDPIGPNVNPQILKATLGADNIGLAIGLAVLSPEHFPLEVLLTGDEEITTDGATLLGADDKAGIAEIMTALSVLRE  161 (414)
T ss_pred             CCCCCCCCCCCCCCCEEEECCCCCHHHHHHHHHHCCCCCCCCEEEEECCEEEECCCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             46524654466576525503585136555577643766687024322426884268521377625679999999898763


Q ss_pred             C--CCCCCCEEEEEEEECCCEECCCCCCCCCC--CCCCCCCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCC
Q ss_conf             1--13578349997520220110442111110--0013321203541456654343100123222357999999641231
Q gi|254780782|r  123 K--YKNFGSISLLITGDEEGPAINGTKKMLSW--IEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGH  198 (389)
Q Consensus       123 ~--~~~~~~i~~~~~~dEE~~~~~G~~~l~~~--~~~~~~~~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~H  198 (389)
                      .  ..++++|.+.|+++||.++. |+..+...  ..+.++..|      ++..+    .+.....+...+++++.|+..|
T Consensus       162 ~~~~i~h~~i~~g~s~~Ee~g~r-g~~~~~~a~f~a~~ay~iD------Gg~~g----~i~~ea~~~~~~~~~~~g~~~h  230 (414)
T COG2195         162 KHPEIPHGGIRGGFSPDEEIGGR-GAANKDVARFLADFAYTLD------GGPVG----EIPREAFNAAAVRATIVGPNVH  230 (414)
T ss_pred             CCCCCCCCCEEEEECCHHHHHHH-HHHHCCHHHHHCCEEEECC------CCCCC----EEEEECCCHHEEEEEEECCCCC
T ss_conf             47653306738885625876323-5652468664100047537------98667----1534042100455444246767


Q ss_pred             CHH-HHCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             000-0001201345544320112233445664421014667655420466655432116651343420677999999999
Q gi|254780782|r  199 VAY-PHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIR  277 (389)
Q Consensus       199 s~~-p~~g~nAi~~~~~~i~~l~~~~~~~~~~~~~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~  277 (389)
                      ++. ....+||+..+.+++..+.....+..      ++.+.|..+ ++...|.|.+++.....+|.......+......+
T Consensus       231 ~~~a~~~~i~a~~~a~e~~~~~~~~~~~e~------t~~~~Gv~~-~~~~~~~V~~~s~~~~~iR~~d~~~~~s~~~~~~  303 (414)
T COG2195         231 PGSAKGKMINALLLAAEFILELPLEEVPEL------TEGPEGVYH-LGDSTNSVEETSLNLAIIRDFDNLLFRARKDSMK  303 (414)
T ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCCCCCCC------CCCCCEEEE-CCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHH
T ss_conf             450277776688865547632776567200------256601786-2435662676564556676056166887699999


Q ss_pred             HHHHHHHHHHC-CCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHH-HCCCEEE--EEEC
Q ss_conf             98765324203-431123222663112578678999999999999828995797414543588986-0598999--9004
Q gi|254780782|r  278 SRLIKGIQNVP-KLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIE--FGLV  353 (389)
Q Consensus       278 ~~l~~~~~~~~-~~~~~i~~~~~~~p~~~~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~-~~iP~v~--fGp~  353 (389)
                      +.+++..+... ....+++....|+.+...+++.+++.+.++++++... |....++|++|++.++ .+.|+..  .|| 
T Consensus       304 ~~~~~~~~~~g~~~~~~~~~~~~Yp~~~~~~~~~iv~~a~~a~~~l~~~-p~v~~i~gGtd~~~is~~g~p~~~i~~Gp-  381 (414)
T COG2195         304 DVVEEMAASLGKLAGAELEVKDSYPGWKIKPDSPLVDLAKKAYKELGIK-PKVKPIHGGTDGGVLSFKGLPTPNISTGP-  381 (414)
T ss_pred             HHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHCCC-CEEEEEECCCCHHHHHCCCCCCCEEECCC-
T ss_conf             9999999974112655999954665767799726999999999983789-75888304664055523578974685014-


Q ss_pred             CCCCCCCCCEEEHHHHHHHHHHHHHHHHHH
Q ss_conf             787368784047999999999999999987
Q gi|254780782|r  354 GRTMHALNENASLQDLEDLTCIYENFLQNW  383 (389)
Q Consensus       354 ~~~~H~pdE~i~i~~l~~~~~~~~~~i~~~  383 (389)
                      ..++|+++||++++++.+..+++.++++.+
T Consensus       382 ~~n~Hs~~E~v~I~s~ek~~~~l~~l~~~~  411 (414)
T COG2195         382 GENPHSPDEFVSIESMEKAVQVLVELLKLA  411 (414)
T ss_pred             CCCCCCCCCEEEHHHHHHHHHHHHHHHHHH
T ss_conf             667888661533588899999999999975


No 62 
>TIGR01882 peptidase-T peptidase T; InterPro: IPR010161   Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site . The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases .   Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins.   Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule.    This entry represents metallopeptidases belonging to MEROPS peptidase family M20 (clan MH), subfamily M20B. They are tripeptide aminopeptidases commonly known as Peptidase T, which have a substrate preference for hydrophobic peptides.; GO: 0008270 zinc ion binding, 0016285 cytosol alanyl aminopeptidase activity, 0045148 tripeptide aminopeptidase activity, 0006518 peptide metabolic process, 0005737 cytoplasm.
Probab=99.95  E-value=4.4e-27  Score=185.30  Aligned_cols=350  Identities=18%  Similarity=0.200  Sum_probs=247.3

Q ss_pred             HHHHHHHHHHHCCCCCCCCH----------HHHHH-HHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEECCC----CCEE
Q ss_conf             78999999996499978996----------89999-999999977984899970588876248999998799----9889
Q gi|254780782|r    3 PDCLEHLIQLIKCPSVTPQD----------GGAFF-ILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE----APHL   67 (389)
Q Consensus         3 ~e~v~~l~~lv~ips~s~~e----------~~~~~-~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g~~----~~~i   67 (389)
                      +++++++.++|++.|.|.+.          ...+. .|.+-|+++|+.  -+.+...+    +-|+|++..+    =|+|
T Consensus         3 e~llpRFl~YVKVntrSDEnsdt~PST~~~~~f~~n~~~~dlk~lGl~--D~hy~e~n----GyViatiPsNtdkdVp~i   76 (413)
T TIGR01882         3 EELLPRFLKYVKVNTRSDENSDTTPSTEAEVEFAKNVLVEDLKELGLK--DVHYDEKN----GYVIATIPSNTDKDVPKI   76 (413)
T ss_pred             CCCCCHHCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCC--CEEECCCC----CEEEEECCCCCCCCCCEE
T ss_conf             222001142575103126767788885788865423678999870840--11001258----718985477866667612


Q ss_pred             EEECCCCCC-CCCCHHHC---------------------CCCC--------CCE----EEECCCCCCCCCCCCCCHHHHH
Q ss_conf             997336815-78887772---------------------5666--------422----4521332365443332012454
Q gi|254780782|r   68 MFAGHIDVV-PPGDFNHW---------------------TYPP--------FSA----TIAEGKIYGRGIVDMKGSIACF  113 (389)
Q Consensus        68 ll~~H~Dtv-p~~~~~~W---------------------~~~P--------f~~----~~~~g~l~GrG~~D~Kg~ia~~  113 (389)
                      .|.+|+||- .- +.++-                     ..+|        |++    +-++..|-|   +|+|+|||-+
T Consensus        77 GfLAH~DTAtDF-n~enVnPQI~enYDGes~i~lgd~eftLdP~~fPnL~~YKGqTlittdGtTLLG---~d~K~GiaEi  152 (413)
T TIGR01882        77 GFLAHVDTATDF-NAENVNPQILENYDGESVIQLGDLEFTLDPEDFPNLKKYKGQTLITTDGTTLLG---ADDKAGIAEI  152 (413)
T ss_pred             EEEECCCCCCCC-CCCCCCCCEEECCCCCCEEEECCEEEEECCCCCCCCCCCCCCEEEECCCCCCCC---CCCCCCHHHH
T ss_conf             012201100022-567877755203688504550650176272217642258876788516861116---6533428899


Q ss_pred             HHHCCCCCC-CCC-CCCCEEEEEEEECCCEECCCCCCCCCCCCCCCCCCCEEE--ECCCCCCCCCCEEEEEEEEEEEEEE
Q ss_conf             410000000-113-578349997520220110442111110001332120354--1456654343100123222357999
Q gi|254780782|r  114 IAAVARFIP-KYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACI--VGEPTCNHIIGDTIKIGRRGSLSGE  189 (389)
Q Consensus       114 l~a~~~l~~-~~~-~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~~~~~~d~~i--~~ep~~~~~~~~~i~~g~rG~~~~~  189 (389)
                      |+++.+|+. ... .||.|.|.|+||||.|-  |+..+-   .+++. .|++.  -|+|-+  ..++.-.    ....+.
T Consensus       153 MT~adYL~~ihPe~kHG~IRvaFtPDEEIG~--Ga~kFD---VkdF~-adFAyTVDGgplG--eL~yetF----sAA~a~  220 (413)
T TIGR01882       153 MTLADYLLNIHPEVKHGKIRVAFTPDEEIGV--GAEKFD---VKDFD-ADFAYTVDGGPLG--ELEYETF----SAAAAK  220 (413)
T ss_pred             HHHHHHHHHCCCCCCCCEEEECCCCCCCCCC--CCCCCC---EEECC-CCEEEECCCCCCC--CCCCCCC----CCCCCE
T ss_conf             9999998504896103737744568724477--965033---00047-8553551788887--6565440----100107


Q ss_pred             EEEEEECCCCHHH-HCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHH
Q ss_conf             9996412310000-001201345544320112233445664421014667655420466655432116651343420677
Q gi|254780782|r  190 ITIHGKQGHVAYP-HLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWN  268 (389)
Q Consensus       190 i~v~G~~~Hs~~p-~~g~nAi~~~~~~i~~l~~~~~~~~~~~~~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~  268 (389)
                      |+++|+--|-|.. ...+||+..++++=+.|.+...++.++=... -++.-+++ |.      |+++.+..=||-.....
T Consensus       221 i~i~G~NVHPgtAKg~MiNa~~~aid~hn~LPe~drPE~TeGrEG-FfHLLs~d-Gt------veea~l~YIIRDfe~~~  292 (413)
T TIGR01882       221 IEIQGKNVHPGTAKGKMINAVQVAIDYHNLLPEDDRPEKTEGREG-FFHLLSLD-GT------VEEAKLAYIIRDFEKEK  292 (413)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC-CEEEECCC-CC------HHHCCCEEEEEECCCCC
T ss_conf             775021007400123678899999877423764567887688640-10220147-78------51101013464125575


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEEECCCC--CCCCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHH-HCC
Q ss_conf             99999999998765324203431123222663--112578678999999999999828995797414543588986-059
Q gi|254780782|r  269 EKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV--SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYC  345 (389)
Q Consensus       269 ~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~--~p~~~~~~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~~-~~i  345 (389)
                      .+.=++.+++.+++.-.+...-++.+.....|  -.-...++=.++..+++|++. .|.+|......|+||++-++ .|.
T Consensus       293 f~eRK~l~k~iv~kmn~E~G~~Rikl~~nDQYYNMa~~iek~~~IvdiAk~Amen-lgiep~i~PiRGGTDGSqlsyMGL  371 (413)
T TIGR01882       293 FEERKELMKEIVEKMNDEYGQDRIKLDMNDQYYNMAEKIEKDMEIVDIAKKAMEN-LGIEPKIEPIRGGTDGSQLSYMGL  371 (413)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHCCCCCCHHHHHHHHHHH-CCCCEEECCCCCCCCCCCCEECCC
T ss_conf             2568999999999987651756423352632112587515643024788999985-699610045457876121001678


Q ss_pred             CEEEEEECCCCCCCCCCEEEHHHHHHHHHHHHHHHHHH
Q ss_conf             89999004787368784047999999999999999987
Q gi|254780782|r  346 PVIEFGLVGRTMHALNENASLQDLEDLTCIYENFLQNW  383 (389)
Q Consensus       346 P~v~fGp~~~~~H~pdE~i~i~~l~~~~~~~~~~i~~~  383 (389)
                      ||--+-.|+.|+|+.=||++++++.|.+.++.++++.+
T Consensus       372 PtPNiFaGgENmHGrfEy~sv~~M~KaVdv~~eia~ln  409 (413)
T TIGR01882       372 PTPNIFAGGENMHGRFEYVSVESMVKAVDVLVEIAKLN  409 (413)
T ss_pred             CCCCCCCCCCCCCCEEEEEEECCCHHHHHHHHHHHHHH
T ss_conf             78764558867765168887545055899999999986


No 63 
>COG4187 RocB Arginine degradation protein (predicted deacylase) [Amino acid transport and metabolism]
Probab=99.94  E-value=4.2e-26  Score=179.32  Aligned_cols=218  Identities=22%  Similarity=0.318  Sum_probs=159.7

Q ss_pred             HHHHHHHHHHHCCCCCCC--CHHHHHHHHHHHHHHCCC-EEEEEEECC---CCCC-EEEEEEEEE-C-CCCCEEEEECCC
Q ss_conf             789999999964999789--968999999999997798-489997058---8876-248999998-7-999889997336
Q gi|254780782|r    3 PDCLEHLIQLIKCPSVTP--QDGGAFFILVNTLKLLGF-SIEEKDFQT---KNTS-IVKNLYARF-G-TEAPHLMFAGHI   73 (389)
Q Consensus         3 ~e~v~~l~~lv~ips~s~--~e~~~~~~l~~~l~~~G~-~~~~~~~~~---~~~~-~~~~~~~~~-g-~~~~~ill~~H~   73 (389)
                      .++-.++.+||+.||+++  .|...+++|...|.++.+ +-+..++..   .+.. .+.|++|-. | +..+||++.||+
T Consensus         8 e~v~~lt~~LV~~~SvtgT~GE~a~ad~l~~vL~~~pYFqehped~~~~pi~nDpygR~nv~AlVrg~~~k~tvvl~gH~   87 (553)
T COG4187           8 ERVRALTLSLVSWPSVTGTPGEGAFADRLLGVLGELPYFQEHPEDLWLQPIHNDPYGRRNVFALVRGGTSKRTVVLHGHF   87 (553)
T ss_pred             HHHHHHHHHHEECCCCCCCCCCCCHHHHHHHHHHCCCHHHHCHHHHCCCCCCCCCCCCCEEEEEEECCCCCCEEEEEECC
T ss_conf             99999998870020247986632088999999715825553947650257778866541169998458877348996033


Q ss_pred             CCCCCC---CHHHCCCCCC----------CE----E----EECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEE
Q ss_conf             815788---8777256664----------22----4----5213323654433320124544100000001135783499
Q gi|254780782|r   74 DVVPPG---DFNHWTYPPF----------SA----T----IAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISL  132 (389)
Q Consensus        74 Dtvp~~---~~~~W~~~Pf----------~~----~----~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~~~~~i~~  132 (389)
                      |||-+.   +...-.+||.          +.    +    .-++||+|||+.|||+|+|+.|+.++.+.+.....|+|.|
T Consensus        88 DtV~iedYg~lKd~Afdp~~ll~~~i~~~e~~~erv~~Dl~SGDwlfGRGa~DMKsGlav~la~L~~fa~~~~~~GNlLf  167 (553)
T COG4187          88 DTVSIEDYGELKDLAFDPLALLDALIESLELREERVLRDLESGDWLFGRGALDMKSGLAVHLACLEEFAARTDRQGNLLF  167 (553)
T ss_pred             CEEECCCCCCHHHHCCCHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCEEE
T ss_conf             24541236626643369899999999862158898864354068455777212220059999999998627787775799


Q ss_pred             EEEEECCCEECCCCCCCCCCCCCCCC----CCCEEEECCCCCCCCCCE---EEEEEEEEEEEEEEEEEEECCCCHHHHCC
Q ss_conf             97520220110442111110001332----120354145665434310---01232223579999996412310000001
Q gi|254780782|r  133 LITGDEEGPAINGTKKMLSWIEKKGE----KWDACIVGEPTCNHIIGD---TIKIGRRGSLSGEITIHGKQGHVAYPHLT  205 (389)
Q Consensus       133 ~~~~dEE~~~~~G~~~l~~~~~~~~~----~~d~~i~~ep~~~~~~~~---~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g  205 (389)
                      +.++|||.-+ .|++..+..+.....    .+-+||-.++++.+..|.   -+++|.-|-+-.-.-|.|+..|+|+|..|
T Consensus       168 ~a~pdEE~~s-~G~r~a~~~L~~L~kk~~l~~~~~IN~D~~~~~~dGd~~ryvYtGtiGKLLp~f~vvG~etHvG~~f~G  246 (553)
T COG4187         168 MAVPDEEVES-RGMREARPALPGLKKKFDLEYTAAINLDVTSDQGDGDQGRYVYTGTIGKLLPFFFVVGCETHVGYPFEG  246 (553)
T ss_pred             EECCCHHHHC-CCHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCCCCEEEEECCCHHHCCEEEEEEECCCCCCCCCC
T ss_conf             8466054202-128877788888777508537887314444678898644178823203102135897411336776467


Q ss_pred             CCHHHHHHHHHHCCCC
Q ss_conf             2013455443201122
Q gi|254780782|r  206 ENPIRGLIPLLHQLTN  221 (389)
Q Consensus       206 ~nAi~~~~~~i~~l~~  221 (389)
                      +||-.++++++.+|.-
T Consensus       247 vnan~maSei~~~le~  262 (553)
T COG4187         247 VNANFMASEITRRLEL  262 (553)
T ss_pred             CCHHHHHHHHHHHHHC
T ss_conf             7788899999998515


No 64 
>COG1363 FrvX Cellulase M and related proteins [Carbohydrate transport and metabolism]
Probab=99.73  E-value=4e-15  Score=111.90  Aligned_cols=323  Identities=18%  Similarity=0.220  Sum_probs=159.3

Q ss_pred             HHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEECC-CC-CEEEEECCCCCCCCCC
Q ss_conf             789999999964999789968999999999997798489997058887624899999879-99-8899973368157888
Q gi|254780782|r    3 PDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT-EA-PHLMFAGHIDVVPPGD   80 (389)
Q Consensus         3 ~e~v~~l~~lv~ips~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g~-~~-~~ill~~H~Dtvp~~~   80 (389)
                      .+..++|++|+.+|++|+.|.++.+++++.|++++.+++.        ...+|+++++++ ++ |.|++.+|||++=.  
T Consensus         2 ~~~~~~LkeL~~~~gpsG~E~eVr~~~~~el~~~~~ev~~--------D~lGnlia~~~g~~g~~~imi~AHmDEiG~--   71 (355)
T COG1363           2 EELLELLKELLEAPGPSGYEEEVRDVLKEELEPLGDEVEV--------DRLGNLIAKKGGKNGPPKVMIAAHMDEIGF--   71 (355)
T ss_pred             HHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHCCCEEE--------CCCCCEEEEECCCCCCCCEEEEEECCEEEE--
T ss_conf             6799999999739899984799999999999870874488--------678738999168899832789860451103--


Q ss_pred             HHHCCCCCCCE--EEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCC-CEEEEEEEEC-CCEECCCC--CCCCCCCC
Q ss_conf             77725666422--4521332365443332012454410000000113578-3499975202-20110442--11111000
Q gi|254780782|r   81 FNHWTYPPFSA--TIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFG-SISLLITGDE-EGPAINGT--KKMLSWIE  154 (389)
Q Consensus        81 ~~~W~~~Pf~~--~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~~~~-~i~~~~~~dE-E~~~~~G~--~~l~~~~~  154 (389)
                               -.  ..+||+|.=+    .-||+.....           .+ ++.+ ++..+ ...|.-|+  .|+...-.
T Consensus        72 ---------mV~~I~~~G~Lr~~----~iGG~~~~~~-----------~gq~v~i-~t~~g~~i~GvIg~~p~H~~~~~~  126 (355)
T COG1363          72 ---------MVKEIEDDGFLRFV----PIGGWDPQVL-----------EGQRVTI-HTDKGKKIRGVIGSKPPHLLKEEA  126 (355)
T ss_pred             ---------EEEEECCCCEEEEE----ECCCCCHHHC-----------CCCEEEE-EECCCCEEEEEECCCCCCCCCCCC
T ss_conf             ---------78898789659999----7179674340-----------5767999-948986875166166750157300


Q ss_pred             CCC--CCCCEEEECCCCCCCC--CCEEEEEEEEEEEEEEEEEEEECCCCHHHHCC-CCHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             133--2120354145665434--31001232223579999996412310000001-201345544320112233445664
Q gi|254780782|r  155 KKG--EKWDACIVGEPTCNHI--IGDTIKIGRRGSLSGEITIHGKQGHVAYPHLT-ENPIRGLIPLLHQLTNIGFDTGNT  229 (389)
Q Consensus       155 ~~~--~~~d~~i~~ep~~~~~--~~~~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g-~nAi~~~~~~i~~l~~~~~~~~~~  229 (389)
                      ++.  ...+-..+-.+.....  ....|..|...+..-+.+.-.. ++-....+- +=....+.+++.+|+  ..+....
T Consensus       127 ~~~~~~~~~el~iDiga~skeea~~lGI~vGd~v~~~~~~~~l~~-~~v~skalDdR~gva~lle~lk~l~--~~~~~~~  203 (355)
T COG1363         127 ERKKPPEWDELFIDIGASSKEEAEELGIRVGDFVVFDPRFRELAN-GRVVSKALDDRAGVAALLELLKELK--GIELPAD  203 (355)
T ss_pred             CCCCCCCHHHEEEECCCCCHHHHHHCCCCCCCEEEECCCEEEECC-CCEEEEECCCHHHHHHHHHHHHHHC--CCCCCCE
T ss_conf             346788533189977859999999549899988997686089369-8187122540675999999999850--6789952


Q ss_pred             CCCCEEEEEEEEE--EC----CCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCC
Q ss_conf             4210146676554--20----46665543211665134342067799999999998765324203431123222663112
Q gi|254780782|r  230 TFSPTNMEITTID--VG----NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV  303 (389)
Q Consensus       230 ~~~~~~~~i~~i~--~g----~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~  303 (389)
                           +.-+.+++  .|    ..+.+-|....-+-+|+-..-. .+.. .   ..    ...  .+-...+.......++
T Consensus       204 -----vy~v~tvqEEVGlrGA~~~a~~i~pd~aiavd~~~~~d-~~~~-~---~~----~~~--lg~Gp~i~~~D~~~~~  267 (355)
T COG1363         204 -----VYFVASVQEEVGLRGAKTSAFRIKPDIAIAVDVTPAGD-TPGV-P---KG----DVK--LGKGPVIRVKDASGIY  267 (355)
T ss_pred             -----EEEEEECCHHHCCCHHHCCCCCCCCCEEEEEECCCCCC-CCCC-C---CC----CCC--CCCCCEEEEECCCCCC
T ss_conf             -----99999631210562132263326986799973454567-8887-6---55----555--5898779997699888


Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCEEEECC-CCCHHHHH---HHCCCEEEEEECCCCCCCCCCEEEHHHHHHHHHHHHHH
Q ss_conf             578678999999999999828995797414-54358898---60598999900478736878404799999999999999
Q gi|254780782|r  304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSG-GTSDARFI---KDYCPVIEFGLVGRTMHALNENASLQDLEDLTCIYENF  379 (389)
Q Consensus       304 ~~~~~~~l~~~l~~a~~~~~g~~~~~~~~g-g~~d~~~~---~~~iP~v~fGp~~~~~H~pdE~i~i~~l~~~~~~~~~~  379 (389)
                          +..+.+.+.+..++ .+++......+ |+||+..+   ..++|+.++|++.+..|+|.|.++++|+..+.+++..+
T Consensus       268 ----~~~l~~~L~~~A~~-~~Ip~Q~~v~~~ggTDA~a~~~~g~gvpta~Igip~ry~Hs~~e~~~~~D~~~~~~Ll~~~  342 (355)
T COG1363         268 ----HPKLRKFLLELAEK-NNIPYQVDVSPGGGTDAGAAHLTGGGVPTALIGIPTRYIHSPVEVAHLDDLEATVKLLVAY  342 (355)
T ss_pred             ----CHHHHHHHHHHHHH-CCCCEEEEECCCCCCCHHHHHHCCCCCCEEEEECCCCCCCCCCEEECHHHHHHHHHHHHHH
T ss_conf             ----98999999999998-5997699945788753899987279971688742503445851565499999999999999


Q ss_pred             HHHHC
Q ss_conf             99872
Q gi|254780782|r  380 LQNWF  384 (389)
Q Consensus       380 i~~~~  384 (389)
                      ++.+-
T Consensus       343 i~~~~  347 (355)
T COG1363         343 LESLD  347 (355)
T ss_pred             HHHCC
T ss_conf             97345


No 65 
>pfam07687 M20_dimer Peptidase dimerization domain. This domain consists of 4 beta strands and two alpha helices which make up the dimerization surface of members of the M20 family of peptidases. This family includes a range of zinc metallopeptidases belonging to several families in the peptidase classification. Family M20 are Glutamate carboxypeptidases. Peptidase family M25 contains X-His dipeptidases.
Probab=99.73  E-value=9.9e-18  Score=127.89  Aligned_cols=104  Identities=37%  Similarity=0.489  Sum_probs=91.9

Q ss_pred             EEEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCEEEEE
Q ss_conf             32223579999996412310000001201345544320112233445664421014667655420466655432116651
Q gi|254780782|r  180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSF  259 (389)
Q Consensus       180 ~g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~~~~~~~~~~~~~~i~~i~~g~~~~NvIP~~a~~~~  259 (389)
                      +|+||.++++++++|+++|||+|+.|+|||..+++++.+|++...+.. ....+++++++.|++| ...|+||++|++.+
T Consensus         1 ~~~kG~~~~~i~v~G~~~Hss~p~~g~nAi~~~~~~i~~l~~~~~~~~-~~~~~~t~~i~~i~gG-~~~NviP~~a~~~~   78 (107)
T pfam07687         1 IGHKGLAGGHLTVKGKAGHSGAPGLGVNAIKLLARLLAELPAEYGDIG-FDFPRTTLNITGIEGG-TATNVIPAEAEAKF   78 (107)
T ss_pred             CCCCCEEEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCC-CCCCCCEEEEEEEECC-CCCCEECCEEEEEE
T ss_conf             926858899999997216767875576999999999999863255333-6799988999999668-76867773999999


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             34342067799999999998765324
Q gi|254780782|r  260 NIRFNDLWNEKTLKEEIRSRLIKGIQ  285 (389)
Q Consensus       260 diR~~~~~~~~~i~~~i~~~l~~~~~  285 (389)
                      |+|+.|.++.+++.+++++.+.+...
T Consensus        79 d~R~~p~~~~~~v~~~i~~~~~~~~~  104 (107)
T pfam07687        79 DIRLLPGEDLEELLKEIEAILEKEAP  104 (107)
T ss_pred             EEECCCCCCHHHHHHHHHHHHHHHCC
T ss_conf             99769989999999999999998546


No 66 
>TIGR03106 trio_M42_hydro hydrolase, peptidase M42 family. This model describes a subfamily of MEROPS peptidase family M42, a glutamyl aminopeptidase family that also includes the cellulase CelM from Clostridium thermocellum and deblocking aminopeptidases that can remove acylated amino acids. Members of this family occur in a three gene cassette with an amidotransferase (TIGR03104)in the asparagine synthase (glutamine-hydrolyzing) family, and a probable acetyltransferase (TIGR03103) in the GNAT family.
Probab=99.72  E-value=4.8e-15  Score=111.37  Aligned_cols=324  Identities=16%  Similarity=0.165  Sum_probs=154.8

Q ss_pred             CHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEE-CC-CCCEEEEECCCCCCCCC
Q ss_conf             87899999999649997899689999999999977984899970588876248999998-79-99889997336815788
Q gi|254780782|r    2 TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF-GT-EAPHLMFAGHIDVVPPG   79 (389)
Q Consensus         2 ~~e~v~~l~~lv~ips~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~-g~-~~~~ill~~H~Dtvp~~   79 (389)
                      ++.++++|++|+.+||+|+.|++++++++++|+.++.+++.        ...+|+++++ |. +.|.+++.+|||.+=  
T Consensus         2 ~~~~~e~L~~L~~~~gpSG~E~~v~~~i~~~l~~~~dev~~--------D~~Gnvi~~~~G~~~~~~vml~AHmDEIG--   71 (343)
T TIGR03106         2 TDYLTETLLALLAIPSPTGFTDAVVRYVAERLEDLGIEYEL--------TRRGAIRATLPGREATPARAVVTHLDTLG--   71 (343)
T ss_pred             HHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHCCEEEE--------CCCCEEEEEECCCCCCCCEEEEEEECEEC--
T ss_conf             68999999999759998966599999999999861874898--------78964999976888886289999612304--


Q ss_pred             CHHHCCCCCCCE--EEECCCCC--CCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCEECCCCCCCCCCC-C
Q ss_conf             877725666422--45213323--654433320124544100000001135783499975202201104421111100-0
Q gi|254780782|r   80 DFNHWTYPPFSA--TIAEGKIY--GRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWI-E  154 (389)
Q Consensus        80 ~~~~W~~~Pf~~--~~~~g~l~--GrG~~D~Kg~ia~~l~a~~~l~~~~~~~~~i~~~~~~dEE~~~~~G~~~l~~~~-~  154 (389)
                               |-.  ..++|.|+  ..|-.|.+--...-   +..+-+.    +.+.=.+.      ....+.++...- .
T Consensus        72 ---------~mV~~I~~~GfL~~~~lGG~~~~~l~gq~---v~i~t~~----g~~~Gvi~------~~~~~~h~~~~e~~  129 (343)
T TIGR03106        72 ---------AMVRELKDNGRLELVPIGHWSARFAEGAR---VTIFTDS----GEFRGTIL------PLKASGHAFNEEID  129 (343)
T ss_pred             ---------EEEEEECCCCEEEEEECCCCCCCCCCCCE---EEEEECC----CEEEEEEC------CCCCCCCCCCHHHH
T ss_conf             ---------89999878977999957995743236648---9999389----21888988------88887565764453


Q ss_pred             CCCCCC---CEEEECCCCCCC-CCCEEEEEEEEEEEE--EEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             133212---035414566543-431001232223579--99999641231000000120134554432011223344566
Q gi|254780782|r  155 KKGEKW---DACIVGEPTCNH-IIGDTIKIGRRGSLS--GEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGN  228 (389)
Q Consensus       155 ~~~~~~---d~~i~~ep~~~~-~~~~~i~~g~rG~~~--~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~~~~~  228 (389)
                      +.....   +..|...-.+.. .....|..|-.-...  ++..-.++  =+|....-+=....+.+++.+|++...+...
T Consensus       130 ~~~~~~~~~~l~iDig~~s~eEa~~lGV~iGd~v~~~~~~~~l~~~~--i~~kalDdR~g~~~l~e~l~~l~~~~~~~~~  207 (343)
T TIGR03106       130 SQPTGWDHVEVRVDARASCRADLVRLGISVGDFVAFDPQPEFLANGF--IVSRHLDDKAGVAALLAALKAIVEHKVPLPV  207 (343)
T ss_pred             CCCCCCCCCEEEEECCCCCHHHHHHCCCCCCCEEEECCCEEEECCCE--EEEEECCCHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             24678755369996784999999856988899799889508906987--9843344404199999999999972999982


Q ss_pred             CCCCCEEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCH
Q ss_conf             44210146676554204666554321166513434206779999999999876532420343112322266311257867
Q gi|254780782|r  229 TTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHD  308 (389)
Q Consensus       229 ~~~~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~  308 (389)
                      ..+-  .+++-. +.|..+.+.|+..+.+.+++-..+....             ......+...  .......|+    +
T Consensus       208 ~vy~--v~tvQE-EVG~~aa~~i~pdia~~i~vd~a~~~p~-------------~~~~e~G~~i--~~~D~~~~~----~  265 (343)
T TIGR03106       208 DVHP--LFTITE-EVGSGASHALPPDVAELVSVDNGTVAPG-------------QNSSEHGVTI--AMADSSGPF----D  265 (343)
T ss_pred             EEEE--EEECCH-HCCCCHHCCCCCCEEEEEEEECCCCCCC-------------CCCCCCCCEE--EEECCCCCC----C
T ss_conf             2999--997101-0171011247987058999853678999-------------8656778568--740687887----8


Q ss_pred             HHHHHHHHHHHHHHHCCCCEEEE-CCCCCHHHHH---HHCCCEEEEEECCCCCCCCCCEEEHHHHHHHHHHHHHHHHHHC
Q ss_conf             89999999999998289957974-1454358898---6059899990047873687840479999999999999999872
Q gi|254780782|r  309 RKLTSLLSKSIYNTTGNIPLLST-SGGTSDARFI---KDYCPVIEFGLVGRTMHALNENASLQDLEDLTCIYENFLQNWF  384 (389)
Q Consensus       309 ~~l~~~l~~a~~~~~g~~~~~~~-~gg~~d~~~~---~~~iP~v~fGp~~~~~H~pdE~i~i~~l~~~~~~~~~~i~~~~  384 (389)
                      ..+.+.+.+..++ .+++..... .+++||+..+   ..++|+..+|++-...|+ -|.++++|+...+++++    .|+
T Consensus       266 ~~l~~~l~~~A~~-~~Ip~Q~~v~~~~gTDa~a~~~~g~gv~t~~isiP~RY~Hs-~E~~~~~Dve~~~~Ll~----a~~  339 (343)
T TIGR03106       266 YHLTRKLIRLCQD-HGIPHRRDVFRYYRSDAASAVEAGHDIRTALVTFGLDASHG-YERTHIDALEALANLLV----AYA  339 (343)
T ss_pred             HHHHHHHHHHHHH-CCCCCEEEECCCCCCHHHHHHHHCCCCCEEEECCCCCCHHH-HHHCCHHHHHHHHHHHH----HHH
T ss_conf             8999999999998-69984787247898659999986899878997137055134-02040999999999999----996


Q ss_pred             CCC
Q ss_conf             477
Q gi|254780782|r  385 ITP  387 (389)
Q Consensus       385 ~~~  387 (389)
                      .||
T Consensus       340 ~s~  342 (343)
T TIGR03106       340 QSP  342 (343)
T ss_pred             HCC
T ss_conf             199


No 67 
>PRK09961 exoaminopeptidase; Provisional
Probab=99.67  E-value=6.7e-14  Score=104.35  Aligned_cols=315  Identities=16%  Similarity=0.181  Sum_probs=158.6

Q ss_pred             HHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEECC-CCCEEEEECCCCCCCCCCHHHC
Q ss_conf             999999964999789968999999999997798489997058887624899999879-9988999733681578887772
Q gi|254780782|r    6 LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT-EAPHLMFAGHIDVVPPGDFNHW   84 (389)
Q Consensus         6 v~~l~~lv~ips~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g~-~~~~ill~~H~Dtvp~~~~~~W   84 (389)
                      +++|++|+.+|++|+.|.++++++.++|+..+.+++.        ...+|++++.|+ ++|+|+|.+|||.+  |    +
T Consensus         3 ~~lLk~L~~~~g~SG~E~~v~~~i~~~l~~~~dev~~--------D~~GNli~~~g~~~~p~vml~AHmDEi--G----~   68 (345)
T PRK09961          3 LSLLKALSEADAIASSEQEVRQILLEEADRLQKEVRF--------DGLGSVLIRLNESTGPKVMICAHMDEV--G----F   68 (345)
T ss_pred             HHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHCCEEEE--------CCCCCEEEEECCCCCCEEEEEECCCCC--E----E
T ss_conf             7999999749997967499999999998863985998--------689979999789998569999825653--5----8


Q ss_pred             CCCCCCEEEECCCCCCCCCCCCCCHHHHHHH---HCCCCCCCCCCCCCEEEEEEEECCCEECCCCCCCCCCCCCCCCCC-
Q ss_conf             5666422452133236544333201245441---000000011357834999752022011044211111000133212-
Q gi|254780782|r   85 TYPPFSATIAEGKIYGRGIVDMKGSIACFIA---AVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKW-  160 (389)
Q Consensus        85 ~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~---a~~~l~~~~~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~~~~~~-  160 (389)
                      --   +-..++|.|+=+..    ||+-....   -++...+.+.   .+.-++...+..                 .++ 
T Consensus        69 ~V---~~I~~~G~l~~~~l----GG~~~~~l~gq~v~i~~~~g~---~i~gvi~~~~~~-----------------~~~~  121 (345)
T PRK09961         69 MV---RSISREGAIDVLPV----GNVRMAARQLQPVRITTREEC---KIPGLLDGDRQG-----------------NDVS  121 (345)
T ss_pred             EE---EEECCCCEEEEEEC----CCCCHHHCCCCEEEEEECCCC---CCEEEECCCCCC-----------------CCHH
T ss_conf             99---99868965999934----886633314767999958893---883798872678-----------------9745


Q ss_pred             CEEEECCCCCCC-CCCEEEEEEEEEEEEEEE------EEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             035414566543-431001232223579999------9964123100000012013455443201122334456644210
Q gi|254780782|r  161 DACIVGEPTCNH-IIGDTIKIGRRGSLSGEI------TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSP  233 (389)
Q Consensus       161 d~~i~~ep~~~~-~~~~~i~~g~rG~~~~~i------~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~~~~~~~~~~  233 (389)
                      ++.|..--.+.. .....|..|......-..      .+.|++-+    .  +-....+.+++.+|++...+. +-++.-
T Consensus       122 ~l~IDiGa~s~eE~~~~gI~iGd~v~~~~~~~~l~~~~i~~kalD----n--R~G~~~lle~l~~l~~~~l~~-~v~~v~  194 (345)
T PRK09961        122 AMRVDIGARSYDEVMQAGIRPGDRVTFDTTFQVLPHQRVMGKAFD----D--RLGCYLLVTLLRELHDAELPA-EVWLVA  194 (345)
T ss_pred             HEEEEECCCCHHHHHHCCCCCCCEEEECCCEEEECCCEEEEEECC----C--HHHHHHHHHHHHHHHHCCCCC-EEEEEE
T ss_conf             779990889999999639998988997776499469759843062----2--554999999999985278995-299999


Q ss_pred             EEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHH
Q ss_conf             14667655420466655432116651343420677999999999987653242034311232226631125786789999
Q gi|254780782|r  234 TNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTS  313 (389)
Q Consensus       234 ~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~  313 (389)
                      ++-.=....+...+.+.|.....+-+|+......-........  .+.      .+.  .+......    .-.+..+.+
T Consensus       195 tvQEEvGlrGA~~aa~~i~Pd~aI~vDv~~~~~~~~~~~~~~~--~lG------~Gp--~i~~~d~~----~i~~~~l~~  260 (345)
T PRK09961        195 SSSEEVGLRGGQTATRAVSPDVAIVLDTACWAKNFDYGAANHR--QIG------NGP--MLVLSDKS----LIAPPKLTA  260 (345)
T ss_pred             EEHHHCCCCCCHHCCCCCCCCEEEEEECCCCCCCCCCCCCCCC--CCC------CCC--EEEECCCC----CCCCHHHHH
T ss_conf             8433237753100213479878999954667898674656654--348------877--79978988----778989999


Q ss_pred             HHHHHHHHHHCCCCEEE-ECCCCCHHHHH---HHCCCEEEEEECCCCCCCCCCEEEHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999828995797-41454358898---605989999004787368784047999999999999999987
Q gi|254780782|r  314 LLSKSIYNTTGNIPLLS-TSGGTSDARFI---KDYCPVIEFGLVGRTMHALNENASLQDLEDLTCIYENFLQNW  383 (389)
Q Consensus       314 ~l~~a~~~~~g~~~~~~-~~gg~~d~~~~---~~~iP~v~fGp~~~~~H~pdE~i~i~~l~~~~~~~~~~i~~~  383 (389)
                      .+.+..++ .+++.... ..+|+||+..+   ..|+|++.++.+....|+|.|.++++|+...++++..+++++
T Consensus       261 ~l~~~A~~-~~Ip~Q~~~~~~ggTDa~~~~~~~~Gi~t~~isiP~RY~Hs~~e~~~~~Die~~~~Ll~~~i~~l  333 (345)
T PRK09961        261 WIETVAAE-IGVPLQADMFSNGGTDGGAVHLTGTGVPTVVMGPATRHGHCAASIADCRDILQMQQLLSALIQRL  333 (345)
T ss_pred             HHHHHHHH-CCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEECCCCCCCCCCEEEEHHHHHHHHHHHHHHHHHC
T ss_conf             99999998-69986998468987479999985899868998615156776122767999999999999999978


No 68 
>TIGR03107 glu_aminopep glutamyl aminopeptidase. This model represents the M42.001 clade within MEROPS family M42. M42 includes glutamyl aminopeptidase as in the present model, deblocking aminopeptidases as from Pyrococcus horikoshii and related species, and endo-1,4-beta-glucanase (cellulase M) as from Clostridium thermocellum. The current family includes
Probab=99.61  E-value=9.4e-13  Score=97.30  Aligned_cols=318  Identities=15%  Similarity=0.155  Sum_probs=157.6

Q ss_pred             HHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEE-C--CCCCEEEEECCCCCCCCCCHHH
Q ss_conf             999999649997899689999999999977984899970588876248999998-7--9998899973368157888777
Q gi|254780782|r    7 EHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF-G--TEAPHLMFAGHIDVVPPGDFNH   83 (389)
Q Consensus         7 ~~l~~lv~ips~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~-g--~~~~~ill~~H~Dtvp~~~~~~   83 (389)
                      ++|++|+.+|++|+.|.+++++++++|+..+.+++.        ...+|+++.. |  +++|+|||.+|||.+=      
T Consensus         2 ~~Lk~L~~~~gpSG~E~~v~~~i~~~l~~~~dev~~--------D~~GN~ia~~~g~~~~~pkvml~AHmDEIG------   67 (350)
T TIGR03107         2 NKIKEVTELQGTSGFEHPIRDYLRQDITPLVDQVET--------DGLGGIFGIKESQVENAPRVMVAAHMDEVG------   67 (350)
T ss_pred             HHHHHHHCCCCCCCCHHHHHHHHHHHHHHHCCEEEE--------CCCCCEEEEECCCCCCCCEEEEEEECCCEE------
T ss_conf             579998769998967599999999998861874999--------789858999668878886699998045002------


Q ss_pred             CCCCCCCE--EEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCEECCC--CCCCCCCCCCCC--
Q ss_conf             25666422--452133236544333201245441000000011357834999752022011044--211111000133--
Q gi|254780782|r   84 WTYPPFSA--TIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAING--TKKMLSWIEKKG--  157 (389)
Q Consensus        84 W~~~Pf~~--~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~~~~~i~~~~~~dEE~~~~~G--~~~l~~~~~~~~--  157 (389)
                           |-.  ..++|.|+=.-.    ||+-..+.--          .++.+.-.-.+..++..|  +.|+...-.+..  
T Consensus        68 -----~~V~~I~~~G~l~~~~i----GG~~~~~l~g----------q~V~I~t~~G~~~~~v~g~~~pH~~~~~~~~~~~  128 (350)
T TIGR03107        68 -----FMVSQIKPDGTFRVVEL----GGWNPLVVSS----------QRFTLFTRKGKKYPVISGSVPPHLLRGSSGGPQL  128 (350)
T ss_pred             -----EEEEEECCCCEEEEEEC----CCCCCCCCCC----------CEEEEEECCCCEEEEEECCCCCEECCCCCCCCCC
T ss_conf             -----99999877988999977----9846011478----------7899997799899999888586460450246567


Q ss_pred             CCC-CEEEECCCCCC-CCCCEEEEEEEEEEEEEE--EEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCCCCCCCCCCCC
Q ss_conf             212-03541456654-343100123222357999--99964123100000012013455443201122334456644210
Q gi|254780782|r  158 EKW-DACIVGEPTCN-HIIGDTIKIGRRGSLSGE--ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSP  233 (389)
Q Consensus       158 ~~~-d~~i~~ep~~~-~~~~~~i~~g~rG~~~~~--i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~~~~~~~~~~  233 (389)
                      ... |+.|..--.+. ......|..|-.-+...+  ....|+-- .|....-+-....+.+++.+|++...+.  .    
T Consensus       129 p~~~dl~iDiGa~skeEa~~~GI~vGD~v~~~~~~~~~~ng~~i-~~kalDnR~G~~~lle~l~~l~~~~~~~--~----  201 (350)
T TIGR03107       129 PAVSDILFDGGFTNKDEAWSFGVRPGDVIVPQTETILTANGKNV-ISKAWDNRYGVLMILELLESLKDQELPN--T----  201 (350)
T ss_pred             CCCCEEEEECCCCCHHHHHHCCCCCCCEEEECCCEEEECCCCEE-ECCCCCCCHHHHHHHHHHHHHHCCCCCC--E----
T ss_conf             86030899837799889985697789989876642894378648-6023665152999999999875278994--7----


Q ss_pred             EEEEEEEEE--EC----CCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCC
Q ss_conf             146676554--20----466655432116651343420677999999999987653242034311232226631125786
Q gi|254780782|r  234 TNMEITTID--VG----NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTH  307 (389)
Q Consensus       234 ~~~~i~~i~--~g----~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~  307 (389)
                       .+.+.+.+  .|    ..+.+.|-....+-+|+-...+...+.     ...+.      .+  ..+.+....  .  -.
T Consensus       202 -v~~~~TvQEEvGlrGA~~aa~~i~PD~aI~vD~~~a~D~~~~~-----~~~lG------~G--p~i~~~d~~--~--i~  263 (350)
T TIGR03107       202 -LIAGANVQEEVGLRGAHVSTTKFNPDIFFAVDCSPAGDIYGDQ-----GGKLG------EG--TLLRFFDPG--H--IM  263 (350)
T ss_pred             -EEEEEECHHHCCCHHHHHHHHCCCCCEEEEEECCCCCCCCCCC-----CCEEC------CC--CEEEEECCC--C--CC
T ss_conf             -9999982242471567888741599889999565677888887-----77317------86--779773887--7--67


Q ss_pred             HHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHH---HHCCCEEEEEECCCCCCCCCCEEEHHHHHHHHHHHHHHHHHH
Q ss_conf             7899999999999982899579741454358898---605989999004787368784047999999999999999987
Q gi|254780782|r  308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFI---KDYCPVIEFGLVGRTMHALNENASLQDLEDLTCIYENFLQNW  383 (389)
Q Consensus       308 ~~~l~~~l~~a~~~~~g~~~~~~~~gg~~d~~~~---~~~iP~v~fGp~~~~~H~pdE~i~i~~l~~~~~~~~~~i~~~  383 (389)
                      +..+.+.+.+..++ .+++.....+.|+||+..+   +.|+|++.++.+...+|+|.|-++++|+...++++..+++++
T Consensus       264 ~~~l~~~l~~~A~~-~~Ip~Q~~~~~gGTDa~~~~~~~~Gvpt~~isiP~RY~Hsp~e~~~~~D~e~~~~Ll~~~i~~l  341 (350)
T TIGR03107       264 LPRMKDFLLTTAEE-AGIKYQYYVAKGGTDAGAAHLKNSGVPSTTIGVCARYIHSHQTLYSIDDFLAAQAFLQAIVKKL  341 (350)
T ss_pred             CHHHHHHHHHHHHH-CCCCEEEECCCCCCHHHHHHHHCCCCCEEEEEECCCCCCCCCEEEEHHHHHHHHHHHHHHHHHC
T ss_conf             99999999999998-4998488768988578999986899758997305166677240556999999999999999972


No 69 
>PRK09864 putative fructose-specific phosphotransferase system protein FrvX; Provisional
Probab=99.59  E-value=7.3e-13  Score=97.97  Aligned_cols=321  Identities=19%  Similarity=0.184  Sum_probs=156.9

Q ss_pred             HHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEECCCCCEEEEECCCCCCCCCCHHHCC
Q ss_conf             99999996499978996899999999999779848999705888762489999987999889997336815788877725
Q gi|254780782|r    6 LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDVVPPGDFNHWT   85 (389)
Q Consensus         6 v~~l~~lv~ips~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g~~~~~ill~~H~Dtvp~~~~~~W~   85 (389)
                      +++|++|...|++|+.|.+++++++++|+...-+++.        ...+|++++.++++|.|+|.+|||-+=        
T Consensus         3 ~elL~~L~~~~g~SG~E~~v~~~i~~~l~~~~dev~~--------D~lGN~ia~~~~~~p~vml~AHmDEIG--------   66 (356)
T PRK09864          3 IELLQQLCEASAVSGDEQEVRDILINTLEPCVNEITF--------DGLGSFVARKGNKGPKVAVVGHMDEVG--------   66 (356)
T ss_pred             HHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHCCEEEE--------CCCCCEEEEECCCCCEEEEEEECCCEE--------
T ss_conf             7999999749997977089999999998854874898--------689729999479996599998035037--------


Q ss_pred             CCCCCE--EEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCEECCCC--CCCCCCCCC-CCCCC
Q ss_conf             666422--4521332365443332012454410000000113578349997520220110442--111110001-33212
Q gi|254780782|r   86 YPPFSA--TIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGT--KKMLSWIEK-KGEKW  160 (389)
Q Consensus        86 ~~Pf~~--~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~~~~~i~~~~~~dEE~~~~~G~--~~l~~~~~~-~~~~~  160 (389)
                         |-.  ..++|.|+=.-    -||+-....     ..     .++.+.---.++..|.-|+  .|+...-.+ ....+
T Consensus        67 ---f~V~~I~~~G~l~~~~----vGG~~~~~l-----~g-----q~V~i~t~~g~~i~GViG~~~~H~~~~~~~~~~~~~  129 (356)
T PRK09864         67 ---FMVTHIDESGFLRFTT----IGGWWNQSM-----LN-----HRVTIRTHKGVKIPGVIGSVAPHALTEKQKQQPLSF  129 (356)
T ss_pred             ---EEEEEECCCCEEEEEE----CCCCCCCCC-----CC-----CEEEEECCCCCEEEEEECCCCCCCCCHHHCCCCCCH
T ss_conf             ---9999986798799997----187650422-----36-----679999278978889981667710473232579973


Q ss_pred             C-EEEE-CCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCCHHHHCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEE
Q ss_conf             0-3541-4566543431001232223579999996412310000001201345544320112233445664421014667
Q gi|254780782|r  161 D-ACIV-GEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI  238 (389)
Q Consensus       161 d-~~i~-~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~~~~~~~~~~~~~~i  238 (389)
                      + +.|. |-.+........|.+|-.....-....-|..-=+|....-+=....+++++.++++...   + .     ..+
T Consensus       130 ~~l~IDiGa~s~eEa~~~gI~iGd~v~~~~~~~~l~~~~i~~kalDnR~G~~~l~e~l~~l~~~~~---~-l-----y~v  200 (356)
T PRK09864        130 DEMFIDIGANSREEVEKRGVEIGDFISPEANFACWGEDKVVGKALDNRIGCAMMAELLQTVNNPEI---T-L-----YGV  200 (356)
T ss_pred             HHEEEECCCCCHHHHHHCCCCCCCEEEECCCEEEECCCCEEEEECCCHHHHHHHHHHHHHHCCCCC---E-E-----EEE
T ss_conf             309999688999999955999999875256238977981886545426669999999997116796---7-9-----999


Q ss_pred             EEEE--EC----CCCCCCCCCCEEEEECCCCCCHHH-HHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHH
Q ss_conf             6554--20----466655432116651343420677-9999999999876532420343112322266311257867899
Q gi|254780782|r  239 TTID--VG----NPSKNVIPAQVKMSFNIRFNDLWN-EKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKL  311 (389)
Q Consensus       239 ~~i~--~g----~~~~NvIP~~a~~~~diR~~~~~~-~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l  311 (389)
                      .+++  .|    ..+.+.|.....+-+|+-...+.- .+.....+  .+.+      +...  .....   . .-.+..+
T Consensus       201 ~tvQEEvGlRGA~~aa~~i~PD~aIavDvt~a~D~p~~~~~~~~~--~LG~------GP~i--~~~d~---~-~i~~~~l  266 (356)
T PRK09864        201 GSVEEEVGLRGAQTSAEHIKPDVVIVLDTAVAGDVPGIDNIKYPL--KLGQ------GPGL--MLFDK---R-YFPNQKL  266 (356)
T ss_pred             EEEHHHCCCHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCC--CCCC------CCEE--EEECC---C-CCCCHHH
T ss_conf             975152352278999853389889999776577899987554674--0588------8769--98068---7-6699999


Q ss_pred             HHHHHHHHHHHHCCCCEEE-ECCCCCHHHHH---HHCCCEEEEEECCCCCCCCCCEEEHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999828995797-41454358898---605989999004787368784047999999999999999987
Q gi|254780782|r  312 TSLLSKSIYNTTGNIPLLS-TSGGTSDARFI---KDYCPVIEFGLVGRTMHALNENASLQDLEDLTCIYENFLQNW  383 (389)
Q Consensus       312 ~~~l~~a~~~~~g~~~~~~-~~gg~~d~~~~---~~~iP~v~fGp~~~~~H~pdE~i~i~~l~~~~~~~~~~i~~~  383 (389)
                      .+.+.+..++ .+++.... ..+|+||+..+   +.|+|++.++.+-..+|+|.|-++++|+...++++..+++++
T Consensus       267 ~~~l~~~A~~-~~Ip~Q~~~~~~ggTDa~~~~~~~~Gvpt~~isiP~RY~Hsp~ev~~~~D~e~~~~Ll~~~l~~l  341 (356)
T PRK09864        267 VAALKNCAAH-NDLPLQFSTMKTGATDGGRYNVMGGGRPVVALCLPTRYLHANSGMISKADYDALLTLIRDFLTTL  341 (356)
T ss_pred             HHHHHHHHHH-CCCCEEEEECCCCCCCHHHHHHHCCCCEEEEEEECCCCCCCCCEEEEHHHHHHHHHHHHHHHHHC
T ss_conf             9999999998-49987998578887008999986898279997425365676130647999999999999999968


No 70 
>pfam05343 Peptidase_M42 M42 glutamyl aminopeptidase. These peptidases are found in Archaea and Bacteria. The example in Lactococcus lactis, PepA, aids growth on milk. Pyrococcus horikoshii contain a thermostable de-blocking aminopeptidase member of this family used commercially for N-terminal protein sequencing.
Probab=99.06  E-value=4.6e-09  Score=74.65  Aligned_cols=67  Identities=25%  Similarity=0.243  Sum_probs=52.2

Q ss_pred             HHHHHHHHHHHHHHHHCCCCEEE-ECCCCCHHHHH---HHCCCEEEEEECCCCCCCCCCEEEHHHHHHHHHH
Q ss_conf             78999999999999828995797-41454358898---6059899990047873687840479999999999
Q gi|254780782|r  308 DRKLTSLLSKSIYNTTGNIPLLS-TSGGTSDARFI---KDYCPVIEFGLVGRTMHALNENASLQDLEDLTCI  375 (389)
Q Consensus       308 ~~~l~~~l~~a~~~~~g~~~~~~-~~gg~~d~~~~---~~~iP~v~fGp~~~~~H~pdE~i~i~~l~~~~~~  375 (389)
                      +..+.+.+.+..++ .+++.... ..+|+||+..+   ..++|++.+|++-...|+|.|.++++|+...+++
T Consensus       222 ~~~l~~~l~~~A~~-~~Ip~Q~~~~~~~gTDa~~~~~~~~Gi~~~~i~iP~ry~Hs~~E~~~~~D~~~~i~L  292 (292)
T pfam05343       222 HPKLRKFLLELAKK-NNIPYQVEVYPGGGTDAGAAHLTGGGVPTALIGIPTRYIHSPVEVAHLDDLEATIKL  292 (292)
T ss_pred             CHHHHHHHHHHHHH-CCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEECCCCCCCCCCEEEEHHHHHHHHHC
T ss_conf             98999999999987-699728985688776699999838998789981050556773347679999998519


No 71 
>KOG2194 consensus
Probab=98.88  E-value=2e-08  Score=70.73  Aligned_cols=127  Identities=19%  Similarity=0.312  Sum_probs=86.1

Q ss_pred             HHHHHHHHHHHCC-CCC--CCC-HHHHHHHHHHHHHHCCCEEEE----EEEC-------------CCCCCEEEEEEEEEC
Q ss_conf             7899999999649-997--899-689999999999977984899----9705-------------888762489999987
Q gi|254780782|r    3 PDCLEHLIQLIKC-PSV--TPQ-DGGAFFILVNTLKLLGFSIEE----KDFQ-------------TKNTSIVKNLYARFG   61 (389)
Q Consensus         3 ~e~v~~l~~lv~i-ps~--s~~-e~~~~~~l~~~l~~~G~~~~~----~~~~-------------~~~~~~~~~~~~~~g   61 (389)
                      .++.+.|.++.++ |.+  |.+ |..+.+|+.+.+.+..-..+.    .+++             ......+.|+..+++
T Consensus        57 ~rA~~~l~~ls~~G~~~~gS~~ne~~a~~~il~e~~~i~~~~~~~~~~~Evd~q~~sg~~~~~~~~~~Y~~i~NIvVki~  136 (834)
T KOG2194          57 ARALKDLLSLSAAGPHPVGSDNNEMHASSFILKEVNKIRKGSQSDLYDMEVDLQSASGSFILEGMTLVYQNISNIVVKIS  136 (834)
T ss_pred             HHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHEECEEECCCEEEEHHHHHEEEEEEEEEEECC
T ss_conf             99998789987428844575255788999999999999865520012200010222532553121410013016899658


Q ss_pred             CC---CC-EEEEECCCCCCCCCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCC-CCCCEEEEEEE
Q ss_conf             99---98-899973368157888777256664224521332365443332012454410000000113-57834999752
Q gi|254780782|r   62 TE---AP-HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK-NFGSISLLITG  136 (389)
Q Consensus        62 ~~---~~-~ill~~H~Dtvp~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~-~~~~i~~~~~~  136 (389)
                      ++   .. .|++++|.|+||.                     |.|+.||..++|++|++++.+.+..+ ...+|.++|..
T Consensus       137 ~k~~~~~~~lLlnaHfDSvpt---------------------~~gAtDDg~~va~mLe~lRv~s~~~~~l~~~vVFLfNg  195 (834)
T KOG2194         137 PKNGNDKNALLLNAHFDSVPT---------------------GPGATDDGSGVASMLEALRVLSKSDKLLTHSVVFLFNG  195 (834)
T ss_pred             CCCCCCCCEEEEECCCCCCCC---------------------CCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCEEEEECC
T ss_conf             999876320666402465588---------------------89977535489999999998641787566647999658


Q ss_pred             ECCCEECCCCCCCCC
Q ss_conf             022011044211111
Q gi|254780782|r  137 DEEGPAINGTKKMLS  151 (389)
Q Consensus       137 dEE~~~~~G~~~l~~  151 (389)
                      .||.+ ..|+-.++.
T Consensus       196 aEE~~-L~gsH~FIt  209 (834)
T KOG2194         196 AEESG-LLGSHAFIT  209 (834)
T ss_pred             CCCCH-HHHCCCCEE
T ss_conf             32000-000342201


No 72 
>PRK10199 alkaline phosphatase isozyme conversion aminopeptidase; Provisional
Probab=98.82  E-value=9.8e-09  Score=72.62  Aligned_cols=128  Identities=16%  Similarity=0.293  Sum_probs=88.8

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCEEEEEEEC------CCCCC------EEEEEEEEE-CCCCCEEEEECCCCCCCC-CC
Q ss_conf             99978996899999999999779848999705------88876------248999998-799988999733681578-88
Q gi|254780782|r   15 CPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQ------TKNTS------IVKNLYARF-GTEAPHLMFAGHIDVVPP-GD   80 (389)
Q Consensus        15 ips~s~~e~~~~~~l~~~l~~~G~~~~~~~~~------~~~~~------~~~~~~~~~-g~~~~~ill~~H~Dtvp~-~~   80 (389)
                      .++-||.|-.+++|+.+.+.++|+++.+..+.      ..+..      ...+++|.. |..++-|++.+|+||--+ .+
T Consensus        47 R~~Gspae~~aAdyl~q~f~~~GYqs~~r~Fntry~yt~~~~~~~w~nvt~~~vIAa~~G~~~q~iii~AH~DTy~p~sd  126 (346)
T PRK10199         47 RMTGTPAEMLSADYIRQQFQQMGYQSDIRTFNSRYIYTARDNRKNWHNVTGSTVIAAHEGKAPQQIIIMAHLDTYAPQSD  126 (346)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHCCCCCCCEEEEEEEECCCCCCCC
T ss_conf             76898788878899999998616401001345413675278853423464033333215898835999986125577553


Q ss_pred             HHHCCCCCCCEEEEC---CCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCEECCCCCCCCCCCCC
Q ss_conf             777256664224521---332365443332012454410000000113578349997520220110442111110001
Q gi|254780782|r   81 FNHWTYPPFSATIAE---GKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEK  155 (389)
Q Consensus        81 ~~~W~~~Pf~~~~~~---g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~  155 (389)
                      .+           -|   |.+-=.|+-|+-+|+.+||+.+++|+. .+....|.|+|.+.||.|. .|++.+++.+..
T Consensus       127 ~d-----------~~~nlGgltlqG~DDNasGvgvmLevAe~lk~-i~t~y~vrFvafgAEE~Gl-~Gs~~yl~rms~  191 (346)
T PRK10199        127 AD-----------ADANLGGLTLQGMDDNAAGLGVMLELAERLKN-IPTEYGIRFVATSGEEEGK-LGAENLLKRMSD  191 (346)
T ss_pred             CH-----------HHHCCCCCCCCCCCCCCCCHHHHHHHHHHHCC-CCCCCEEEEEEECCCCCCC-CCHHHHHHHCCH
T ss_conf             10-----------23204763201556665038999999998359-9875605999944633452-218999987278


No 73 
>pfam04389 Peptidase_M28 Peptidase family M28.
Probab=98.52  E-value=8.3e-08  Score=66.94  Aligned_cols=65  Identities=20%  Similarity=0.318  Sum_probs=52.7

Q ss_pred             EEEEECCCCCCCCCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC-CCCCCEEEEEEEECCCEECC
Q ss_conf             89997336815788877725666422452133236544333201245441000000011-35783499975202201104
Q gi|254780782|r   66 HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSISLLITGDEEGPAIN  144 (389)
Q Consensus        66 ~ill~~H~Dtvp~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-~~~~~i~~~~~~dEE~~~~~  144 (389)
                      .|++.+|+|+++.                     +.|+.|+-+|+|++|++++.|.+.. ++.++|.|++...||.|. .
T Consensus         2 ~ivigaH~Ds~~~---------------------~~GA~DnasGva~lle~ar~l~~~~~~~~~ti~f~~~~~EE~Gl-~   59 (173)
T pfam04389         2 VVLLGAHYDSVPI---------------------GPGATDNASGVAALLELARVLAAQGPRPKRSVVFLFFDAEEDGL-L   59 (173)
T ss_pred             EEEEECCCCCCCC---------------------CCCCCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCC-C
T ss_conf             9999654377889---------------------89977773899999999999996599988539998558511356-2


Q ss_pred             CCCCCCCC
Q ss_conf             42111110
Q gi|254780782|r  145 GTKKMLSW  152 (389)
Q Consensus       145 G~~~l~~~  152 (389)
                      |++++++.
T Consensus        60 GS~~~~~~   67 (173)
T pfam04389        60 GSRAFAEL   67 (173)
T ss_pred             HHHHHHHC
T ss_conf             29999974


No 74 
>COG2234 Iap Predicted aminopeptidases [General function prediction only]
Probab=97.55  E-value=0.00023  Score=45.79  Aligned_cols=56  Identities=14%  Similarity=0.172  Sum_probs=44.7

Q ss_pred             CCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCEECCCCCCCCCCCC
Q ss_conf             3236544333201245441000000011357834999752022011044211111000
Q gi|254780782|r   97 KIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIE  154 (389)
Q Consensus        97 ~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~  154 (389)
                      .-.+.|+.||-.|++++|+.++.|.... +..+|.|++...||.|. .|+.++.....
T Consensus       220 ~~~~~GA~DNasGva~llEiAr~l~~~~-p~~~v~f~~~~aEE~Gl-~GS~~~~~~~~  275 (435)
T COG2234         220 VPTGPGADDNASGVAALLELARVLKGNP-PKRTVRFVAFGAEESGL-LGSEAYVKRLS  275 (435)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHCC-CCCEEEEEECCCCCCCC-CCHHHHHHHCC
T ss_conf             7777885475317999999999984089-99708999758733467-53799986035


No 75 
>KOG3946 consensus
Probab=97.49  E-value=0.00079  Score=42.47  Aligned_cols=117  Identities=21%  Similarity=0.219  Sum_probs=80.1

Q ss_pred             CCCHHHHHHHHHHHHHHCCCEEEEEEECCCC---CCEEEEEEEEECCCC-CEEEEECCCCCCCCCCHHHCCCCCCCEEEE
Q ss_conf             8996899999999999779848999705888---762489999987999-889997336815788877725666422452
Q gi|254780782|r   19 TPQDGGAFFILVNTLKLLGFSIEEKDFQTKN---TSIVKNLYARFGTEA-PHLMFAGHIDVVPPGDFNHWTYPPFSATIA   94 (389)
Q Consensus        19 s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~---~~~~~~~~~~~g~~~-~~ill~~H~Dtvp~~~~~~W~~~Pf~~~~~   94 (389)
                      |++...+.+|+.+.|+.+|+.++...+.+..   .-.+.|++++..++. +.+.+..|+|+--.   -+|          
T Consensus        68 s~g~~~vr~~i~~~l~~l~w~ve~~~f~~~tp~g~~~f~nii~tl~~~A~r~lVlachydsk~~---p~~----------  134 (338)
T KOG3946          68 SPGSRQVRRFIIQHLRNLGWAVETDAFTDNTPLGTRNFNNLIATLDPNASRYLVLACHYDSKIF---PGG----------  134 (338)
T ss_pred             CCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCCEEEEEEEEEEECCCCCCHHEEEECCCCCCCC---CCC----------
T ss_conf             9752899999999987268424303110357310145656888647984210111003453328---875----------


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHCCCCCCCC--CC---CCCEEEEEEEECCC-------EECCCCCCCCCC
Q ss_conf             133236544333201245441000000011--35---78349997520220-------110442111110
Q gi|254780782|r   95 EGKIYGRGIVDMKGSIACFIAAVARFIPKY--KN---FGSISLLITGDEEG-------PAINGTKKMLSW  152 (389)
Q Consensus        95 ~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~--~~---~~~i~~~~~~dEE~-------~~~~G~~~l~~~  152 (389)
                        .  =+|+.|.--++|.++..++.+.+..  +.   .-.+.++|.-.||.       .+.+|++++.+.
T Consensus       135 --~--~vgatdsAvpcamll~laq~l~~~~~~~~~~s~lsL~LvFFDGEEAf~eW~p~DSlYGsRhLA~~  200 (338)
T KOG3946         135 --M--FVGATDSAVPCAMLLNLAQALDKILCSKVSASQLSLQLVFFDGEEAFEEWGPEDSLYGSRHLAAK  200 (338)
T ss_pred             --C--EEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCEEEEEEEECCHHHHHHCCCCCCCCHHHHHHHH
T ss_conf             --1--57421553518999999999999874366767515899995558888633975663057899998


No 76 
>PRK09961 exoaminopeptidase; Provisional
Probab=97.00  E-value=0.00063  Score=43.11  Aligned_cols=69  Identities=13%  Similarity=0.172  Sum_probs=52.5

Q ss_pred             EECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCEECCCCCCCCCCCCCCCCCCCEEEECCCC
Q ss_conf             52133236544333201245441000000011357834999752022011044211111000133212035414566
Q gi|254780782|r   93 IAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPT  169 (389)
Q Consensus        93 ~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~~~~~~d~~i~~ep~  169 (389)
                      ..++++.||. .||+.|+++++.+++++.+. .....|.+.|+.-||.|. .|++...     ...+||.+|+.|.+
T Consensus       155 l~~~~i~~ka-lDnR~G~~~lle~l~~l~~~-~l~~~v~~v~tvQEEvGl-rGA~~aa-----~~i~Pd~aI~vDv~  223 (345)
T PRK09961        155 LPHQRVMGKA-FDDRLGCYLLVTLLRELHDA-ELPAEVWLVASSSEEVGL-RGGQTAT-----RAVSPDVAIVLDTA  223 (345)
T ss_pred             ECCCEEEEEE-CCCHHHHHHHHHHHHHHHHC-CCCCEEEEEEEEHHHCCC-CCCHHCC-----CCCCCCEEEEEECC
T ss_conf             4697598430-62255499999999998527-899529999984332377-5310021-----34798789999546


No 77 
>TIGR03107 glu_aminopep glutamyl aminopeptidase. This model represents the M42.001 clade within MEROPS family M42. M42 includes glutamyl aminopeptidase as in the present model, deblocking aminopeptidases as from Pyrococcus horikoshii and related species, and endo-1,4-beta-glucanase (cellulase M) as from Clostridium thermocellum. The current family includes
Probab=96.75  E-value=0.0013  Score=41.26  Aligned_cols=67  Identities=7%  Similarity=-0.008  Sum_probs=49.4

Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCEECCCCCCCCCCCCCCCCCCCEEEECCCC
Q ss_conf             133236544333201245441000000011357834999752022011044211111000133212035414566
Q gi|254780782|r   95 EGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPT  169 (389)
Q Consensus        95 ~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~~~~~~d~~i~~ep~  169 (389)
                      ++++.||. .||+.|+++++.+++.+... .....+.+.|+.-||.|. .|++....     ...||.+|+.+.+
T Consensus       169 g~~i~~ka-lDnR~G~~~lle~l~~l~~~-~~~~~v~~~~TvQEEvGl-rGA~~aa~-----~i~PD~aI~vD~~  235 (350)
T TIGR03107       169 GKNVISKA-WDNRYGVLMILELLESLKDQ-ELPNTLIAGANVQEEVGL-RGAHVSTT-----KFNPDIFFAVDCS  235 (350)
T ss_pred             CCEEECCC-CCCCHHHHHHHHHHHHHHCC-CCCCEEEEEEECHHHCCC-HHHHHHHH-----CCCCCEEEEEECC
T ss_conf             86486023-66515299999999987527-899479999982242471-56788874-----1599889999565


No 78 
>PRK09864 putative fructose-specific phosphotransferase system protein FrvX; Provisional
Probab=95.98  E-value=0.0042  Score=38.06  Aligned_cols=67  Identities=18%  Similarity=0.101  Sum_probs=48.8

Q ss_pred             ECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCEECCCCCCCCCCCCCCCCCCCEEEECCCCC
Q ss_conf             21332365443332012454410000000113578349997520220110442111110001332120354145665
Q gi|254780782|r   94 AEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTC  170 (389)
Q Consensus        94 ~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~~~~~~d~~i~~ep~~  170 (389)
                      .++++.||. .||+.|+++++.+++.+..   +..++.+.|+.-||.|. .|++....     ..+||.+|..|.+.
T Consensus       165 ~~~~i~~ka-lDnR~G~~~l~e~l~~l~~---~~~~ly~v~tvQEEvGl-RGA~~aa~-----~i~PD~aIavDvt~  231 (356)
T PRK09864        165 GEDKVVGKA-LDNRIGCAMMAELLQTVNN---PEITLYGVGSVEEEVGL-RGAQTSAE-----HIKPDVVIVLDTAV  231 (356)
T ss_pred             CCCCEEEEE-CCCHHHHHHHHHHHHHHCC---CCCEEEEEEEEHHHCCC-HHHHHHHH-----HCCCCEEEEEECCC
T ss_conf             798188654-5426669999999997116---79679999975152352-27899985-----33898899997765


No 79 
>KOG2195 consensus
Probab=95.77  E-value=0.021  Score=33.70  Aligned_cols=78  Identities=17%  Similarity=0.252  Sum_probs=52.2

Q ss_pred             EEEEEEEEE-CCC--CCEEEEECCCCCCCCCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCC---CCC-CC
Q ss_conf             248999998-799--98899973368157888777256664224521332365443332012454410000---000-11
Q gi|254780782|r   52 IVKNLYARF-GTE--APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR---FIP-KY  124 (389)
Q Consensus        52 ~~~~~~~~~-g~~--~~~ill~~H~Dtvp~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~---l~~-~~  124 (389)
                      ...|+++++ |..  ++-|++.+|-|..        .+               |+.|.-+|.+.++.-.++   +++ ..
T Consensus       337 ki~NIig~I~Gs~epD~~ViigahrDSw--------~~---------------Ga~dp~sGta~Ll~i~~~~~~~~k~gw  393 (702)
T KOG2195         337 KIQNIIGKIEGSEEPDRYVIIGAHRDSW--------TF---------------GAIDPNSGTALLLEIARALSKLKKRGW  393 (702)
T ss_pred             EEEEEEEEEECCCCCCEEEEEECCCCCC--------CC---------------CCCCCCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             4112899974675787079972362432--------33---------------776798438999999999999987388


Q ss_pred             CCCCCEEEEEEEECCCEECCCCCCCCCCC
Q ss_conf             35783499975202201104421111100
Q gi|254780782|r  125 KNFGSISLLITGDEEGPAINGTKKMLSWI  153 (389)
Q Consensus       125 ~~~~~i~~~~~~dEE~~~~~G~~~l~~~~  153 (389)
                      +|+++|.|+.=..||.|.. ||..+++..
T Consensus       394 rP~RtI~F~sWdAeEfGli-GStE~~E~~  421 (702)
T KOG2195         394 RPRRTILFASWDAEEFGLL-GSTEWAEEY  421 (702)
T ss_pred             CCCCEEEEEECCCHHCCCC-CCHHHHHHH
T ss_conf             7664289997074122664-508999999


No 80 
>KOG2526 consensus
Probab=95.68  E-value=0.069  Score=30.58  Aligned_cols=125  Identities=18%  Similarity=0.234  Sum_probs=69.3

Q ss_pred             HHHHHHHHHHHCCCEEEEEEECCC--CCCEEEEEEEEEC---------CCCCEEEEECCCCCCCCCCHHHCCCCCCCEEE
Q ss_conf             999999999977984899970588--8762489999987---------99988999733681578887772566642245
Q gi|254780782|r   25 AFFILVNTLKLLGFSIEEKDFQTK--NTSIVKNLYARFG---------TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATI   93 (389)
Q Consensus        25 ~~~~l~~~l~~~G~~~~~~~~~~~--~~~~~~~~~~~~g---------~~~~~ill~~H~Dtvp~~~~~~W~~~Pf~~~~   93 (389)
                      ..+.+..-+...|+.+-.-...+.  ..-.+.|+.++..         +.-|+|++.+|+||.-+.+   |         
T Consensus       163 ~~~~ll~Tasangy~iv~sg~sp~a~~s~ki~nI~G~L~~glra~~dg~~lPtIaivA~ydtfgaap---~---------  230 (555)
T KOG2526         163 ALQHLLQTASANGYSIVSSGQSPEAPPSYKILNIVGRLSSGLRAEGDGSALPTIAIVAHYDTFGAAP---G---------  230 (555)
T ss_pred             HHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCEEEEEEECCCCCCCC---C---------
T ss_conf             5777874331683799945887466888765137865144323456645587589997313445578---8---------


Q ss_pred             ECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC-----CCCCCEEEEEEEECCCEECCCCCCCCCCCCCC-CCCCCEEEECC
Q ss_conf             2133236544333201245441000000011-----35783499975202201104421111100013-32120354145
Q gi|254780782|r   94 AEGKIYGRGIVDMKGSIACFIAAVARFIPKY-----KNFGSISLLITGDEEGPAINGTKKMLSWIEKK-GEKWDACIVGE  167 (389)
Q Consensus        94 ~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~-----~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~~-~~~~d~~i~~e  167 (389)
                           +-.|+--+.+|+++.|..++-+.+-+     ..+.++.|+.+..--. .+-|.++-++..... ....|++|+.+
T Consensus       231 -----lsvgADSNGSGvvaLLelarlfSkly~ypsTrakYnLlF~lt~aG~l-NyqGTkkWLe~dd~~lq~nVdfaiCLd  304 (555)
T KOG2526         231 -----LSVGADSNGSGVVALLELARLFSKLYDYPSTRAKYNLLFILTAAGKL-NYQGTKKWLEFDDADLQKNVDFAICLD  304 (555)
T ss_pred             -----CCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCC-CCCCHHHHHHCCHHHHHHCCCEEEEHH
T ss_conf             -----78787778840899999999999973386656551589997067643-531203466426687871566898735


No 81 
>COG4882 Predicted aminopeptidase, Iap family [General function prediction only]
Probab=92.11  E-value=0.32  Score=26.47  Aligned_cols=24  Identities=13%  Similarity=-0.096  Sum_probs=14.2

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             999789968999999999997798
Q gi|254780782|r   15 CPSVTPQDGGAFFILVNTLKLLGF   38 (389)
Q Consensus        15 ips~s~~e~~~~~~l~~~l~~~G~   38 (389)
                      +=.-+++|.++.+++..+|++--.
T Consensus        15 li~g~~ger~~v~~vrafLe~~~v   38 (486)
T COG4882          15 LIVGAGGERGAVEVVRAFLEESLV   38 (486)
T ss_pred             EEECCCCCHHHHHHHHHHHHCCCC
T ss_conf             230689734589999999845532


No 82 
>COG2195 PepD Di- and tripeptidases [Amino acid transport and metabolism]
Probab=92.05  E-value=0.21  Score=27.61  Aligned_cols=78  Identities=24%  Similarity=0.360  Sum_probs=50.6

Q ss_pred             CCCCCEEEEECCCCCCCC-CCHHH--CCCCCCCEEEECCCCC-CCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEEEEEE
Q ss_conf             799988999733681578-88777--2566642245213323-6544333201245441000000011357834999752
Q gi|254780782|r   61 GTEAPHLMFAGHIDVVPP-GDFNH--WTYPPFSATIAEGKIY-GRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITG  136 (389)
Q Consensus        61 g~~~~~ill~~H~Dtvp~-~~~~~--W~~~Pf~~~~~~g~l~-GrG~~D~Kg~ia~~l~a~~~l~~~~~~~~~i~~~~~~  136 (389)
                      +.+-..+.|.||+|.||. +....  -..||-.+.+++.++- .+|+ |+ -+++..++.+    +.  .+.++.+.++.
T Consensus        58 ~~~~~~~~L~a~~d~V~~i~~~sh~Dt~~d~~~~~v~~~~l~~~~Ga-d~-i~~~~~~a~L----~~--~~~P~~~~~t~  129 (414)
T COG2195          58 GENYVPAVLQAHLDMVPEIGFISHHDTVPDPIGPNVNPQILKATLGA-DN-IGLAIGLAVL----SP--EHFPLEVLLTG  129 (414)
T ss_pred             CCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCC-CH-HHHHHHHHHC----CC--CCCCCEEEEEC
T ss_conf             77704688523667666135545546524654466576525503585-13-6555577643----76--66870243224


Q ss_pred             ECCCEECCCCC
Q ss_conf             02201104421
Q gi|254780782|r  137 DEEGPAINGTK  147 (389)
Q Consensus       137 dEE~~~~~G~~  147 (389)
                      +||++. +|+.
T Consensus       130 ~~ei~~-dGa~  139 (414)
T COG2195         130 DEEITT-DGAT  139 (414)
T ss_pred             CEEEEC-CCCC
T ss_conf             268842-6852


No 83 
>PRK05015 aminopeptidase B; Provisional
Probab=85.09  E-value=2.6  Score=20.85  Aligned_cols=128  Identities=18%  Similarity=0.194  Sum_probs=57.9

Q ss_pred             HHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCC---CEEEEEEE---CCCCCCEEEEEEEE-ECCC-CCEEEEECCCCC
Q ss_conf             8999999996499978996899999999999779---84899970---58887624899999-8799-988999733681
Q gi|254780782|r    4 DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLG---FSIEEKDF---QTKNTSIVKNLYAR-FGTE-APHLMFAGHIDV   75 (389)
Q Consensus         4 e~v~~l~~lv~ips~s~~e~~~~~~l~~~l~~~G---~~~~~~~~---~~~~~~~~~~~~~~-~g~~-~~~ill~~H~Dt   75 (389)
                      +.++.-+++|+.|..--.-...++...++++++|   +.+++++-   ...+.+.   +++. .|+. .|+++   ++|=
T Consensus       101 ~~~~~~R~liN~p~~~l~P~~lA~~a~~~~~~~~~~~v~~~ii~ge~L~e~G~gG---i~aVG~GS~~pPrlv---~L~Y  174 (424)
T PRK05015        101 KIIDWVRDTINAPAEELGPEQLAQRAADLISSVAGDAVSYRIIKGEDLREQGYMG---IHTVGRGSERPPVLL---ALDY  174 (424)
T ss_pred             HHHHHHHHHHCCCHHHCCHHHHHHHHHHHHHHHCCCCEEEEEECHHHHHHCCCCC---EEEECCCCCCCCEEE---EEEE
T ss_conf             9999999874599466499999999999998736465479996179998679841---366647789998689---9996


Q ss_pred             CCCCCHHHCCCCCCCEEEECCCCCC---------CCCCCCC---CHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCE
Q ss_conf             5788877725666422452133236---------5443332---0124544100000001135783499975202201
Q gi|254780782|r   76 VPPGDFNHWTYPPFSATIAEGKIYG---------RGIVDMK---GSIACFIAAVARFIPKYKNFGSISLLITGDEEGP  141 (389)
Q Consensus        76 vp~~~~~~W~~~Pf~~~~~~g~l~G---------rG~~D~K---g~ia~~l~a~~~l~~~~~~~~~i~~~~~~dEE~~  141 (389)
                      -|.|+.+   .+....-+-.|.-|=         .|..+||   +|-++.+.++..+.+.. ...+|..++...|-..
T Consensus       175 ~P~g~~~---a~v~~aLVGKGITFDSGGlsLKps~~M~~MK~DMgGAAaV~ga~~~a~~~~-l~~~V~~il~~aENm~  248 (424)
T PRK05015        175 NPTGDPD---APVSACLVGKGITFDSGGYSIKPSAGMDSMKSDMGGAATVTGALALAITRG-LNKRVKLFLCCAENLI  248 (424)
T ss_pred             CCCCCCC---CCCEEEEECCCEEEECCCCCCCCCCCHHHHHCCCHHHHHHHHHHHHHHHCC-CCCEEEEEEEEECCCC
T ss_conf             6899877---752189976621070898673762315451465527999999999999729-9960899988550577


No 84 
>PRK02813 putative aminopeptidase 2; Provisional
Probab=82.41  E-value=0.75  Score=24.21  Aligned_cols=72  Identities=17%  Similarity=0.187  Sum_probs=50.2

Q ss_pred             HHHHHHHHHHHHHHHHCCCCEE-----EECCCCCHHHHHH-H-CCCEEEEEECCCCCCCCCCEEEHHHHHHHHHHHHHHH
Q ss_conf             7899999999999982899579-----7414543588986-0-5989999004787368784047999999999999999
Q gi|254780782|r  308 DRKLTSLLSKSIYNTTGNIPLL-----STSGGTSDARFIK-D-YCPVIEFGLVGRTMHALNENASLQDLEDLTCIYENFL  380 (389)
Q Consensus       308 ~~~l~~~l~~a~~~~~g~~~~~-----~~~gg~~d~~~~~-~-~iP~v~fGp~~~~~H~pdE~i~i~~l~~~~~~~~~~i  380 (389)
                      |......+++.+++. +.+...     ...+|+|-+.+++ . +++++-+|+.--.+|++.|-+...|+...+++|..+.
T Consensus       347 d~~~~a~~~~i~~~~-~ip~Q~f~~r~D~~gGsTIGpi~as~~gi~tvDiG~p~LsMHS~rE~~~~~D~~~~~~~~~aFf  425 (427)
T PRK02813        347 DSETAAVFALLCEKA-GVPVQEFVNRSDMPCGSTIGPITAARLGIPTVDIGAPLLAMHSIRELAGVKDHAYLIKALTAFF  425 (427)
T ss_pred             CHHHHHHHHHHHHHC-CCCEEEEEECCCCCCCHHHHHHHHHHCCCCEEEECHHHHHHHHHHHHHCCCHHHHHHHHHHHHH
T ss_conf             889999999999987-9976882524899970039999875379978983677663107888855130999999999984


No 85 
>PRK02256 putative aminopeptidase 1; Provisional
Probab=82.28  E-value=3  Score=20.51  Aligned_cols=72  Identities=25%  Similarity=0.306  Sum_probs=48.8

Q ss_pred             HHHHHHHHHHHHHHHHCCCCEE------EECCCCCHHHHHH-HCCCEEEEEECCCCCCCCCCEEEHHHHHHHHHHHHHHH
Q ss_conf             7899999999999982899579------7414543588986-05989999004787368784047999999999999999
Q gi|254780782|r  308 DRKLTSLLSKSIYNTTGNIPLL------STSGGTSDARFIK-DYCPVIEFGLVGRTMHALNENASLQDLEDLTCIYENFL  380 (389)
Q Consensus       308 ~~~l~~~l~~a~~~~~g~~~~~------~~~gg~~d~~~~~-~~iP~v~fGp~~~~~H~pdE~i~i~~l~~~~~~~~~~i  380 (389)
                      +...+..+++.+++ .+.+...      ...+|+|-+...+ .++++|-+|...-.+|++.|-..+.|+...++++..|.
T Consensus       380 ~a~~~a~~~~i~~~-a~Vp~Q~f~v~r~D~~~GsTIGpi~A~~Gi~tVDvG~P~LsMHSiRE~~g~~D~~~~~~~~~aFf  458 (459)
T PRK02256        380 NAEFVAEVRKIFNK-NGVVWQTAELGKVDQGGGGTIAKFLAQYGMEVIDCGVALLSMHSPFEIASKADIYETYKAYKAFL  458 (459)
T ss_pred             CHHHHHHHHHHHHH-CCCCEEEEEECCCCCCCCCHHHHHHHHCCCCEEECCHHHHHHHHHHHHHCCCHHHHHHHHHHHHH
T ss_conf             58999999999987-79975777740588998441789987279988970676654208988854330999999999972


No 86 
>TIGR01754 flav_RNR ribonucleotide reductase-associated flavodoxin, putative; InterPro: IPR010088   This entry represents a family of proteins found immediately downstream of ribonucleotide reductase genes in Xyella fastidiosa and some Gram-positive bacteria. It appears to be a highly divergent flavodoxin of the short chain type, more like the flavodoxins of the sulphate-reducing genus Desulfovibrio than like the NifF flavodoxins associated with nitrogen fixation..
Probab=78.85  E-value=3.3  Score=20.28  Aligned_cols=105  Identities=21%  Similarity=0.241  Sum_probs=58.2

Q ss_pred             HHHHCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEE-EECCCCCEEEEECCCCCCCCCCHHHCCCCC
Q ss_conf             9996499978996899999999999779848999705888762489999-987999889997336815788877725666
Q gi|254780782|r   10 IQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYA-RFGTEAPHLMFAGHIDVVPPGDFNHWTYPP   88 (389)
Q Consensus        10 ~~lv~ips~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~-~~g~~~~~ill~~H~Dtvp~~~~~~W~~~P   88 (389)
                      +=|++..|.|+|-+.+|+.++++|.+.|.++..+..+...      |.. -..+..=++.|.|           .|+-+ 
T Consensus         2 RillAy~slSGNT~eVA~~I~~~l~~~G~eVDW~~~r~~~------La~~pldPe~ydL~~LG-----------twT~~-   63 (145)
T TIGR01754         2 RILLAYLSLSGNTKEVADIIRDILEKDGHEVDWVEFRIST------LADAPLDPEDYDLYLLG-----------TWTVE-   63 (145)
T ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHHHCCCEEEEEEECCHH------HHCCCCCCCCCCEEEEE-----------EEECC-
T ss_conf             5765354148777899999999998479776766400046------42467899863157743-----------12235-


Q ss_pred             CCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCEECCCCCCCCCC
Q ss_conf             4224521332365443332012454410000000113578349997520220110442111110
Q gi|254780782|r   89 FSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSW  152 (389)
Q Consensus        89 f~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~~~~~~i~~~~~~dEE~~~~~G~~~l~~~  152 (389)
                                +||==-|||--|+-+...+      +||. ++.+.-++| -  -.+|..+++..
T Consensus        64 ----------~GrTP~e~KdFiaEl~~li------GKP~-nvaiFGTGe-T--QwGG~d~yCgA  107 (145)
T TIGR01754        64 ----------RGRTPDEMKDFIAELAVLI------GKPK-NVAIFGTGE-T--QWGGDDYYCGA  107 (145)
T ss_pred             ----------CCCCCHHHHHHHHHHHHHH------CCCC-CEEEECCCC-C--CCCCCCCCHHH
T ss_conf             ----------7899666899999999983------6998-248865887-5--52886540247


No 87 
>cd00433 Peptidase_M17 Cytosol aminopeptidase family, N-terminal and catalytic domains.  Family M17 contains zinc- and manganese-dependent exopeptidases ( EC  3.4.11.1), including leucine aminopeptidase. They catalyze removal of amino acids from the N-terminus of a protein and play a key role in protein degradation and in the metabolism of biologically active peptides. They do not contain HEXXH motif (which is used as one of the signature patterns to group the peptidase families) in the metal-binding site. The two associated zinc ions and the active site are entirely enclosed within the C-terminal catalytic domain in leucine aminopeptidase. The enzyme is a hexamer, with the catalytic domains clustered around the three-fold axis, and the two trimers related to one another by a two-fold rotation. The N-terminal domain is structurally similar to the ADP-ribose binding Macro domain. This family includes proteins from bacteria, archaea, animals and plants.
Probab=78.23  E-value=4.7  Score=19.31  Aligned_cols=40  Identities=18%  Similarity=0.052  Sum_probs=20.7

Q ss_pred             HHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             9999999964999789968999999999997798489997
Q gi|254780782|r    5 CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKD   44 (389)
Q Consensus         5 ~v~~l~~lv~ips~s~~e~~~~~~l~~~l~~~G~~~~~~~   44 (389)
                      -+.+-++|++.|+---.-...++..++.+++.|++++.++
T Consensus       156 gv~laRdLvn~P~N~ltP~~lA~~a~~la~~~g~~v~Vld  195 (468)
T cd00433         156 GVNLARDLVNTPANDLTPTYLAEEAKELAKELGVKVEVLD  195 (468)
T ss_pred             HHHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             9999999744896016999999999998640798799970


No 88 
>pfam00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain. The two associated zinc ions and the active site are entirely enclosed within the C-terminal catalytic domain in leucine aminopeptidase.
Probab=77.23  E-value=5  Score=19.13  Aligned_cols=125  Identities=15%  Similarity=0.079  Sum_probs=65.6

Q ss_pred             HHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCC-CEEEEEEEC---CCCCCEEEEEEEE-ECC-CCCEEEEECCCCCCCCC
Q ss_conf             99999996499978996899999999999779-848999705---8887624899999-879-99889997336815788
Q gi|254780782|r    6 LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLG-FSIEEKDFQ---TKNTSIVKNLYAR-FGT-EAPHLMFAGHIDVVPPG   79 (389)
Q Consensus         6 v~~l~~lv~ips~s~~e~~~~~~l~~~l~~~G-~~~~~~~~~---~~~~~~~~~~~~~-~g~-~~~~ill~~H~Dtvp~~   79 (389)
                      |.+-++|++.|+---.-...++++++.+++.+ ++++..+-.   ..+++.   +++. .|+ ..|.++...|.   |.+
T Consensus         1 VnlaRdLvn~P~N~ltP~~~a~~~~~~~~~~~~~~v~v~~~~~l~~~gmg~---llaVg~GS~~~P~lv~l~y~---~~~   74 (312)
T pfam00883         1 VNLARDLVNTPANILTPAVLAEEAEKLASNYSDVKIEVLDEEELEELGMGG---LLAVNKGSENPPRFIVLSYK---GNK   74 (312)
T ss_pred             CHHHHHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEEEEHHHHHHCCCCC---EEEEECCCCCCCCEEEEEEC---CCC
T ss_conf             926774003794554999999999999865699289996199998589974---77662356889832799988---988


Q ss_pred             CHHHCCCCCCCEE----E-E-CC-CCC-CCCCCCCC---CHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCC
Q ss_conf             8777256664224----5-2-13-323-65443332---012454410000000113578349997520220
Q gi|254780782|r   80 DFNHWTYPPFSAT----I-A-EG-KIY-GRGIVDMK---GSIACFIAAVARFIPKYKNFGSISLLITGDEEG  140 (389)
Q Consensus        80 ~~~~W~~~Pf~~~----~-~-~g-~l~-GrG~~D~K---g~ia~~l~a~~~l~~~~~~~~~i~~~~~~dEE~  140 (389)
                      .  .+ ..|..++    . | +| .|. +.|..+||   +|-|+.+.+++++.+.. +..+|..++...|-.
T Consensus        75 ~--~~-~~~i~lVGKGvTFDtGGl~lKp~~~M~~Mk~DM~GAA~v~g~~~aia~l~-l~v~v~~i~~l~EN~  142 (312)
T pfam00883        75 K--ED-KKKLALVGKGITFDSGGISIKPGAGMDLMKYDMGGAAAVLGAIKALAQLK-PPVNVVAVLALTENM  142 (312)
T ss_pred             C--CC-CCEEEEECCCEEECCCCCCCCCCHHHHHHHCCCHHHHHHHHHHHHHHHHC-CCCCEEEEEEEECCC
T ss_conf             8--77-76289953760633665788066226565455315899999999999849-986479998701037


No 89 
>KOG2597 consensus
Probab=73.79  E-value=6.2  Score=18.58  Aligned_cols=53  Identities=19%  Similarity=0.135  Sum_probs=23.0

Q ss_pred             HHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEE--EECCCCCEEEEECCCCCC
Q ss_conf             99999999999779848999705888762489999--987999889997336815
Q gi|254780782|r   24 GAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYA--RFGTEAPHLMFAGHIDVV   76 (389)
Q Consensus        24 ~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~--~~g~~~~~ill~~H~Dtv   76 (389)
                      ..++++.+++...|..++.++-+.-......-+++  ......|.++..+|..+-
T Consensus       210 ~fae~a~~~~~~~~v~v~V~~~~~i~~~~~~~~l~V~k~s~~pP~ll~lsY~g~~  264 (513)
T KOG2597         210 QFAEEAVDVLCPLGVTVEVRDEEWIEEQGMNSFLAVAKASCEPPRLLELSYKGTS  264 (513)
T ss_pred             HHHHHHHHHHCCCCCEEEEECHHHHHHCCCCCEEEECCCCCCCCEEEEEEECCCC
T ss_conf             9999999861324742899424777654465002321456889879999962898


No 90 
>pfam05450 Nicastrin Nicastrin. Nicastrin and presenilin are two major components of the gamma-secretase complex, which executes the intramembrane proteolysis of type I integral membrane proteins such as the amyloid precursor protein (APP) and Notch. Nicastrin is synthesized in fibroblasts and neurons as an endoglycosidase-H-sensitive glycosylated precursor protein (immature nicastrin) and is then modified by complex glycosylation in the Golgi apparatus and by sialylation in the trans-Golgi network (mature nicastrin). A region featured in this family has a fold similar to human transferrin receptor (TfR) and a bacterial aminopeptidase. It is implicated in the pathogenesis of Alzheimer's disease.
Probab=73.33  E-value=1.9  Score=21.77  Aligned_cols=73  Identities=11%  Similarity=0.132  Sum_probs=48.5

Q ss_pred             CEEEEECCCCCCCCCCHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHCCCCCCCC----CCCCCEEEEEEEECCC
Q ss_conf             889997336815788877725666422452133236544333201245441000000011----3578349997520220
Q gi|254780782|r   65 PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY----KNFGSISLLITGDEEG  140 (389)
Q Consensus        65 ~~ill~~H~Dtvp~~~~~~W~~~Pf~~~~~~g~l~GrG~~D~Kg~ia~~l~a~~~l~~~~----~~~~~i~~~~~~dEE~  140 (389)
                      |-|+..+.||+---          |       +-.+.|+.+.-.|++++|+|++.|.+..    ...++|.|.|-..|.-
T Consensus         1 kiIlv~armDS~s~----------f-------~~~~~Ga~~~~sg~v~llaaa~~L~~~~~~~~~~~~~v~F~~f~GE~~   63 (227)
T pfam05450         1 KVVLVTARMDSTSM----------F-------DGVSLGAMSSLSGFIVLLAAADALSKALPDISNLKRNVLFAFFNGESY   63 (227)
T ss_pred             CEEEEEECCCCHHC----------C-------CCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCC
T ss_conf             97999943550424----------3-------556776566257899999999999875223234676569998578523


Q ss_pred             EECCCCCCCCCCCCC
Q ss_conf             110442111110001
Q gi|254780782|r  141 PAINGTKKMLSWIEK  155 (389)
Q Consensus       141 ~~~~G~~~l~~~~~~  155 (389)
                       ++-|+..++..+++
T Consensus        64 -dYiGS~r~vyDm~~   77 (227)
T pfam05450        64 -DYIGSQRFVYDMEN   77 (227)
T ss_pred             -CCCCHHHHHHHHHH
T ss_conf             -43132999999870


No 91 
>PRK00913 leucyl aminopeptidase; Provisional
Probab=67.26  E-value=8.6  Score=17.70  Aligned_cols=15  Identities=20%  Similarity=0.096  Sum_probs=8.6

Q ss_pred             HHHHHHHHHHHHHHH
Q ss_conf             999999999999987
Q gi|254780782|r  369 LEDLTCIYENFLQNW  383 (389)
Q Consensus       369 l~~~~~~~~~~i~~~  383 (389)
                      -=.+++++.+++.++
T Consensus       474 tG~~vr~l~~~~~~~  488 (491)
T PRK00913        474 TGRGVRLLVQFLLNR  488 (491)
T ss_pred             CCHHHHHHHHHHHHH
T ss_conf             533299999999986


No 92 
>pfam02127 Peptidase_M18 Aminopeptidase I zinc metalloprotease (M18).
Probab=66.19  E-value=3.9  Score=19.81  Aligned_cols=68  Identities=15%  Similarity=0.201  Sum_probs=46.3

Q ss_pred             HHHHHHHHHHHHHCCCCEEE-----ECCCCCHHHHHH--HCCCEEEEEECCCCCCCCCCEEEHHHHHHHHHHHHHH
Q ss_conf             99999999999828995797-----414543588986--0598999900478736878404799999999999999
Q gi|254780782|r  311 LTSLLSKSIYNTTGNIPLLS-----TSGGTSDARFIK--DYCPVIEFGLVGRTMHALNENASLQDLEDLTCIYENF  379 (389)
Q Consensus       311 l~~~l~~a~~~~~g~~~~~~-----~~gg~~d~~~~~--~~iP~v~fGp~~~~~H~pdE~i~i~~l~~~~~~~~~~  379 (389)
                      -...+.+.+++ .+......     ..+|+|-+..++  .+++++-+|+.--.+|++.|-+...|+...+++|..|
T Consensus       350 ~~a~~~~i~~~-a~vp~Q~f~~r~d~~~GsTiGpi~~a~~Gi~tvDiG~P~LsMHS~rE~~~~~D~~~~~~~~~aF  424 (425)
T pfam02127       350 GAALVKRVAQL-ANVPLQVFVVRNDSPCGSTIGPILAARTGIRTIDLGPAQLSMHSIRETTGSADLYEAYKLFKAF  424 (425)
T ss_pred             HHHHHHHHHHH-CCCCEEEEEECCCCCCCCHHHHHHHHHCCCCEEEECHHHHHHHHHHHHHCCCHHHHHHHHHHHH
T ss_conf             69999999998-6997789886788987533989998766998897078776411798885421099999999975


No 93 
>PRK09271 flavodoxin; Provisional
Probab=63.57  E-value=7.2  Score=18.15  Aligned_cols=36  Identities=8%  Similarity=0.085  Sum_probs=29.9

Q ss_pred             HHCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECC
Q ss_conf             964999789968999999999997798489997058
Q gi|254780782|r   12 LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQT   47 (389)
Q Consensus        12 lv~ips~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~   47 (389)
                      +|-.-|.|+|-+.+|+.|++.|++.|.+++.++...
T Consensus         4 lIvYaS~TGNTE~vA~~I~~~l~~~G~eV~~~e~d~   39 (160)
T PRK09271          4 LLAYASLSGNTREVARMIAARCEEAGHAVTWVETDL   39 (160)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHHHCCCEEEEEEECC
T ss_conf             999984887689999999999997698237987010


No 94 
>TIGR02610 PHA_gran_rgn putative polyhydroxyalkanoic acid system protein; InterPro: IPR013433    Proteins in this entry are encoded by genes involved in either polyhydroxyalkanoic acid (PHA) biosynthesis or utilisation, including proteins at found at the surface of PHA granules. These proteins have so far been found in the Pseudomonadales, Xanthomonadales, and Vibrionales, all of which belong to the Gammaproteobacteria..
Probab=63.49  E-value=9.6  Score=17.39  Aligned_cols=83  Identities=12%  Similarity=0.074  Sum_probs=53.3

Q ss_pred             ECCCCHHHHCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             12310000001201345544320112233445664421014667655420466655432116651343420677999999
Q gi|254780782|r  195 KQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKE  274 (389)
Q Consensus       195 ~~~Hs~~p~~g~nAi~~~~~~i~~l~~~~~~~~~~~~~~~~~~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~  274 (389)
                      +-.||-.|...+.+++.+++=+..=+.+...     +..-++++.+= +-.+++|+.|++..+++.+-+.-..-.--|+.
T Consensus         7 ~r~Hslg~~aARak~e~la~KL~d~Ygl~~~-----W~GDtl~~aRs-Gv~Gav~~g~~~irv~~eLG~llSaM~g~iks   80 (91)
T TIGR02610         7 ERDHSLGKAAARAKAEDLARKLTDRYGLASH-----WEGDTLRIARS-GVDGAVHLGEESIRVEVELGMLLSAMSGTIKS   80 (91)
T ss_pred             ECCCCCCHHHHHHHHHHHHHHHHHHCCCCCC-----CCCCEEEEEEC-CCCCEEEECCCEEEEEEEECHHHHHCCCCCHH
T ss_conf             2145888789999999999863654388545-----78976677751-67733642784168863101165302875368


Q ss_pred             HHHHHHHHH
Q ss_conf             999987653
Q gi|254780782|r  275 EIRSRLIKG  283 (389)
Q Consensus       275 ~i~~~l~~~  283 (389)
                      +|+..+.+.
T Consensus        81 EI~raLdk~   89 (91)
T TIGR02610        81 EIERALDKA   89 (91)
T ss_pred             HHHHHHHHH
T ss_conf             899998863


No 95 
>COG1362 LAP4 Aspartyl aminopeptidase [Amino acid transport and metabolism]
Probab=61.14  E-value=11  Score=16.99  Aligned_cols=74  Identities=20%  Similarity=0.196  Sum_probs=51.8

Q ss_pred             HHHHHHHHHHHHHHHHCCCCEEE-----ECCCCCHHH-H-HHHCCCEEEEEECCCCCCCCCCEEEHHHHHHHHHHHHHHH
Q ss_conf             78999999999999828995797-----414543588-9-8605989999004787368784047999999999999999
Q gi|254780782|r  308 DRKLTSLLSKSIYNTTGNIPLLS-----TSGGTSDAR-F-IKDYCPVIEFGLVGRTMHALNENASLQDLEDLTCIYENFL  380 (389)
Q Consensus       308 ~~~l~~~l~~a~~~~~g~~~~~~-----~~gg~~d~~-~-~~~~iP~v~fGp~~~~~H~pdE~i~i~~l~~~~~~~~~~i  380 (389)
                      |+..+..+++.+++ .+.+....     ..+|++-+. + -+.|++++..|+.--.+|++.|-....|+....+.|..|.
T Consensus       355 d~~~~a~~~~l~~~-~~Vp~Q~f~~~~d~~~Gstigpi~aa~tGi~tIDiG~~~LsMHS~rE~~g~~D~~~~~~~~~aFf  433 (437)
T COG1362         355 DSEGIALLRKLAQK-AGVPWQVFVLRNDVPCGSTIGPILAARTGIRTIDIGPALLSMHSIRELSGSADLYEAYKALSAFF  433 (437)
T ss_pred             CCHHHHHHHHHHHH-CCCCEEEEEECCCCCCCCCCCHHHHHHCCCCEEECCHHHHHHCCHHHHCCHHHHHHHHHHHHHHH
T ss_conf             72679999999987-69954898703668898651046786539854624646664025887705257999999999998


Q ss_pred             HH
Q ss_conf             98
Q gi|254780782|r  381 QN  382 (389)
Q Consensus       381 ~~  382 (389)
                      ++
T Consensus       434 ~~  435 (437)
T COG1362         434 EN  435 (437)
T ss_pred             HC
T ss_conf             51


No 96 
>pfam01364 Peptidase_C25 Peptidase family C25.
Probab=57.94  E-value=13  Score=16.66  Aligned_cols=95  Identities=16%  Similarity=0.158  Sum_probs=57.1

Q ss_pred             HHHHHHHHHHHHCCCEEEEEEECCCCCCE----E----EEEEEEECCCCCEEEEECCCCCCCCCCHHHCCCCCCCEEEEC
Q ss_conf             99999999999779848999705888762----4----899999879998899973368157888777256664224521
Q gi|254780782|r   24 GAFFILVNTLKLLGFSIEEKDFQTKNTSI----V----KNLYARFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAE   95 (389)
Q Consensus        24 ~~~~~l~~~l~~~G~~~~~~~~~~~~~~~----~----~~~~~~~g~~~~~ill~~H~Dtvp~~~~~~W~~~Pf~~~~~~   95 (389)
                      ..++-+.+|=++.||+++.........+.    +    .+.|-..++...-|||.|+.|.+|.....+..+|+.=..+++
T Consensus        22 ~~l~~~v~WK~q~G~~~~V~~~~~~~~G~t~~~Ik~yI~~~Y~~~~~~~~yvLLVGD~~~ip~~~g~~~~sD~~Y~~~~G  101 (349)
T pfam01364        22 GDIKDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVG  101 (349)
T ss_pred             HHHHHHHHHHHHCCCEEEEEEEECCCCCCCHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCEEECC
T ss_conf             87778998987189726999720246788899999999999736788854999962566677656899988701241446


Q ss_pred             -----CCCCCCCCCCCCCHHHHHHHHCC
Q ss_conf             -----33236544333201245441000
Q gi|254780782|r   96 -----GKIYGRGIVDMKGSIACFIAAVA  118 (389)
Q Consensus        96 -----g~l~GrG~~D~Kg~ia~~l~a~~  118 (389)
                           +.++||=+++.-.-+..++.-..
T Consensus       102 ~D~~pdv~iGR~s~~~~~~l~~~v~k~i  129 (349)
T pfam01364       102 NDHYNEVFIGRFSCESKEDLKTQIDRTI  129 (349)
T ss_pred             CCCCCHHEEEEECCCCHHHHHHHHHHHH
T ss_conf             6556323178505799999999999999


No 97 
>KOG2596 consensus
Probab=56.12  E-value=9  Score=17.58  Aligned_cols=52  Identities=15%  Similarity=0.378  Sum_probs=42.3

Q ss_pred             CCCCHHHHHH--HCCCEEEEEECCCCCCCCCCEEEHHHHHHHHHHHHHHHHHHC
Q ss_conf             4543588986--059899990047873687840479999999999999999872
Q gi|254780782|r  333 GGTSDARFIK--DYCPVIEFGLVGRTMHALNENASLQDLEDLTCIYENFLQNWF  384 (389)
Q Consensus       333 gg~~d~~~~~--~~iP~v~fGp~~~~~H~pdE~i~i~~l~~~~~~~~~~i~~~~  384 (389)
                      .|++-+..++  .|+.++.+|...-.+|+..|...-+|+..++++|-.+-++|-
T Consensus       417 cGsTIGPiLAS~~G~RTlDlG~pqLsMHSiRe~~gs~dv~~~~~lFk~Ff~~f~  470 (479)
T KOG2596         417 CGSTIGPILASKTGIRTLDLGIPQLSMHSIREMCGSKDVEQAVKLFKGFFERFS  470 (479)
T ss_pred             CCCCCCHHHHHHCCCEEEECCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHH
T ss_conf             866444366520485466158526666789987486418999999999998766


No 98 
>TIGR01931 cysJ sulfite reductase [NADPH] flavoprotein, alpha-component; InterPro: IPR010199   This entry describes an NADPH-dependent sulphite reductase flavoprotein subunit. Most members of the proteins of this entry are found in Cys biosynthesis gene clusters. The closest homologues are designated as subunits nitrate reductase.; GO: 0004783 sulfite reductase (NADPH) activity, 0000103 sulfate assimilation, 0019344 cysteine biosynthetic process.
Probab=52.99  E-value=15  Score=16.16  Aligned_cols=49  Identities=16%  Similarity=0.093  Sum_probs=36.2

Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCE------EEEEEEEECCCCC
Q ss_conf             978996899999999999779848999705888762------4899999879998
Q gi|254780782|r   17 SVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSI------VKNLYARFGTEAP   65 (389)
Q Consensus        17 s~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~------~~~~~~~~g~~~~   65 (389)
                      |.++|-+.+|+-+.+.|+..|+.+......+-....      ...|+.|.|+++|
T Consensus        76 SQTGNAr~~A~~l~~~l~~~g~~V~l~~~~dYk~k~lk~E~~L~lv~STqGEGEP  130 (628)
T TIGR01931        76 SQTGNARRLAKALAEKLEAAGLSVRLVSADDYKFKQLKSERLLLLVISTQGEGEP  130 (628)
T ss_pred             CCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCEEEEEEEECCCCCC
T ss_conf             1134278999999999986598388961026883201045178999853689896


No 99 
>COG0260 PepB Leucyl aminopeptidase [Amino acid transport and metabolism]
Probab=51.50  E-value=16  Score=16.01  Aligned_cols=14  Identities=21%  Similarity=0.000  Sum_probs=8.4

Q ss_pred             HHHHHHHHHHHHHC
Q ss_conf             99999999999872
Q gi|254780782|r  371 DLTCIYENFLQNWF  384 (389)
Q Consensus       371 ~~~~~~~~~i~~~~  384 (389)
                      .+++++.+++++++
T Consensus       471 ~~VrtL~~~l~~~~  484 (485)
T COG0260         471 VGVRTLAQFLLNRA  484 (485)
T ss_pred             CCHHHHHHHHHHHC
T ss_conf             12999999999862


No 100
>PTZ00323 NAD+ synthase; Provisional
Probab=48.90  E-value=18  Score=15.76  Aligned_cols=44  Identities=11%  Similarity=0.079  Sum_probs=36.2

Q ss_pred             CCHHHHHHHHHHHCCCCCCCCHH--HHHHHHHHHHHHCCCEEEEEE
Q ss_conf             98789999999964999789968--999999999997798489997
Q gi|254780782|r    1 MTPDCLEHLIQLIKCPSVTPQDG--GAFFILVNTLKLLGFSIEEKD   44 (389)
Q Consensus         1 l~~e~v~~l~~lv~ips~s~~e~--~~~~~l~~~l~~~G~~~~~~~   44 (389)
                      |.|+.-+.+.+|-..|+..|.+.  ...+||++++++.||+--.+.
T Consensus         7 ~~~~~~~ii~e~~~~~~~dp~~eI~~rv~fLrDYv~k~GfkgvVLG   52 (294)
T PTZ00323          7 LHPELQRVLEEYRRTRAFDPVAWIEMKCAKLNEYMRRCGLKACVTS   52 (294)
T ss_pred             CCHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             9999999999968888889899999999999999998299859995


No 101
>COG3375 Uncharacterized conserved protein [Function unknown]
Probab=46.83  E-value=19  Score=15.56  Aligned_cols=49  Identities=18%  Similarity=0.141  Sum_probs=29.1

Q ss_pred             HHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEECCCCCEEEEECCCCCCC
Q ss_conf             9999999997798489997058887624899999879998899973368157
Q gi|254780782|r   26 FFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDVVP   77 (389)
Q Consensus        26 ~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g~~~~~ill~~H~Dtvp   77 (389)
                      ++.+. .|+..|=-+- -.+..++ ..++..++..|..+..+.++|||=-|-
T Consensus        35 ~d~i~-al~~~GGlvl-gAf~~dg-~lVGls~G~pg~r~g~~y~ySH~~gV~   83 (266)
T COG3375          35 ADTIR-ALRYHGGLVL-GAFSADG-RLVGLSYGYPGGRGGSLYLYSHMLGVR   83 (266)
T ss_pred             HHHHH-HHHHCCCEEE-EEECCCC-CEEEEEECCCCCCCCCEEEEEEEHHCC
T ss_conf             88999-9986188699-9873898-378788525776787556553002145


No 102
>COG4635 HemG Flavodoxin [Energy production and conversion / Coenzyme metabolism]
Probab=44.73  E-value=19  Score=15.61  Aligned_cols=35  Identities=17%  Similarity=0.202  Sum_probs=26.8

Q ss_pred             HHHCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEE
Q ss_conf             99649997899689999999999977984899970
Q gi|254780782|r   11 QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDF   45 (389)
Q Consensus        11 ~lv~ips~s~~e~~~~~~l~~~l~~~G~~~~~~~~   45 (389)
                      -||..-|..++-..++++++..|++.|.+++..++
T Consensus         3 ~LIlYstr~GqT~kIA~~iA~~L~e~g~qvdi~dl   37 (175)
T COG4635           3 TLILYSTRDGQTRKIAEYIASHLRESGIQVDIQDL   37 (175)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEEEH
T ss_conf             69998347775899999999975541770565365


No 103
>TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase; InterPro: IPR006257   This group of sequences represent one of several closely related clades of the dihydrolipoamide acetyltransferase subunit of the pyruvate dehydrogenase complex. It includes sequences from mitochondria and from alpha and beta branches of the proteobacteria, as well as from some other bacteria, but not the Gram-positive bacteria.; GO: 0004742 dihydrolipoyllysine-residue acetyltransferase activity, 0006090 pyruvate metabolic process, 0045254 pyruvate dehydrogenase complex.
Probab=44.49  E-value=21  Score=15.34  Aligned_cols=15  Identities=0%  Similarity=-0.006  Sum_probs=8.7

Q ss_pred             HHHHHHHHHHHHHHH
Q ss_conf             789999999999998
Q gi|254780782|r  308 DRKLTSLLSKSIYNT  322 (389)
Q Consensus       308 ~~~l~~~l~~a~~~~  322 (389)
                      |.-++++...|++++
T Consensus       410 ND~iikA~a~Al~~v  424 (584)
T TIGR01349       410 NDFIIKASALALREV  424 (584)
T ss_pred             CHHHHHHHHHHHHHC
T ss_conf             007999999998729


No 104
>TIGR00455 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme that catalyses the phosphorylation of adenylylsulphate to 3'-phosphoadenylylsulphate. This domain contains an ATP binding P-loop motif .; GO: 0005524 ATP binding, 0016301 kinase activity, 0016772 transferase activity transferring phosphorus-containing groups, 0000103 sulfate assimilation.
Probab=35.38  E-value=29  Score=14.46  Aligned_cols=28  Identities=18%  Similarity=0.204  Sum_probs=16.9

Q ss_pred             HHHHHHHHHHHCCCEEEEEEECCCCCCEEEEE
Q ss_conf             99999999997798489997058887624899
Q gi|254780782|r   25 AFFILVNTLKLLGFSIEEKDFQTKNTSIVKNL   56 (389)
Q Consensus        25 ~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~   56 (389)
                      +|..+++.|.+.|+.++..|    +.+.+.+|
T Consensus        35 iA~Al~~~L~~~G~~~~~LD----GDnvR~gL   62 (187)
T TIGR00455        35 IANALEKKLEKKGYRVYVLD----GDNVRHGL   62 (187)
T ss_pred             HHHHHHHHHHHCCCEEEEEC----CCEEECCC
T ss_conf             99999999996697499975----86342477


No 105
>PRK10953 cysJ sulfite reductase subunit alpha; Provisional
Probab=31.45  E-value=34  Score=14.07  Aligned_cols=30  Identities=10%  Similarity=-0.062  Sum_probs=22.5

Q ss_pred             CCCHHHHHHHHHHHHHHCCCEEEEEEECCC
Q ss_conf             899689999999999977984899970588
Q gi|254780782|r   19 TPQDGGAFFILVNTLKLLGFSIEEKDFQTK   48 (389)
Q Consensus        19 s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~   48 (389)
                      |++-++.|+-+.+.+++.||++...+..+-
T Consensus        72 TGnAe~~A~~l~~~~~~~g~~~~v~~m~dy  101 (599)
T PRK10953         72 TGNARRVAEALRDDLLAAKLNVNLVNAGDY  101 (599)
T ss_pred             CHHHHHHHHHHHHHHHHCCCCCEEECHHHC
T ss_conf             357999999999999976998587453769


No 106
>TIGR01753 flav_short flavodoxin; InterPro: IPR010087   Flavodoxins are small redox-active proteins with a flavin mononucleotide (FMN) prosthetic group. They function as electron transfer agents in a variety of microbial metabolic processes, including nitrogen fixation by nitrogenase , sulphite reduction , and light-dependent NADP+ reduction during photosynthesis . This entry describes the short chain type. Many of these are involved in sulphite reduction.; GO: 0010181 FMN binding, 0006118 electron transport.
Probab=30.66  E-value=35  Score=13.98  Aligned_cols=33  Identities=18%  Similarity=0.128  Sum_probs=28.1

Q ss_pred             CCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCC
Q ss_conf             997899689999999999977984899970588
Q gi|254780782|r   16 PSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTK   48 (389)
Q Consensus        16 ps~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~   48 (389)
                      -|-|+|-..+|+.|++-|++.|.+++...+.+-
T Consensus         6 ~S~TGNTE~~A~~I~e~l~~~g~~V~~~~~~d~   38 (146)
T TIGR01753         6 ASMTGNTEEMANIIEEGLKEAGADVDLLEVADV   38 (146)
T ss_pred             ECCCCHHHHHHHHHHHHHHHCCCCEEEEEEEEC
T ss_conf             418812899999999999856886257852017


No 107
>TIGR01990 bPGM beta-phosphoglucomutase; InterPro: IPR010972   This model represents the beta-phosphoglucomutase enzyme which catalyses the interconversion of beta-D-glucose-1-phosphate and beta-D-glucose-6-phosphate. The 6-phosphate is capable of non-enzymatic anomerization (alpha to beta or vice versa) while the 1-phosphate is not. A separate enzyme is responsible for the isomerisation of the alpha anomers. Beta-D-glucose-1-phosphate results from the phosphorolysis of maltose (2.4.1.8 from EC), trehalose (2.4.1.64 from EC) or trehalose-6-phosphate (2.4.1.216 from EC). Alternatively, these reactions can be run in the synthetic direction to create the disaccharides. All sequenced genomes which contain a member of this family also appear to contain at least one putative maltose or trehalose phosphorylase. Three species, Lactococcus, Enterococcus and Neisseria appear to contain a pair of paralogous beta-PGM's.   Beta-phosphoglucomutase is a member of the haloacid dehalogenase superfamily of hydrolase enzymes. These enzymes are characterised by a series of three catalytic motifs positioned within an alpha-beta (Rossman) fold . Beta-PGM contains an inserted alpha helical domain in between the first and second conserved motifs and thus is a member of subfamily IA of the superfamily , . The third catalytic motif comes in three variants, the third of which, containing a conserved DD or ED, is the only one found here as well as in several other related enzymes.    The enzyme from Lactococcus lactis has been extensively characterised including a remarkable crystal structure which traps the pentacoordinate transition state . .
Probab=28.73  E-value=11  Score=17.07  Aligned_cols=24  Identities=13%  Similarity=0.159  Sum_probs=10.3

Q ss_pred             ECCCCC-CHHHHHHHHHHHHHHHHH
Q ss_conf             134342-067799999999998765
Q gi|254780782|r  259 FNIRFN-DLWNEKTLKEEIRSRLIK  282 (389)
Q Consensus       259 ~diR~~-~~~~~~~i~~~i~~~l~~  282 (389)
                      ..+|+. .+.+++++..-|.+.+.+
T Consensus        79 ~Y~~LlD~~lTp~d~LPGi~~lL~~  103 (190)
T TIGR01990        79 YYVELLDKELTPEDVLPGIKSLLED  103 (190)
T ss_pred             HHHHHHHCCCCHHHHCCCHHHHHHH
T ss_conf             9999975068986604018999999


No 108
>pfam02784 Orn_Arg_deC_N Pyridoxal-dependent decarboxylase, pyridoxal binding domain. These pyridoxal-dependent decarboxylases acting on ornithine, lysine, arginine and related substrates This domain has a TIM barrel fold.
Probab=28.25  E-value=38  Score=13.73  Aligned_cols=12  Identities=0%  Similarity=0.163  Sum_probs=4.4

Q ss_pred             HHHHHHHHHHHH
Q ss_conf             999999999982
Q gi|254780782|r  312 TSLLSKSIYNTT  323 (389)
Q Consensus       312 ~~~l~~a~~~~~  323 (389)
                      .+.+.+++++.+
T Consensus       215 ~~~i~~~~~~~~  226 (245)
T pfam02784       215 AEVINAALEEVF  226 (245)
T ss_pred             HHHHHHHHHHHH
T ss_conf             999999999984


No 109
>PRK07308 flavodoxin; Validated
Probab=27.78  E-value=39  Score=13.68  Aligned_cols=32  Identities=22%  Similarity=0.285  Sum_probs=24.1

Q ss_pred             CCCCCCHHHHHHHHHHHHHHCCCEEEEEEECC
Q ss_conf             99789968999999999997798489997058
Q gi|254780782|r   16 PSVTPQDGGAFFILVNTLKLLGFSIEEKDFQT   47 (389)
Q Consensus        16 ps~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~   47 (389)
                      -|.+++-+.+|+.+++.|++.|++++..+...
T Consensus         9 gS~tGnae~~A~~i~~~l~~~G~~v~v~~~~~   40 (147)
T PRK07308          9 ASMTGNTEEIADIVADKLQELGHDVDVDECTT   40 (147)
T ss_pred             ECCCHHHHHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             88972799999999999997599407611364


No 110
>TIGR02707 butyr_kinase butyrate kinase; InterPro: IPR011245   This group represents bacterial butyrate kinase, an enzyme that facilitates the formation of butyryl-CoA by phosphorylating butyrate in the presence of ATP to form butyryl phosphate . The final steps in butyrate synthesis by anaerobic bacteria can occur via butyrate kinase and phosphotransbutyrylase or via butyryl-CoA:acetate CoA-transferase, the latter providing the dominant route for butyrate formation in human colonic bacteria .; GO: 0005524 ATP binding, 0047761 butyrate kinase activity, 0016310 phosphorylation, 0005737 cytoplasm.
Probab=27.49  E-value=39  Score=13.65  Aligned_cols=35  Identities=23%  Similarity=0.174  Sum_probs=23.3

Q ss_pred             HHHHCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             99964999789968999999999997798489997
Q gi|254780782|r   10 IQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKD   44 (389)
Q Consensus        10 ~~lv~ips~s~~e~~~~~~l~~~l~~~G~~~~~~~   44 (389)
                      ++|=+++++-.|-.=.-+.+.++|++.|+++...+
T Consensus        33 eEL~~f~~v~dQfeFR~~~i~~~L~e~Gi~~~~l~   67 (353)
T TIGR02707        33 EELAKFKNVIDQFEFRKQVILEVLEEKGINISKLD   67 (353)
T ss_pred             HHHHCCCCEEECHHHHHHHHHHHHHHCCCCHHHEE
T ss_conf             87305664021126899999999874088712431


No 111
>PRK08105 flavodoxin; Provisional
Probab=27.07  E-value=40  Score=13.60  Aligned_cols=30  Identities=10%  Similarity=-0.200  Sum_probs=22.8

Q ss_pred             CCCCCCHHHHHHHHHHHHHHCCCEEEEEEE
Q ss_conf             997899689999999999977984899970
Q gi|254780782|r   16 PSVTPQDGGAFFILVNTLKLLGFSIEEKDF   45 (389)
Q Consensus        16 ps~s~~e~~~~~~l~~~l~~~G~~~~~~~~   45 (389)
                      -|.+++-+.+|+.+++.|++.|++++..+.
T Consensus         9 gS~TGnae~~A~~la~~l~~~g~~~~v~~~   38 (149)
T PRK08105          9 GTVYGNALLVAEEAEAILTAQGHEVTLFED   38 (149)
T ss_pred             ECCCHHHHHHHHHHHHHHHHCCCCEEEECH
T ss_conf             888327999999999999967994399521


No 112
>TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase; InterPro: IPR013380    Proteins in this entry are found in a variety of bacteria, and are predicted to be ATPases involved in type III secretion systems. One example is YscN (P40290 from SWISSPROT) from Yersinia enterocolitica, which is thought to energise the YOP (Yersinia outer protein) secretion system .; GO: 0046961 hydrogen ion transporting ATPase activity rotational mechanism, 0030254 protein secretion by the type III secretion system.
Probab=23.78  E-value=39  Score=13.67  Aligned_cols=32  Identities=16%  Similarity=0.177  Sum_probs=16.9

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             21166513434206779999999999876532
Q gi|254780782|r  253 AQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGI  284 (389)
Q Consensus       253 ~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~  284 (389)
                      +++|+-..|=...+...+=+-+++|+.|+-++
T Consensus       296 GSITA~YTVLvEgDd~~dP~ADEvRSILDGHI  327 (430)
T TIGR02546       296 GSITALYTVLVEGDDMNDPIADEVRSILDGHI  327 (430)
T ss_pred             CCEEEEEEEEECCCCCCCCHHHHHHHHHHHHH
T ss_conf             62534567876277799843665544542368


No 113
>PRK06703 flavodoxin; Provisional
Probab=23.54  E-value=47  Score=13.19  Aligned_cols=35  Identities=6%  Similarity=0.067  Sum_probs=27.8

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCC
Q ss_conf             49997899689999999999977984899970588
Q gi|254780782|r   14 KCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTK   48 (389)
Q Consensus        14 ~ips~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~   48 (389)
                      -.-|.|++-+.+|+.+++.|++.|++++..+..+-
T Consensus         7 ~YgS~tGnte~~A~~i~~~l~~~g~~v~~~~~~~~   41 (151)
T PRK06703          7 AYASMSGNTEDIADLIKVSLDAFDHEVVLQEMDGM   41 (151)
T ss_pred             EEECCCHHHHHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             99898617899999999999857996389760319


No 114
>pfam09211 DUF1958 Domain of unknown function (DUF1958). Members of this functionally uncharacterized family are found in prokaryotic penicillin-binding protein 4.
Probab=23.39  E-value=39  Score=13.65  Aligned_cols=30  Identities=23%  Similarity=0.526  Sum_probs=17.4

Q ss_pred             CCEEEEEC-CCCCCCCCCHHHCCCCCCCEEEECCCCC
Q ss_conf             98899973-3681578887772566642245213323
Q gi|254780782|r   64 APHLMFAG-HIDVVPPGDFNHWTYPPFSATIAEGKIY   99 (389)
Q Consensus        64 ~~~ill~~-H~Dtvp~~~~~~W~~~Pf~~~~~~g~l~   99 (389)
                      +++.-+-. -+||||-+      ..||...++||.++
T Consensus        14 gk~y~v~~DlYdvvpK~------~~ky~~~i~dgkv~   44 (65)
T pfam09211        14 GKKYYVEKDLYDVVPKG------FSKYKLKVEDGKVH   44 (65)
T ss_pred             CEEEEEECHHHHHCCCC------CCCEEEEEECCEEE
T ss_conf             88998600034233388------86306998189699


No 115
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458; InterPro: IPR006355   These sequences are all members of the IIA subfamily of the haloacid dehalogenase superfamily of aspartate-nucleophile hydrolases. .
Probab=23.25  E-value=42  Score=13.48  Aligned_cols=43  Identities=28%  Similarity=0.381  Sum_probs=17.9

Q ss_pred             HHHHHHHHHH-HCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEE
Q ss_conf             7899999999-649997899689999999999977984899970
Q gi|254780782|r    3 PDCLEHLIQL-IKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDF   45 (389)
Q Consensus         3 ~e~v~~l~~l-v~ips~s~~e~~~~~~l~~~l~~~G~~~~~~~~   45 (389)
                      .|+|++|++- +.|.=+|...+.-.+-+...|+++||++...++
T Consensus        28 ~EAv~rL~~~s~kvrF~tN~~~~S~~~l~~rLqrLgfdisE~ev   71 (258)
T TIGR01458        28 AEAVKRLKRASLKVRFVTNEKKESKRDLVERLQRLGFDISEEEV   71 (258)
T ss_pred             HHHHHHHHHCEEEEEEECCCCCHHHHHHHHHHHHCCCCCCHHHH
T ss_conf             99999884080589970168621479999998770773214421


No 116
>TIGR01169 rplA_bact ribosomal protein L1; InterPro: IPR005878   Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites , . About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.    Many of ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome , .    Ribosomal protein L1 is the largest protein from the large ribosomal subunit. In Escherichia coli, L1 is known to bind to the 23S rRNA. This model describe s bacterial and chloroplast ribosomal protein L1. Most mitochondrial L1 sequences are sufficiently divergent to be the contained in a different entry (IPR005879 from INTERPRO).; GO: 0003723 RNA binding, 0003735 structural constituent of ribosome, 0006412 translation, 0015934 large ribosomal subunit.
Probab=22.81  E-value=48  Score=13.11  Aligned_cols=26  Identities=19%  Similarity=0.371  Sum_probs=9.7

Q ss_pred             CCCCCCCCCCCCCCCCCEEEECCCCCC
Q ss_conf             421111100013321203541456654
Q gi|254780782|r  145 GTKKMLSWIEKKGEKWDACIVGEPTCN  171 (389)
Q Consensus       145 G~~~l~~~~~~~~~~~d~~i~~ep~~~  171 (389)
                      |+.-|++.+..-...+|++ +.-|..+
T Consensus        94 G~~DLie~Ik~G~~dFDV~-IATPDmM  119 (227)
T TIGR01169        94 GSDDLIEKIKKGWLDFDVV-IATPDMM  119 (227)
T ss_pred             CCHHHHHHHHCCCCCEEEE-ECCHHHH
T ss_conf             4887999995589850258-8275776


No 117
>PRK09004 flavodoxin; Provisional
Probab=22.72  E-value=48  Score=13.09  Aligned_cols=29  Identities=24%  Similarity=0.071  Sum_probs=22.1

Q ss_pred             CCCCCCHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             99789968999999999997798489997
Q gi|254780782|r   16 PSVTPQDGGAFFILVNTLKLLGFSIEEKD   44 (389)
Q Consensus        16 ps~s~~e~~~~~~l~~~l~~~G~~~~~~~   44 (389)
                      -|.|++-+.+|+-+.+.|++.|++++...
T Consensus         9 GS~tG~ae~~A~~l~~~l~~~g~~v~~~~   37 (146)
T PRK09004          9 GSTLGGAEYVADHLAEKLEEAGFSTETLH   37 (146)
T ss_pred             ECCCHHHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             88824899999999999997799349823


No 118
>TIGR02414 pepN_proteo aminopeptidase N; InterPro: IPR012779   Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site . The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases .   Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins.   Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule.     The M1 family of zinc metallopeptidases contains a number of distinct, well-separated clades of proteins with aminopeptidase activity. Several are designated aminopeptidase N, 3.4.11.2 from EC, after the Escherichia coli enzyme, suggesting a similar activity profile (see P04825 from SWISSPROT for a description of catalytic activity).   This family of zinc metallopeptidases belong to MEROPS peptidase family M1 (aminopeptidase N, clan MA); the majority are identified as alanyl aminopeptidases (proteobacteria) that are closely related to Escherichia coli PepN and presumed to have a similar (not identical) function. Nearly all are found in proteobacteria, but members are found also in cyanobacteria, plants, and apicomplexan parasites , . This family differs greatly in sequence from the family of aminopeptidases typified by Streptomyces lividans PepN (IPR012778 from INTERPRO) and from the membrane bound aminopeptidase N family in animals.; GO: 0004179 membrane alanyl aminopeptidase activity, 0008270 zinc ion binding.
Probab=20.56  E-value=38  Score=13.70  Aligned_cols=103  Identities=11%  Similarity=0.006  Sum_probs=45.0

Q ss_pred             EECCCCCCCCCCCEEEEECCCCCCH-HHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             4204666554321166513434206-779999999999876532420343112322266311257867899999999999
Q gi|254780782|r  242 DVGNPSKNVIPAQVKMSFNIRFNDL-WNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIY  320 (389)
Q Consensus       242 ~~g~~~~NvIP~~a~~~~diR~~~~-~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~l~~a~~  320 (389)
                      .+|+.++-|=|+++.--=++=+..- +....|+..++..|.+..... |.+.-+. .+.+.++ +. + .+++++.+|.+
T Consensus       354 DAGP~AHPvRP~sY~einNFYT~TVYEKGAEViRM~~TlLG~e~FRk-GmDlYF~-RhDGqAv-T~-e-DF~~Ame~as~  428 (898)
T TIGR02414       354 DAGPMAHPVRPESYIEINNFYTATVYEKGAEVIRMLHTLLGEEGFRK-GMDLYFS-RHDGQAV-TC-E-DFVAAMEDASK  428 (898)
T ss_pred             CCCCCCCCCCCHHCEEECCEEEEEEEECCHHHHHHHHHHCCCHHHHH-HHHHHHH-HCCCCEE-CH-H-HHHHHHHHHHH
T ss_conf             47788879884001154370134266060378999997307066653-7334353-3186750-27-8-89999987897


Q ss_pred             -HHHCCCCEEEECCCCCHHHHHH-HCCCEEEE
Q ss_conf             -9828995797414543588986-05989999
Q gi|254780782|r  321 -NTTGNIPLLSTSGGTSDARFIK-DYCPVIEF  350 (389)
Q Consensus       321 -~~~g~~~~~~~~gg~~d~~~~~-~~iP~v~f  350 (389)
                       +--|....+. .-=+-..+|++ .|.|.+.+
T Consensus       429 ~~~~g~Da~Pl-fdL~qF~rWYsQAGTP~l~v  459 (898)
T TIGR02414       429 MKKAGRDANPL-FDLSQFRRWYSQAGTPELEV  459 (898)
T ss_pred             HHCCCCCCCCH-HHHHHHHHHHCCCCCCEEEE
T ss_conf             53578887610-45676544220379857986


Done!