BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780782|ref|YP_003065195.1| succinyl-diaminopimelate
desuccinylase [Candidatus Liberibacter asiaticus str. psy62]
         (389 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780782|ref|YP_003065195.1| succinyl-diaminopimelate desuccinylase [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040459|gb|ACT57255.1| succinyl-diaminopimelate desuccinylase [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 389

 Score =  803 bits (2074), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/389 (100%), Positives = 389/389 (100%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF
Sbjct: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF
Sbjct: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120

Query: 121 IPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
           IPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI
Sbjct: 121 IPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT
Sbjct: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV 300
           IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV
Sbjct: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV 300

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL 360
           SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL
Sbjct: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL 360

Query: 361 NENASLQDLEDLTCIYENFLQNWFITPSQ 389
           NENASLQDLEDLTCIYENFLQNWFITPSQ
Sbjct: 361 NENASLQDLEDLTCIYENFLQNWFITPSQ 389


>gi|315121999|ref|YP_004062488.1| succinyl-diaminopimelate desuccinylase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495401|gb|ADR52000.1| succinyl-diaminopimelate desuccinylase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 365

 Score =  593 bits (1529), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 277/361 (76%), Positives = 322/361 (89%)

Query: 28  ILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDVVPPGDFNHWTYP 87
           +L +TLK LGFSI+++ FQ +NT  VKN+YARFG + PHLMFAGH+DVVPPG+ + W YP
Sbjct: 1   MLADTLKPLGFSIKQQIFQEENTPDVKNIYARFGVKKPHLMFAGHVDVVPPGNLDEWMYP 60

Query: 88  PFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTK 147
           PFSAT+AEG+IYGRG VDMKGSIACFIAAV+RFIPK+ NFGSISLLITGDEEGPAINGTK
Sbjct: 61  PFSATVAEGRIYGRGAVDMKGSIACFIAAVSRFIPKHTNFGSISLLITGDEEGPAINGTK 120

Query: 148 KMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTEN 207
           KMLSW +K GE+WDACIVGEPTC+HI+GDTIKIGRRGSLSGEI IHG QGHVAYPHL  N
Sbjct: 121 KMLSWAKKNGEQWDACIVGEPTCSHILGDTIKIGRRGSLSGEIIIHGTQGHVAYPHLANN 180

Query: 208 PIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLW 267
           PI+GLIPLLHQLT I FDTGNT F  TN+EITT+DVGNP+KN+IPA+VK+SFNIRFN+LW
Sbjct: 181 PIKGLIPLLHQLTTIEFDTGNTDFPSTNLEITTVDVGNPAKNIIPAKVKISFNIRFNNLW 240

Query: 268 NEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIP 327
           NE+TLK+EI SRL K +QN+PKLS+ +HFSSPVSPVFLT ++ LTSLLS+SI+  TG  P
Sbjct: 241 NEQTLKKEIESRLTKSLQNMPKLSYNLHFSSPVSPVFLTDNKTLTSLLSESIHRVTGGTP 300

Query: 328 LLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDLEDLTCIYENFLQNWFITP 387
            LST+GGTSDARFIKD+CPVIEFGLVG+T+HA+NEN  L+DLEDLTCIYE+FL NWFI+ 
Sbjct: 301 QLSTTGGTSDARFIKDHCPVIEFGLVGKTIHAVNENVLLKDLEDLTCIYEDFLHNWFISS 360

Query: 388 S 388
           S
Sbjct: 361 S 361


>gi|227820648|ref|YP_002824618.1| succinyl-diaminopimelate desuccinylase [Sinorhizobium fredii
           NGR234]
 gi|227339647|gb|ACP23865.1| succinyl-diaminopimelate desuccinylase [Sinorhizobium fredii
           NGR234]
          Length = 397

 Score =  453 bits (1166), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 218/388 (56%), Positives = 273/388 (70%), Gaps = 7/388 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D + +L  LI+CPSVTP +GGA   L   L  LGFS++    +   T  ++NLYAR G E
Sbjct: 5   DPISNLAALIRCPSVTPAEGGALTALEAMLAPLGFSVDRVVAKEAGTPDIENLYARLGAE 64

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVP GD   W++PPFSA IA G++YGRG VDMKG IACF+AAVAR I K
Sbjct: 65  GPHLMFAGHTDVVPVGDEAAWSHPPFSAAIARGEMYGRGAVDMKGGIACFVAAVARHIEK 124

Query: 124 Y-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
           + +  GSIS LITGDEEGPAINGT K+L W  +KGE+WDAC+VGEPT    +GD IKIGR
Sbjct: 125 HGRPKGSISFLITGDEEGPAINGTVKLLEWAAQKGERWDACLVGEPTNPESLGDMIKIGR 184

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSLSG IT+HG QGH AYPHL +NP+RG++ L   L +  FD G  TF P+N+E+TTID
Sbjct: 185 RGSLSGRITVHGVQGHAAYPHLADNPVRGILQLTQALMDSAFDAGTDTFQPSNLEVTTID 244

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQN------VPKLSHTVHF 296
           VGN + NVIPA+   +FNIRFND W  ++LK EI +RL +  ++         + + + +
Sbjct: 245 VGNAAVNVIPARASAAFNIRFNDHWTAESLKAEIVARLDRAAKDETLRPGRQPVKYDIVW 304

Query: 297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRT 356
           +   S VFLT +  L   LS ++   TG  P LST+GGTSDARFIKDYCPV+EFGLVG+T
Sbjct: 305 NERPSHVFLTRNNALIDSLSGAVEAVTGRQPKLSTTGGTSDARFIKDYCPVVEFGLVGQT 364

Query: 357 MHALNENASLQDLEDLTCIYENFLQNWF 384
           MH ++E  ++ DLE LT IYE F+  WF
Sbjct: 365 MHMVDERVAIADLETLTGIYEAFVARWF 392


>gi|222147378|ref|YP_002548335.1| succinyl-diaminopimelate desuccinylase [Agrobacterium vitis S4]
 gi|238055204|sp|B9JZL9|DAPE_AGRVS RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|221734368|gb|ACM35331.1| succinyl-diaminopimelate desuccinylase [Agrobacterium vitis S4]
          Length = 404

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 221/392 (56%), Positives = 273/392 (69%), Gaps = 15/392 (3%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +++L  LI+CPSVTP +GGA   L   L+ LGF++E    + + T  V+NLYAR GTE
Sbjct: 12  DPVDNLQTLIRCPSVTPAEGGALSALAAMLEPLGFTVERMVAREEGTPDVENLYARLGTE 71

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI-- 121
            PHLMFAGH DVVP G+   WTYPPFSA IA G++YGRG VDMKG IACF+AA+AR I  
Sbjct: 72  GPHLMFAGHTDVVPVGNEADWTYPPFSAEIAGGELYGRGAVDMKGGIACFVAAIARHIES 131

Query: 122 ---PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
              PK    GSIS LITGDEEGP+INGT K+L W   KGE+WDAC+VGEPT    +GD I
Sbjct: 132 QGAPK----GSISFLITGDEEGPSINGTTKLLEWAAAKGERWDACLVGEPTNPDQLGDMI 187

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGSLSGEI + G QGH AYPHL +NP+RG+I L   L +  FD G   F P+N+E+
Sbjct: 188 KIGRRGSLSGEIIVKGVQGHAAYPHLADNPVRGMIKLAEALMHPAFDAGTENFQPSNLEV 247

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQN------VPKLSH 292
           TTIDVGN + NVIPA+    FNIRFND W  +TL+ EI +RL     +       P +++
Sbjct: 248 TTIDVGNAATNVIPARASAKFNIRFNDTWTAETLRTEIIARLDTASADPLLRPGRPPIAY 307

Query: 293 TVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGL 352
            + ++   S VFLT +  L S LS +I   TG  P LST+GGTSDARFIKDYCPV+EFGL
Sbjct: 308 ELVWADRPSQVFLTRNNALISSLSAAIEKMTGKTPALSTTGGTSDARFIKDYCPVVEFGL 367

Query: 353 VGRTMHALNENASLQDLEDLTCIYENFLQNWF 384
           VG+TMH ++E  ++ DLE LT IY  F+ +WF
Sbjct: 368 VGQTMHMVDERVAVSDLEALTGIYGAFISSWF 399


>gi|110632750|ref|YP_672958.1| succinyl-diaminopimelate desuccinylase [Mesorhizobium sp. BNC1]
 gi|122966267|sp|Q11LD2|DAPE_MESSB RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|110283734|gb|ABG61793.1| succinyldiaminopimelate desuccinylase [Chelativorans sp. BNC1]
          Length = 395

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 219/393 (55%), Positives = 273/393 (69%), Gaps = 16/393 (4%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D  ++L  LI+C SVTP +GGA   L   L+ LG  ++   F  +  + V+NLYAR G +
Sbjct: 6   DPAQNLASLIRCRSVTPVEGGALTALEAMLRPLGARVDRPVFSEEGEADVENLYARIGKD 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI-- 121
            PHLMFAGH DVVPPGD + WT+PPF+A IA G+++GRG VDMKG IACF+AA+AR +  
Sbjct: 66  GPHLMFAGHTDVVPPGDEDAWTHPPFAAEIAGGEMFGRGAVDMKGGIACFVAALARHLEV 125

Query: 122 ---PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
              PK    GS+S LITGDEEGP++NG+ K+L W   +GE+WDA +VGEPT    +GD +
Sbjct: 126 SGTPK----GSVSFLITGDEEGPSVNGSVKLLEWAAARGERWDAALVGEPTNVETLGDMV 181

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGSLSG IT+ G+QGHVAYPHL +NP RGL+ LL  L    FD G   F PTN+EI
Sbjct: 182 KIGRRGSLSGRITLFGRQGHVAYPHLADNPSRGLVALLEALMEPAFDQGTADFPPTNLEI 241

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQ-------NVPKLS 291
           TTIDVGNPS NVIPA+   +FN+RFND W+ +TL+ EI +RL +              +S
Sbjct: 242 TTIDVGNPSVNVIPARATAAFNVRFNDTWSVETLQAEIHNRLDRAAAENRLRPGRTEPVS 301

Query: 292 HTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFG 351
             + +    SPVFLT D KL + L+ SI   TG  P LST+GGTSDARFIKDYCPVIEFG
Sbjct: 302 FELEWRDRPSPVFLTRDDKLVATLAASIEAVTGRKPQLSTTGGTSDARFIKDYCPVIEFG 361

Query: 352 LVGRTMHALNENASLQDLEDLTCIYENFLQNWF 384
           LVG+TMH ++E   L DLE LT IY+ FL+NWF
Sbjct: 362 LVGQTMHMVDEKVPLSDLETLTRIYQRFLENWF 394


>gi|327191112|gb|EGE58160.1| succinyl-diaminopimelate desuccinylase protein [Rhizobium etli
           CNPAF512]
          Length = 396

 Score =  450 bits (1158), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 217/387 (56%), Positives = 268/387 (69%), Gaps = 6/387 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D + +L  LI+CPSVTP +GGA   L   L  LGF I+        T  ++NLYAR G +
Sbjct: 5   DPVANLQTLIRCPSVTPAEGGALTALEAMLAPLGFKIDRVKASEDGTPDIENLYARLGRD 64

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVP GD   WT+PPF+A IA+G+++GRG VDMKG IACF+AAVAR I K
Sbjct: 65  GPHLMFAGHTDVVPVGDEAAWTHPPFAAEIAKGELFGRGAVDMKGGIACFVAAVARHIEK 124

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               GSISLLITGDEEGPAINGT K+L W  ++GE+WDAC+VGEPT    +GD IKIGRR
Sbjct: 125 NGPAGSISLLITGDEEGPAINGTIKLLQWATERGERWDACLVGEPTNPDRLGDMIKIGRR 184

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSLSG IT+HG QGH AYPHL +NP+RG++ L   L +  FD G   F P+N+E+TT+DV
Sbjct: 185 GSLSGRITVHGVQGHAAYPHLADNPVRGIVQLTQALMDPPFDGGTDDFQPSNLEVTTVDV 244

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQN------VPKLSHTVHFS 297
           GNP+ NVIPA+   SFNIRFND W   TL+ EI  RL     N         + + + ++
Sbjct: 245 GNPATNVIPAKASASFNIRFNDSWTVDTLRAEILRRLDAAAGNGQLRPGREPVKYDIVWA 304

Query: 298 SPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTM 357
              S VFLT +  L + LS +I +  G  P LST+GGTSDARFIKDYCPV+EFGLVG+TM
Sbjct: 305 DRPSHVFLTRNNALIASLSSAIESVAGRSPALSTTGGTSDARFIKDYCPVVEFGLVGQTM 364

Query: 358 HALNENASLQDLEDLTCIYENFLQNWF 384
           H ++E  ++ DLE LT IYE F+  WF
Sbjct: 365 HMVDERVAVADLETLTAIYETFIDRWF 391


>gi|218673647|ref|ZP_03523316.1| succinyl-diaminopimelate desuccinylase [Rhizobium etli GR56]
          Length = 400

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 216/388 (55%), Positives = 274/388 (70%), Gaps = 7/388 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D + +L  LI+CPSVTP +GGA   L   L  LGF++++   + + T+ ++NLYAR G E
Sbjct: 8   DPVANLQTLIRCPSVTPAEGGALTALDAMLAPLGFTVDKVTAREEGTADIENLYARLGGE 67

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVP GD   WT+PPF+A I++G+++GRG VDMKG IACF+AAVAR I K
Sbjct: 68  GPHLMFAGHTDVVPVGDEAAWTHPPFAAEISKGELFGRGAVDMKGGIACFVAAVARHIEK 127

Query: 124 YKN-FGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
                GSISLLITGDEEGPAINGT K+L W  ++GE+WDAC+VGEPT    +GD IKIGR
Sbjct: 128 NGAPAGSISLLITGDEEGPAINGTVKLLQWATERGERWDACLVGEPTNPDRLGDMIKIGR 187

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSLSG IT+HG QGH AYPHL +NP+RG++ L   L +  FD G   F P+N+E+TT+D
Sbjct: 188 RGSLSGRITVHGVQGHAAYPHLADNPVRGIVQLTQALMDPPFDGGTDDFQPSNLEVTTVD 247

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQN------VPKLSHTVHF 296
           VGNP+ NVIPA+   SFNIRFND W   TL+ EI  RL     N         + + + +
Sbjct: 248 VGNPATNVIPAKASASFNIRFNDSWTVDTLRAEILRRLDAAAGNGQLRPGREPVKYDIVW 307

Query: 297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRT 356
           +   S VFLT +  L + LS ++ + TG  P LST+GGTSDARFIKDYCPV+EFGLVG+T
Sbjct: 308 ADRPSHVFLTRNNALIASLSSAVESVTGRSPTLSTTGGTSDARFIKDYCPVVEFGLVGQT 367

Query: 357 MHALNENASLQDLEDLTCIYENFLQNWF 384
           MH ++E  ++ DLE LT IYE F+  WF
Sbjct: 368 MHMVDERVAVADLETLTAIYETFIDRWF 395


>gi|116250205|ref|YP_766043.1| succinyl-diaminopimelate desuccinylase [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|238064796|sp|Q1MM75|DAPE_RHIL3 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|115254853|emb|CAK05927.1| putative succinyl-diaminopimelate desuccinylase [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 397

 Score =  448 bits (1153), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 214/388 (55%), Positives = 275/388 (70%), Gaps = 7/388 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D + +L  LI+CPSVTP +GGA   L   L  LGF+++      + T  ++NLYAR GT+
Sbjct: 5   DPVANLQTLIRCPSVTPAEGGALSALEAMLAPLGFTVDRVKASEEGTPDIENLYARLGTD 64

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVP GD   WT+PPF+A I++G+++GRG VDMKG IACF+AAVAR I K
Sbjct: 65  GPHLMFAGHTDVVPVGDEAAWTHPPFAAEISKGELFGRGAVDMKGGIACFVAAVARHIEK 124

Query: 124 Y-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
             +  GSIS LITGDEEGPAINGT K+L W  ++GE+WDAC+VGEPT    +GD IKIGR
Sbjct: 125 SGQPKGSISFLITGDEEGPAINGTIKLLQWAAERGERWDACLVGEPTNPDRLGDMIKIGR 184

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSLSG+IT+HG QGH AYPHL +NP+RG++ + H L +  FD G   F P+N+E+TT+D
Sbjct: 185 RGSLSGKITVHGVQGHAAYPHLADNPVRGMLQMTHALMDPPFDGGTDDFQPSNLEVTTVD 244

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQN------VPKLSHTVHF 296
           VGNP+ NVIPA+   SFNIRFND W  +TL+ EI  RL     N         + + + +
Sbjct: 245 VGNPATNVIPAKASASFNIRFNDSWTVETLRAEILRRLDAAAGNGELRPGRDPVKYDIVW 304

Query: 297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRT 356
           +   S VFLT +  L + LS ++ + +G  P LST+GGTSDARFIKDYCPV+EFGLVG+T
Sbjct: 305 ADRPSHVFLTRNNALIASLSSAVESVSGQSPKLSTTGGTSDARFIKDYCPVVEFGLVGQT 364

Query: 357 MHALNENASLQDLEDLTCIYENFLQNWF 384
           MH ++E  ++ DLE LT IYE F+  WF
Sbjct: 365 MHMVDERVAVADLETLTAIYETFIARWF 392


>gi|86356074|ref|YP_467966.1| succinyl-diaminopimelate desuccinylase [Rhizobium etli CFN 42]
 gi|86280176|gb|ABC89239.1| succinyl-diaminopimelate desuccinylase protein [Rhizobium etli CFN
           42]
          Length = 409

 Score =  448 bits (1152), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 214/388 (55%), Positives = 272/388 (70%), Gaps = 7/388 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D + +L  LI+CPSVTP +GGA   L   L  LGF+++    + + T+ ++NLYAR G +
Sbjct: 17  DPVANLQTLIRCPSVTPAEGGALTALDAMLTPLGFTVDRVTAREEGTAAIENLYARLGRD 76

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVP GD   WT+PPF+A I+ G+++GRG VDMKG IACF+AAVAR I K
Sbjct: 77  GPHLMFAGHTDVVPVGDEAAWTHPPFAAEISNGELFGRGAVDMKGGIACFVAAVARHIEK 136

Query: 124 Y-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
                GSIS L+TGDEEGPAINGT K+L W  ++GE+WDAC+VGEPT    +GD IKIGR
Sbjct: 137 SGPPAGSISFLVTGDEEGPAINGTIKLLQWAAERGERWDACLVGEPTNPDRLGDMIKIGR 196

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSLSG+IT+HG QGH AYPHL +NP+RGL+ L   L +  FD G   F P+N+E+TT+D
Sbjct: 197 RGSLSGKITVHGVQGHAAYPHLADNPVRGLLQLTQALMDPPFDGGTDDFQPSNLEVTTVD 256

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQN------VPKLSHTVHF 296
           VGNP+ NVIPA+   SFNIRFND W  +TL+ EI  RL     N       P   + + +
Sbjct: 257 VGNPATNVIPAKASASFNIRFNDSWTVETLRAEILRRLEAAAGNGQLRPGRPPAKYDIVW 316

Query: 297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRT 356
           +   S VFLT +  L + LS +I +  G  P LST+GGTSDARFIKDYCPV+EFGLVG+T
Sbjct: 317 ADRPSHVFLTRNNALIASLSSAIESVAGRSPALSTTGGTSDARFIKDYCPVVEFGLVGQT 376

Query: 357 MHALNENASLQDLEDLTCIYENFLQNWF 384
           MH ++E  ++ DLE LT IY+ F+  WF
Sbjct: 377 MHMVDERVAVADLETLTAIYQTFIDRWF 404


>gi|190890090|ref|YP_001976632.1| succinyl-diaminopimelate desuccinylase [Rhizobium etli CIAT 652]
 gi|190695369|gb|ACE89454.1| succinyl-diaminopimelate desuccinylase protein [Rhizobium etli CIAT
           652]
          Length = 409

 Score =  448 bits (1152), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 216/388 (55%), Positives = 273/388 (70%), Gaps = 7/388 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D + +L  LI+CPSVTP +GGA   L   L  LGF++++   + + T+ ++NLYAR G +
Sbjct: 17  DPVANLQTLIRCPSVTPAEGGALTALDAMLTPLGFTVDKVTAREEGTADIENLYARLGRD 76

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVP GD   WT+PPF+A IA+G+++GRG VDMKG IACF+AAVAR I K
Sbjct: 77  GPHLMFAGHTDVVPVGDEAAWTHPPFAAEIAKGELFGRGAVDMKGGIACFVAAVARHIEK 136

Query: 124 Y-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
                GSISLLITGDEEGPAINGT K+L W  ++GE+WDAC+VGEPT    +GD IKIGR
Sbjct: 137 NGPPAGSISLLITGDEEGPAINGTVKLLQWATERGERWDACLVGEPTNPDRLGDMIKIGR 196

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSLSG IT+HG QGH AYPHL +NP+RG++ L   L +  FD G   F P+N+E+TT+D
Sbjct: 197 RGSLSGRITVHGVQGHAAYPHLADNPVRGIVQLTQALMDPPFDGGTDDFQPSNLEVTTVD 256

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQN------VPKLSHTVHF 296
           VGNP+ NVIPA+   SFNIRFND W   TL+ EI  RL     N         + + + +
Sbjct: 257 VGNPATNVIPAKASASFNIRFNDSWTVDTLRAEILRRLDAAAGNGQLRPGREPVKYDIVW 316

Query: 297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRT 356
           +   S VFLT +  L + LS +I +  G  P LST+GGTSDARFIKDYCPV+EFGLVG+T
Sbjct: 317 ADRPSHVFLTRNNALIASLSSAIESVAGRSPALSTTGGTSDARFIKDYCPVVEFGLVGQT 376

Query: 357 MHALNENASLQDLEDLTCIYENFLQNWF 384
           MH ++E  ++ DLE LT IYE F+  WF
Sbjct: 377 MHMVDERVAVADLETLTAIYETFIDRWF 404


>gi|238064831|sp|Q2KD47|DAPE_RHIEC RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 397

 Score =  447 bits (1151), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 214/388 (55%), Positives = 272/388 (70%), Gaps = 7/388 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D + +L  LI+CPSVTP +GGA   L   L  LGF+++    + + T+ ++NLYAR G +
Sbjct: 5   DPVANLQTLIRCPSVTPAEGGALTALDAMLTPLGFTVDRVTAREEGTAAIENLYARLGRD 64

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVP GD   WT+PPF+A I+ G+++GRG VDMKG IACF+AAVAR I K
Sbjct: 65  GPHLMFAGHTDVVPVGDEAAWTHPPFAAEISNGELFGRGAVDMKGGIACFVAAVARHIEK 124

Query: 124 Y-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
                GSIS L+TGDEEGPAINGT K+L W  ++GE+WDAC+VGEPT    +GD IKIGR
Sbjct: 125 SGPPAGSISFLVTGDEEGPAINGTIKLLQWAAERGERWDACLVGEPTNPDRLGDMIKIGR 184

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSLSG+IT+HG QGH AYPHL +NP+RGL+ L   L +  FD G   F P+N+E+TT+D
Sbjct: 185 RGSLSGKITVHGVQGHAAYPHLADNPVRGLLQLTQALMDPPFDGGTDDFQPSNLEVTTVD 244

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQN------VPKLSHTVHF 296
           VGNP+ NVIPA+   SFNIRFND W  +TL+ EI  RL     N       P   + + +
Sbjct: 245 VGNPATNVIPAKASASFNIRFNDSWTVETLRAEILRRLEAAAGNGQLRPGRPPAKYDIVW 304

Query: 297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRT 356
           +   S VFLT +  L + LS +I +  G  P LST+GGTSDARFIKDYCPV+EFGLVG+T
Sbjct: 305 ADRPSHVFLTRNNALIASLSSAIESVAGRSPALSTTGGTSDARFIKDYCPVVEFGLVGQT 364

Query: 357 MHALNENASLQDLEDLTCIYENFLQNWF 384
           MH ++E  ++ DLE LT IY+ F+  WF
Sbjct: 365 MHMVDERVAVADLETLTAIYQTFIDRWF 392


>gi|15887721|ref|NP_353402.1| succinyl-diaminopimelate desuccinylase [Agrobacterium tumefaciens
           str. C58]
 gi|238055203|sp|A9CKC4|DAPE_AGRT5 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|15155282|gb|AAK86187.1| succinyl-diaminopimelate desuccinylase [Agrobacterium tumefaciens
           str. C58]
          Length = 398

 Score =  447 bits (1150), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 219/390 (56%), Positives = 270/390 (69%), Gaps = 7/390 (1%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           T D + +L  LI+CPSVTP +GGA  +L   L  LGF++E        T  V+NLYAR G
Sbjct: 3   TTDPVANLAALIRCPSVTPAEGGALSLLDTLLSPLGFAVERVMATEDGTPDVENLYARLG 62

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
           TE PHLMFAGH DVVP GD   W++PPFSA IA G++YGRG VDMKG IACF+AA+AR I
Sbjct: 63  TEGPHLMFAGHTDVVPVGDEAAWSHPPFSADIAGGEMYGRGAVDMKGGIACFVAAIARHI 122

Query: 122 PKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
            K+ K  GS+S LITGDEEGP+INGT K+L W   KGE WDAC+VGEPT    +GD IKI
Sbjct: 123 GKHGKPQGSVSFLITGDEEGPSINGTSKLLEWAAAKGETWDACVVGEPTNPDQLGDMIKI 182

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGSLSG IT+ G QGH AYPHL +NPIRGL+ L H L +  FD G   F P+N+E+TT
Sbjct: 183 GRRGSLSGRITVQGVQGHAAYPHLADNPIRGLLQLTHALMHPAFDHGTDDFQPSNLEVTT 242

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQ------NVPKLSHTV 294
           +D GN + NVIPA+   +FNIRFND W  ++L+ EI  RL           +   + + +
Sbjct: 243 VDTGNAATNVIPARATAAFNIRFNDSWTAESLRAEIIRRLDAAANEGELRPDRAPVKYEI 302

Query: 295 HFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVG 354
            ++   S VFLT +  L S LS +I   TG  P LST+GGTSDARFIKDYCPV+EFGLVG
Sbjct: 303 VWADRPSHVFLTRNNALISSLSGAIETVTGKEPKLSTTGGTSDARFIKDYCPVVEFGLVG 362

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNWF 384
           +TMH ++E  ++ DLE LT IYE F++ WF
Sbjct: 363 QTMHMVDERVAVADLETLTRIYETFIERWF 392


>gi|225686785|ref|YP_002734757.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis ATCC
           23457]
 gi|254690655|ref|ZP_05153909.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 6 str.
           870]
 gi|256043898|ref|ZP_05446818.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256111037|ref|ZP_05452099.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis bv. 3
           str. Ether]
 gi|256255837|ref|ZP_05461373.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 9 str.
           C68]
 gi|256262081|ref|ZP_05464613.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis bv. 2
           str. 63/9]
 gi|260756226|ref|ZP_05868574.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 6 str.
           870]
 gi|260882050|ref|ZP_05893664.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 9 str.
           C68]
 gi|265990321|ref|ZP_06102878.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis bv. 1
           str. Rev.1]
 gi|265992572|ref|ZP_06105129.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis bv. 3
           str. Ether]
 gi|297249206|ref|ZP_06932907.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 5 str.
           B3196]
 gi|254767082|sp|C0RMH0|DAPE_BRUMB RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|225642890|gb|ACO02803.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis ATCC
           23457]
 gi|260676334|gb|EEX63155.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 6 str.
           870]
 gi|260871578|gb|EEX78647.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 9 str.
           C68]
 gi|262763442|gb|EEZ09474.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis bv. 3
           str. Ether]
 gi|263000990|gb|EEZ13680.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis bv. 1
           str. Rev.1]
 gi|263091770|gb|EEZ16101.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis bv. 2
           str. 63/9]
 gi|297173075|gb|EFH32439.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 5 str.
           B3196]
 gi|326411193|gb|ADZ68257.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis M28]
 gi|326554484|gb|ADZ89123.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis M5-90]
          Length = 395

 Score =  447 bits (1149), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 218/387 (56%), Positives = 269/387 (69%), Gaps = 8/387 (2%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           +++L  LI+CPSVTP +GGA   L   LKL+GFS     F   NT  ++NLYAR     P
Sbjct: 8   VDNLAALIRCPSVTPAEGGALTALEKMLKLMGFSANRPVFSDDNTPDIENLYARKSGNGP 67

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
           HLMFAGH DVVPPGD   W +PPF+A I +G +YGRG VDMKG IACF+AAVAR I K+ 
Sbjct: 68  HLMFAGHTDVVPPGDEKDWKHPPFAAAIEDGVMYGRGAVDMKGGIACFVAAVARHIEKHG 127

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           N  GSIS LITGDEEGPA+NGT K+L W +++GE WDA IVGEPT  + +GD IKIGRRG
Sbjct: 128 NIKGSISFLITGDEEGPAVNGTVKLLEWAKQRGESWDASIVGEPTNPNALGDMIKIGRRG 187

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG IT+HG QGH AYPHL ENP+RG++ L+  L    FD G   F  +N+E+TTIDVG
Sbjct: 188 SLSGTITVHGVQGHAAYPHLAENPVRGIVTLVDSLLYPAFDEGTANFQASNLEVTTIDVG 247

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQN-------VPKLSHTVHFS 297
           N + NVIP +   SFNIRFND W  ++L+ EI SRL +  ++          + + + + 
Sbjct: 248 NKATNVIPNKATASFNIRFNDTWTAESLQAEIISRLERAARDNRLRQGRETPIKYELTWR 307

Query: 298 SPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTM 357
              S VFLTHD KL   L+ S+   TG  P LSTSGGTSDARFIKDYCPV+EFGL G+TM
Sbjct: 308 ERPSHVFLTHDEKLIGTLTASVEAVTGKRPELSTSGGTSDARFIKDYCPVVEFGLTGQTM 367

Query: 358 HALNENASLQDLEDLTCIYENFLQNWF 384
           H ++E  +L DLE LT IYE F+ ++F
Sbjct: 368 HMVDERVALADLEGLTQIYERFIADFF 394


>gi|17988612|ref|NP_541245.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis bv. 1
           str. 16M]
 gi|260565075|ref|ZP_05835560.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis bv. 1
           str. 16M]
 gi|81850740|sp|Q8YDB0|DAPE_BRUME RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|17984414|gb|AAL53509.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis bv. 1
           str. 16M]
 gi|260152718|gb|EEW87811.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis bv. 1
           str. 16M]
          Length = 395

 Score =  447 bits (1149), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 218/387 (56%), Positives = 269/387 (69%), Gaps = 8/387 (2%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           +++L  LI+CPSVTP +GGA   L   LKL+GFS     F   NT  ++NLYAR     P
Sbjct: 8   VDNLAALIRCPSVTPAEGGALTALEKMLKLMGFSANRPVFSDDNTPDIENLYARKSGNGP 67

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
           HLMFAGH DVVPPGD   W +PPF+A I +G +YGRG VDMKG IACF+AAVAR I K+ 
Sbjct: 68  HLMFAGHTDVVPPGDEKDWKHPPFAAAIEDGVMYGRGAVDMKGGIACFVAAVARHIEKHG 127

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           N  GSIS LITGDEEGPA+NGT K+L W +++GE WDA IVGEPT  + +GD IKIGRRG
Sbjct: 128 NIKGSISFLITGDEEGPAVNGTVKLLEWAKQRGESWDASIVGEPTNPNALGDMIKIGRRG 187

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG IT+HG QGH AYPHL ENP+RG++ L+  L    FD G   F  +N+E+TTIDVG
Sbjct: 188 SLSGTITVHGVQGHAAYPHLAENPVRGIVTLVDSLLCPAFDEGTANFQASNLEVTTIDVG 247

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQN-------VPKLSHTVHFS 297
           N + NVIP +   SFNIRFND W  ++L+ EI SRL +  ++          + + + + 
Sbjct: 248 NKATNVIPNKATASFNIRFNDTWTAESLQAEIISRLERAARDNRLRQGRETPIKYELTWR 307

Query: 298 SPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTM 357
              S VFLTHD KL   L+ S+   TG  P LSTSGGTSDARFIKDYCPV+EFGL G+TM
Sbjct: 308 ERPSHVFLTHDEKLIGTLTASVEAVTGKRPELSTSGGTSDARFIKDYCPVVEFGLTGQTM 367

Query: 358 HALNENASLQDLEDLTCIYENFLQNWF 384
           H ++E  +L DLE LT IYE F+ ++F
Sbjct: 368 HMVDERVALADLEGLTQIYERFIADFF 394


>gi|23500754|ref|NP_700194.1| succinyl-diaminopimelate desuccinylase [Brucella suis 1330]
 gi|148558511|ref|YP_001257942.1| succinyl-diaminopimelate desuccinylase [Brucella ovis ATCC 25840]
 gi|161621078|ref|YP_001594964.1| succinyl-diaminopimelate desuccinylase [Brucella canis ATCC 23365]
 gi|163845144|ref|YP_001622799.1| succinyl-diaminopimelate desuccinylase [Brucella suis ATCC 23445]
 gi|225629480|ref|ZP_03787513.1| succinyl-diaminopimelate desuccinylase [Brucella ceti str. Cudo]
 gi|254700225|ref|ZP_05162053.1| succinyl-diaminopimelate desuccinylase [Brucella suis bv. 5 str.
           513]
 gi|254703346|ref|ZP_05165174.1| succinyl-diaminopimelate desuccinylase [Brucella suis bv. 3 str.
           686]
 gi|254705513|ref|ZP_05167341.1| succinyl-diaminopimelate desuccinylase [Brucella pinnipedialis
           M163/99/10]
 gi|254710744|ref|ZP_05172555.1| succinyl-diaminopimelate desuccinylase [Brucella pinnipedialis
           B2/94]
 gi|254712786|ref|ZP_05174597.1| succinyl-diaminopimelate desuccinylase [Brucella ceti M644/93/1]
 gi|254715855|ref|ZP_05177666.1| succinyl-diaminopimelate desuccinylase [Brucella ceti M13/05/1]
 gi|256015790|ref|YP_003105799.1| succinyl-diaminopimelate desuccinylase [Brucella microti CCM 4915]
 gi|256029127|ref|ZP_05442741.1| succinyl-diaminopimelate desuccinylase [Brucella pinnipedialis
           M292/94/1]
 gi|256058810|ref|ZP_05449026.1| succinyl-diaminopimelate desuccinylase [Brucella neotomae 5K33]
 gi|256157319|ref|ZP_05455237.1| succinyl-diaminopimelate desuccinylase [Brucella ceti M490/95/1]
 gi|256253703|ref|ZP_05459239.1| succinyl-diaminopimelate desuccinylase [Brucella ceti B1/94]
 gi|260167781|ref|ZP_05754592.1| succinyl-diaminopimelate desuccinylase [Brucella sp. F5/99]
 gi|260567724|ref|ZP_05838193.1| succinyl-diaminopimelate desuccinylase [Brucella suis bv. 4 str.
           40]
 gi|261217616|ref|ZP_05931897.1| succinyl-diaminopimelate desuccinylase [Brucella ceti M13/05/1]
 gi|261220840|ref|ZP_05935121.1| succinyl-diaminopimelate desuccinylase [Brucella ceti B1/94]
 gi|261312917|ref|ZP_05952114.1| succinyl-diaminopimelate desuccinylase [Brucella pinnipedialis
           M163/99/10]
 gi|261318312|ref|ZP_05957509.1| succinyl-diaminopimelate desuccinylase [Brucella pinnipedialis
           B2/94]
 gi|261320493|ref|ZP_05959690.1| succinyl-diaminopimelate desuccinylase [Brucella ceti M644/93/1]
 gi|261322747|ref|ZP_05961944.1| succinyl-diaminopimelate desuccinylase [Brucella neotomae 5K33]
 gi|261750720|ref|ZP_05994429.1| succinyl-diaminopimelate desuccinylase [Brucella suis bv. 5 str.
           513]
 gi|261753976|ref|ZP_05997685.1| succinyl-diaminopimelate desuccinylase [Brucella suis bv. 3 str.
           686]
 gi|261757218|ref|ZP_06000927.1| succinyl-diaminopimelate desuccinylase [Brucella sp. F5/99]
 gi|265986110|ref|ZP_06098667.1| succinyl-diaminopimelate desuccinylase [Brucella pinnipedialis
           M292/94/1]
 gi|265995804|ref|ZP_06108361.1| succinyl-diaminopimelate desuccinylase [Brucella ceti M490/95/1]
 gi|294853984|ref|ZP_06794656.1| succinyl-diaminopimelate desuccinylase [Brucella sp. NVSL 07-0026]
 gi|81750979|sp|Q8FV22|DAPE_BRUSU RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238055177|sp|A9MCV6|DAPE_BRUC2 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238055178|sp|A5VVT7|DAPE_BRUO2 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238055179|sp|A9WW41|DAPE_BRUSI RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|23464409|gb|AAN34199.1| succinyl-diaminopimelate desuccinylase [Brucella suis 1330]
 gi|148369796|gb|ABQ62668.1| succinyl-diaminopimelate desuccinylase [Brucella ovis ATCC 25840]
 gi|161337889|gb|ABX64193.1| succinyl-diaminopimelate desuccinylase [Brucella canis ATCC 23365]
 gi|163675867|gb|ABY39977.1| succinyl-diaminopimelate desuccinylase [Brucella suis ATCC 23445]
 gi|225615976|gb|EEH13025.1| succinyl-diaminopimelate desuccinylase [Brucella ceti str. Cudo]
 gi|255998450|gb|ACU50137.1| succinyl-diaminopimelate desuccinylase [Brucella microti CCM 4915]
 gi|260154389|gb|EEW89470.1| succinyl-diaminopimelate desuccinylase [Brucella suis bv. 4 str.
           40]
 gi|260919424|gb|EEX86077.1| succinyl-diaminopimelate desuccinylase [Brucella ceti B1/94]
 gi|260922705|gb|EEX89273.1| succinyl-diaminopimelate desuccinylase [Brucella ceti M13/05/1]
 gi|261293183|gb|EEX96679.1| succinyl-diaminopimelate desuccinylase [Brucella ceti M644/93/1]
 gi|261297535|gb|EEY01032.1| succinyl-diaminopimelate desuccinylase [Brucella pinnipedialis
           B2/94]
 gi|261298727|gb|EEY02224.1| succinyl-diaminopimelate desuccinylase [Brucella neotomae 5K33]
 gi|261301943|gb|EEY05440.1| succinyl-diaminopimelate desuccinylase [Brucella pinnipedialis
           M163/99/10]
 gi|261737202|gb|EEY25198.1| succinyl-diaminopimelate desuccinylase [Brucella sp. F5/99]
 gi|261740473|gb|EEY28399.1| succinyl-diaminopimelate desuccinylase [Brucella suis bv. 5 str.
           513]
 gi|261743729|gb|EEY31655.1| succinyl-diaminopimelate desuccinylase [Brucella suis bv. 3 str.
           686]
 gi|262550101|gb|EEZ06262.1| succinyl-diaminopimelate desuccinylase [Brucella ceti M490/95/1]
 gi|264658307|gb|EEZ28568.1| succinyl-diaminopimelate desuccinylase [Brucella pinnipedialis
           M292/94/1]
 gi|294819639|gb|EFG36639.1| succinyl-diaminopimelate desuccinylase [Brucella sp. NVSL 07-0026]
          Length = 395

 Score =  447 bits (1149), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 218/386 (56%), Positives = 268/386 (69%), Gaps = 8/386 (2%)

Query: 7   EHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPH 66
           ++L  LI+CPSVTP +GGA   L   LKL+GFS     F   NT  ++NLYAR     PH
Sbjct: 9   DNLAALIRCPSVTPAEGGALTALEKMLKLMGFSANRPVFSDDNTPDIENLYARKSGNGPH 68

Query: 67  LMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKN 126
           LMFAGH DVVPPGD   W +PPF+A I +G +YGRG VDMKG IACF+AAVAR I K+ N
Sbjct: 69  LMFAGHTDVVPPGDEKDWKHPPFAAAIEDGVMYGRGAVDMKGGIACFVAAVARHIEKHGN 128

Query: 127 F-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGS 185
             GSIS LITGDEEGPA+NGT K+L W +++GE WDA IVGEPT  + +GD IKIGRRGS
Sbjct: 129 IKGSISFLITGDEEGPAVNGTVKLLEWAKQRGESWDASIVGEPTNPNALGDMIKIGRRGS 188

Query: 186 LSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGN 245
           LSG IT+HG QGH AYPHL ENP+RG++ L+  L    FD G   F  +N+E+TTIDVGN
Sbjct: 189 LSGTITVHGVQGHAAYPHLAENPVRGIVTLVDSLLYPAFDEGTANFQASNLEVTTIDVGN 248

Query: 246 PSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQN-------VPKLSHTVHFSS 298
            + NVIP +   SFNIRFND W  ++L+ EI SRL +  ++          + + + +  
Sbjct: 249 KATNVIPNKATASFNIRFNDTWTAESLQAEIISRLERAARDNRLRQGRETPIKYELTWRE 308

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
             S VFLTHD KL   L+ S+   TG  P LSTSGGTSDARFIKDYCPV+EFGL G+TMH
Sbjct: 309 RPSHVFLTHDEKLIGTLTASVEAVTGKRPELSTSGGTSDARFIKDYCPVVEFGLTGQTMH 368

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E  +L DLE LT IYE F+ ++F
Sbjct: 369 MVDERVALADLEGLTQIYERFIADFF 394


>gi|62317859|ref|YP_223712.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 1 str.
           9-941]
 gi|83269837|ref|YP_419128.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis biovar
           Abortus 2308]
 gi|189023109|ref|YP_001932850.1| succinyl-diaminopimelate desuccinylase [Brucella abortus S19]
 gi|237817400|ref|ZP_04596392.1| succinyl-diaminopimelate desuccinylase [Brucella abortus str. 2308
           A]
 gi|254699149|ref|ZP_05160977.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254732593|ref|ZP_05191171.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 4 str.
           292]
 gi|260545094|ref|ZP_05820915.1| succinyl-diaminopimelate desuccinylase [Brucella abortus NCTC 8038]
 gi|260760405|ref|ZP_05872753.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 4 str.
           292]
 gi|260763645|ref|ZP_05875977.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|75495359|sp|Q576T3|DAPE_BRUAB RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|123545679|sp|Q2YJQ6|DAPE_BRUA2 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238055176|sp|B2SC17|DAPE_BRUA1 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|62198052|gb|AAX76351.1| DapE, succinyl-diaminopimelate desuccinylase [Brucella abortus bv.
           1 str. 9-941]
 gi|82940111|emb|CAJ13159.1| ArgE/dapE/ACY1/CPG2/yscS:Peptidase M20/M25/M40:Proteobacterial
           succinyl-diaminopimelate desuccinylase [Brucella
           melitensis biovar Abortus 2308]
 gi|189021683|gb|ACD74404.1| succinyl-diaminopimelate desuccinylase [Brucella abortus S19]
 gi|237788213|gb|EEP62429.1| succinyl-diaminopimelate desuccinylase [Brucella abortus str. 2308
           A]
 gi|260098365|gb|EEW82239.1| succinyl-diaminopimelate desuccinylase [Brucella abortus NCTC 8038]
 gi|260670723|gb|EEX57663.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 4 str.
           292]
 gi|260674066|gb|EEX60887.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 2 str.
           86/8/59]
          Length = 395

 Score =  447 bits (1149), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 218/387 (56%), Positives = 269/387 (69%), Gaps = 8/387 (2%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           +++L  LI+CPSVTP +GGA   L   LKL+GFS     F   NT  ++NLYAR     P
Sbjct: 8   VDNLAALIRCPSVTPAEGGALTALEKMLKLMGFSANRPVFSDDNTPDIENLYARKSGNGP 67

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
           HLMFAGH DVVPPGD   W +PPF+A I +G +YGRG VDMKG IACF+AAVAR I K+ 
Sbjct: 68  HLMFAGHTDVVPPGDEKDWKHPPFAAEIEDGVMYGRGAVDMKGGIACFVAAVARHIEKHG 127

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           N  GSIS LITGDEEGPA+NGT K+L W +++GE WDA IVGEPT  + +GD IKIGRRG
Sbjct: 128 NIKGSISFLITGDEEGPAVNGTVKLLEWAKQRGESWDASIVGEPTNPNALGDMIKIGRRG 187

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG IT+HG QGH AYPHL ENP+RG++ L+  L    FD G   F  +N+E+TTIDVG
Sbjct: 188 SLSGTITVHGVQGHAAYPHLAENPVRGIVTLVDSLLYPAFDEGTANFQASNLEVTTIDVG 247

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQN-------VPKLSHTVHFS 297
           N + NVIP +   SFNIRFND W  ++L+ EI SRL +  ++          + + + + 
Sbjct: 248 NKATNVIPNKATASFNIRFNDTWTAESLQAEIISRLERAARDNRLRQGRETPIKYELTWR 307

Query: 298 SPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTM 357
              S VFLTHD KL   L+ S+   TG  P LSTSGGTSDARFIKDYCPV+EFGL G+TM
Sbjct: 308 ERPSHVFLTHDEKLIGTLTASVEAVTGKRPELSTSGGTSDARFIKDYCPVVEFGLTGQTM 367

Query: 358 HALNENASLQDLEDLTCIYENFLQNWF 384
           H ++E  +L DLE LT IYE F+ ++F
Sbjct: 368 HMVDERVALADLEGLTQIYERFIADFF 394


>gi|254720142|ref|ZP_05181953.1| succinyl-diaminopimelate desuccinylase [Brucella sp. 83/13]
 gi|265985148|ref|ZP_06097883.1| succinyl-diaminopimelate desuccinylase [Brucella sp. 83/13]
 gi|306839552|ref|ZP_07472359.1| succinyl-diaminopimelate desuccinylase [Brucella sp. NF 2653]
 gi|264663740|gb|EEZ34001.1| succinyl-diaminopimelate desuccinylase [Brucella sp. 83/13]
 gi|306405384|gb|EFM61656.1| succinyl-diaminopimelate desuccinylase [Brucella sp. NF 2653]
          Length = 395

 Score =  445 bits (1145), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 217/386 (56%), Positives = 268/386 (69%), Gaps = 8/386 (2%)

Query: 7   EHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPH 66
           ++L  LI+CPSVTP +GGA   L   LK +GFS +   F   NT  ++NLYAR     PH
Sbjct: 9   DNLAALIRCPSVTPAEGGALTALEKMLKPMGFSADRPVFSDDNTPDIENLYARKSGNGPH 68

Query: 67  LMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKN 126
           LMFAGH DVVPPGD   W +PPF+A I +G +YGRG VDMKG IACF+AAVAR I K+ N
Sbjct: 69  LMFAGHTDVVPPGDEKDWKHPPFAAAIEDGVMYGRGAVDMKGGIACFVAAVARHIEKHGN 128

Query: 127 F-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGS 185
             GSIS LITGDEEGPA+NGT K+L W +++GE WDA IVGEPT  + +GD IKIGRRGS
Sbjct: 129 IKGSISFLITGDEEGPAVNGTVKLLEWAKQRGESWDASIVGEPTNPNALGDMIKIGRRGS 188

Query: 186 LSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGN 245
           LSG IT+HG QGH AYPHL ENP+RG++ L+  L    FD G   F  +N+E+TTIDVGN
Sbjct: 189 LSGTITVHGVQGHAAYPHLAENPVRGIVTLVDSLLYPAFDEGTANFQASNLEVTTIDVGN 248

Query: 246 PSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQN-------VPKLSHTVHFSS 298
            + NVIP +   SFNIRFND W  ++L+ EI SRL +  ++          + + + +  
Sbjct: 249 KATNVIPNKATASFNIRFNDTWTAESLQAEIISRLERAARDNRLRQGRETPIKYELTWRE 308

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
             S VFLTHD KL   L+ S+   TG  P LSTSGGTSDARFIKDYCPV+EFGL G+TMH
Sbjct: 309 QPSHVFLTHDEKLIGTLTASVEAVTGKRPELSTSGGTSDARFIKDYCPVVEFGLTGQTMH 368

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E  +L DLE LT IYE F+ ++F
Sbjct: 369 MVDERVALADLEGLTQIYERFIADFF 394


>gi|306846232|ref|ZP_07478794.1| succinyl-diaminopimelate desuccinylase [Brucella sp. BO1]
 gi|306273483|gb|EFM55344.1| succinyl-diaminopimelate desuccinylase [Brucella sp. BO1]
          Length = 395

 Score =  445 bits (1144), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 217/386 (56%), Positives = 268/386 (69%), Gaps = 8/386 (2%)

Query: 7   EHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPH 66
           ++L  LI+CPSVTP +GGA   L   LK +GFS +   F   NT  ++NLYAR     PH
Sbjct: 9   DNLAALIRCPSVTPAEGGALTALEKMLKPMGFSADRPVFSDDNTPDIENLYARKSGNGPH 68

Query: 67  LMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKN 126
           LMFAGH DVVPPGD   W +PPF+A I +G +YGRG VDMKG IACF+AAVAR I K+ N
Sbjct: 69  LMFAGHTDVVPPGDEKDWKHPPFAAAIEDGVMYGRGAVDMKGGIACFVAAVARHIEKHGN 128

Query: 127 F-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGS 185
             GSIS LITGDEEGPA+NGT K+L W +++GE WDA IVGEPT  + +GD IKIGRRGS
Sbjct: 129 IKGSISFLITGDEEGPAVNGTVKLLEWAKQRGESWDASIVGEPTNPNALGDMIKIGRRGS 188

Query: 186 LSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGN 245
           LSG IT+HG QGH AYPHL ENP+RG++ L+  L    FD G   F  +N+E+TTIDVGN
Sbjct: 189 LSGTITVHGVQGHAAYPHLAENPVRGIVTLVDSLLYPAFDEGTANFQASNLEVTTIDVGN 248

Query: 246 PSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQN-------VPKLSHTVHFSS 298
            + NVIP +   SFNIRFND W  ++L+ EI SRL +  ++          + + + +  
Sbjct: 249 KATNVIPNKATASFNIRFNDTWTAESLQAEIISRLERAARDNRLRQGRETPIKYELTWRE 308

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
             S VFLTHD KL   L+ S+   TG  P LSTSGGTSDARFIKDYCPV+EFGL G+TMH
Sbjct: 309 RPSHVFLTHDEKLIGTLTASVEAVTGKRPELSTSGGTSDARFIKDYCPVVEFGLTGQTMH 368

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E  +L DLE LT IYE F+ ++F
Sbjct: 369 MVDERVALADLEGLTQIYERFIADFF 394


>gi|306840406|ref|ZP_07473170.1| succinyl-diaminopimelate desuccinylase [Brucella sp. BO2]
 gi|306289619|gb|EFM60826.1| succinyl-diaminopimelate desuccinylase [Brucella sp. BO2]
          Length = 395

 Score =  444 bits (1143), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 217/386 (56%), Positives = 267/386 (69%), Gaps = 8/386 (2%)

Query: 7   EHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPH 66
           ++L  LI+CPSVTP +GGA   L   LK +GFS +   F   NT  ++NLYAR     PH
Sbjct: 9   DNLAALIRCPSVTPAEGGALTALEKMLKPMGFSADRPVFSDDNTPDIENLYARKSGNGPH 68

Query: 67  LMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKN 126
           LMFAGH DVVPPGD   W +PPF+A I  G +YGRG VDMKG IACF+AAVAR I K+ N
Sbjct: 69  LMFAGHTDVVPPGDEKDWKHPPFAAAIENGVMYGRGAVDMKGGIACFVAAVARHIEKHGN 128

Query: 127 F-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGS 185
             GSIS LITGDEEGPA+NGT K+L W +++GE WDA IVGEPT  + +GD IKIGRRGS
Sbjct: 129 IKGSISFLITGDEEGPAVNGTVKLLEWAKRRGESWDASIVGEPTNPNALGDMIKIGRRGS 188

Query: 186 LSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGN 245
           LSG IT+HG QGH AYPHL ENP+RG++ L+  L    FD G   F  +N+E+TTIDVGN
Sbjct: 189 LSGTITVHGVQGHAAYPHLAENPVRGIVTLVDSLLYPAFDEGTANFQASNLEVTTIDVGN 248

Query: 246 PSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQN-------VPKLSHTVHFSS 298
            + NVIP +   SFNIRFND W  ++L+ EI SRL +  ++          + + + +  
Sbjct: 249 KATNVIPNKATASFNIRFNDTWTAESLQAEIISRLERAARDNRLRQGRETPIKYELTWRE 308

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
             S VFLTHD KL   L+ S+   TG  P LSTSGGTSDARFIKDYCPV+EFGL G+TMH
Sbjct: 309 RPSHVFLTHDEKLIGTLTASVEAVTGKRPELSTSGGTSDARFIKDYCPVVEFGLTGQTMH 368

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E  +L DLE LT IYE F+ ++F
Sbjct: 369 MVDERVALADLEGLTQIYERFIADFF 394


>gi|254696040|ref|ZP_05157868.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 3 str.
           Tulya]
 gi|261216472|ref|ZP_05930753.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 3 str.
           Tulya]
 gi|260918079|gb|EEX84940.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 3 str.
           Tulya]
          Length = 395

 Score =  444 bits (1141), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 217/387 (56%), Positives = 268/387 (69%), Gaps = 8/387 (2%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           +++L  LI+CPSVTP +GGA   L   LKL+GFS     F   NT  ++NLYAR     P
Sbjct: 8   VDNLAALIRCPSVTPAEGGALTALEKMLKLMGFSANRPVFSDGNTPDIENLYARKSGNGP 67

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
           HLMFAGH DVVPPGD   W +PPF+A I +G +YGRG VDMKG IACF+AAVAR I K+ 
Sbjct: 68  HLMFAGHTDVVPPGDEKDWKHPPFAAAIEDGVMYGRGAVDMKGGIACFVAAVARHIEKHG 127

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           N  GSIS LITGDEEGPA+NGT K+L W +++GE WDA IVGEPT  + +GD IKIGRRG
Sbjct: 128 NIKGSISFLITGDEEGPAVNGTVKLLEWAKQRGESWDASIVGEPTNPNALGDMIKIGRRG 187

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG IT+HG QGH AYPHL ENP+ G++ L+  L    FD G   F  +N+E+TTIDVG
Sbjct: 188 SLSGTITVHGVQGHAAYPHLAENPVHGIVTLVDSLLYPAFDEGTANFQASNLEVTTIDVG 247

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQN-------VPKLSHTVHFS 297
           N + NVIP +   SFNIRFND W  ++L+ EI SRL +  ++          + + + + 
Sbjct: 248 NKATNVIPNKATASFNIRFNDTWTAESLQAEIISRLERAARDNRLRQGRETPIKYELTWR 307

Query: 298 SPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTM 357
              S VFLTHD KL   L+ S+   TG  P LSTSGGTSDARFIKDYCPV+EFGL G+TM
Sbjct: 308 ERPSHVFLTHDEKLIGTLTASVEAVTGKRPELSTSGGTSDARFIKDYCPVVEFGLTGQTM 367

Query: 358 HALNENASLQDLEDLTCIYENFLQNWF 384
           H ++E  +L DLE LT IYE F+ ++F
Sbjct: 368 HMVDERVALADLEGLTQIYERFIADFF 394


>gi|241202832|ref|YP_002973928.1| succinyl-diaminopimelate desuccinylase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240856722|gb|ACS54389.1| succinyl-diaminopimelate desuccinylase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 397

 Score =  443 bits (1140), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 213/388 (54%), Positives = 271/388 (69%), Gaps = 7/388 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D + +L  LI+CPSVTP +GGA   L   L  LGF+++      + T  ++NLYAR G +
Sbjct: 5   DPVANLQTLIRCPSVTPAEGGALTALEAMLAPLGFALDRVKASEEGTPEIENLYARLGKD 64

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVP GD   WT+PPF A I++G+++GRG VDMKG IACF+AAVAR I K
Sbjct: 65  GPHLMFAGHTDVVPVGDEAAWTHPPFEAQISKGELFGRGAVDMKGGIACFVAAVARHIEK 124

Query: 124 Y-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
                GSIS LITGDEEGPAINGT K+L W  ++GE+WDAC+VGEPT    +GD IKIGR
Sbjct: 125 NGPPNGSISFLITGDEEGPAINGTIKLLQWAAERGERWDACLVGEPTNPDRLGDMIKIGR 184

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSLSG+IT+HG QGH AYPHL +NP+RG++ L   L +  FD G   F P+N+E+TT+D
Sbjct: 185 RGSLSGKITVHGVQGHAAYPHLADNPVRGMLQLTQALMDPPFDAGTGDFQPSNLEVTTVD 244

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQN------VPKLSHTVHF 296
           VGNP+ NVIPA+   SFNIRFND W  +TL+ EI  RL     N         +++ + +
Sbjct: 245 VGNPATNVIPAKASASFNIRFNDSWTVETLRAEILRRLEAAAGNGALRPGRDPVAYDIVW 304

Query: 297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRT 356
           +   S VFLT +  L + LS ++ +  G  P LST+GGTSDARFIKDYCPV+EFGLVG+T
Sbjct: 305 ADRPSHVFLTRNNALIASLSSAVESVAGQSPRLSTTGGTSDARFIKDYCPVVEFGLVGQT 364

Query: 357 MHALNENASLQDLEDLTCIYENFLQNWF 384
           MH ++E  ++ DLE LT IYE F+  WF
Sbjct: 365 MHMVDERVAVADLETLTAIYETFIARWF 392


>gi|209547673|ref|YP_002279590.1| succinyl-diaminopimelate desuccinylase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|238064797|sp|B5ZN23|DAPE_RHILW RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|209533429|gb|ACI53364.1| succinyl-diaminopimelate desuccinylase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 397

 Score =  442 bits (1137), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 213/388 (54%), Positives = 272/388 (70%), Gaps = 7/388 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D + +L  LI+CPSVTP +GGA   L   L  LGF++++       T+ ++NLYAR G +
Sbjct: 5   DPVANLQTLIRCPSVTPAEGGALSALDAMLAPLGFTVDKVKASEAGTADIENLYARLGKD 64

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVP GD   WT+PPF+A I++G+++GRG VDMKG IACFIAAVAR I K
Sbjct: 65  GPHLMFAGHTDVVPVGDEADWTHPPFAAEISKGELFGRGAVDMKGGIACFIAAVARHIEK 124

Query: 124 Y-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
                GSIS LITGDEEGPAINGT K+L W  ++GE+WDAC+VGEPT    +GD IKIGR
Sbjct: 125 NGPPKGSISFLITGDEEGPAINGTIKLLRWAAERGERWDACLVGEPTNPDRLGDMIKIGR 184

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSLSG+IT+HG QGH AYPHL +NP+RG++ L   L +  FD G   F P+N+E+TT+D
Sbjct: 185 RGSLSGKITVHGVQGHAAYPHLADNPVRGMLQLTQALMDPPFDGGTDDFQPSNLEVTTVD 244

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQN------VPKLSHTVHF 296
           VGNP+ NVIPA+   SFNIRFND W  +TL+ EI  RL     +         + + + +
Sbjct: 245 VGNPATNVIPAKASASFNIRFNDSWTAETLRAEILRRLDAAAGDGRLRPGREPVKYDIVW 304

Query: 297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRT 356
           +   S VFLT +  L + LS ++    G  P LST+GGTSDARFIKDYCPV+EFGLVG+T
Sbjct: 305 ADRPSHVFLTRNNALIASLSSAVEGVIGRSPKLSTTGGTSDARFIKDYCPVVEFGLVGQT 364

Query: 357 MHALNENASLQDLEDLTCIYENFLQNWF 384
           MH ++E  ++ DLE LT IYE F+ +WF
Sbjct: 365 MHMVDERVAVSDLETLTAIYETFIAHWF 392


>gi|325291804|ref|YP_004277668.1| succinyl-diaminopimelate desuccinylase [Agrobacterium sp. H13-3]
 gi|325059657|gb|ADY63348.1| succinyl-diaminopimelate desuccinylase [Agrobacterium sp. H13-3]
          Length = 398

 Score =  441 bits (1135), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 215/390 (55%), Positives = 270/390 (69%), Gaps = 7/390 (1%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           T D + +L  LI+CPSVTP +GGA  +L   L  LGF++E+       T  V+NLYAR G
Sbjct: 3   TTDPVANLAALIRCPSVTPAEGGALSLLDTLLSPLGFAVEKMVATEAGTPDVENLYARLG 62

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
           TE PHLM AGH DVVP GD   W++PPF+A IA G+++GRG VDMKG IACF+AA+AR+I
Sbjct: 63  TEGPHLMLAGHTDVVPVGDEAAWSHPPFAAEIAGGEMFGRGAVDMKGGIACFVAAIARYI 122

Query: 122 PKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
            K+ K  GS+S LITGDEEGP+INGT K+L W   KGE WDAC+VGEPT    +G+ IKI
Sbjct: 123 EKHGKPKGSVSFLITGDEEGPSINGTSKLLEWAAAKGETWDACVVGEPTNPDQLGEMIKI 182

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGS+SG IT+HG QGH AYPHL +NPIRGL+ L H L    FD G   F P+N+E+TT
Sbjct: 183 GRRGSISGRITVHGVQGHAAYPHLADNPIRGLLQLTHALMYPPFDHGTDDFQPSNLEVTT 242

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQ------NVPKLSHTV 294
           ID GN + NVIPA+   SFNIRFND W  ++L+ EI  RL           +   + + +
Sbjct: 243 IDTGNAATNVIPARATASFNIRFNDSWTVESLRAEIIRRLDAAAAEGELRPDRSPVKYEI 302

Query: 295 HFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVG 354
            ++   + VFLT +  L S LS ++   TG  P LST+GGTSDARFIKDYCPV+EFGLVG
Sbjct: 303 VWADRPAHVFLTRNNALISSLSGAVEAVTGKEPKLSTTGGTSDARFIKDYCPVVEFGLVG 362

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNWF 384
           +TMH ++E   + DLE LT IYE F++ WF
Sbjct: 363 QTMHMVDERVEIADLETLTRIYETFIERWF 392


>gi|239832656|ref|ZP_04680985.1| succinyl-diaminopimelate desuccinylase [Ochrobactrum intermedium
           LMG 3301]
 gi|239824923|gb|EEQ96491.1| succinyl-diaminopimelate desuccinylase [Ochrobactrum intermedium
           LMG 3301]
          Length = 395

 Score =  439 bits (1128), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 215/386 (55%), Positives = 269/386 (69%), Gaps = 8/386 (2%)

Query: 7   EHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPH 66
           E+L  LI+CPSVTP +GGA   L   LK +GFS+E   F+ + T  ++NLYAR     PH
Sbjct: 9   ENLAALIRCPSVTPAEGGALTALEAMLKPMGFSVERPVFRDEGTPDIENLYARKSGNGPH 68

Query: 67  LMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKN 126
           LMFAGH DVVPPG+   W +PPFSA I +G +YGRG VDMKG +ACF+AAVAR I K+ +
Sbjct: 69  LMFAGHTDVVPPGNEGDWKHPPFSAAIEDGVMYGRGAVDMKGGVACFVAAVARHIEKHGS 128

Query: 127 F-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGS 185
             GS+S LITGDEEGPAINGT K+L W +++GE WDA IVGEPT  + +GD IKIGRRGS
Sbjct: 129 LKGSVSFLITGDEEGPAINGTVKLLDWAKQRGESWDASIVGEPTNPNALGDMIKIGRRGS 188

Query: 186 LSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGN 245
           LSG IT+HG QGH AYPHL ENP+RG+  L+  L    FD G   F  +N+E+TTIDVGN
Sbjct: 189 LSGIITVHGVQGHAAYPHLAENPVRGITTLVDSLLYPAFDAGTADFQASNLEVTTIDVGN 248

Query: 246 PSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQN-------VPKLSHTVHFSS 298
            + NVI  +   SFNIRFND W  ++L+ EI +RL K  ++          +++ + +  
Sbjct: 249 TATNVIANKATASFNIRFNDTWTAESLQAEIVARLEKAARDNRLRPGRETPINYELTWRE 308

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
             S VFLT D KL   L+ S+   TG  P LSTSGGTSDARFIKDYCPV+EFGLVG+TMH
Sbjct: 309 HPSHVFLTRDEKLIGTLTASVEAVTGKRPELSTSGGTSDARFIKDYCPVVEFGLVGQTMH 368

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E  +L DLE LT IYE F+ ++F
Sbjct: 369 MVDERVALADLEGLTQIYERFIADFF 394


>gi|319780353|ref|YP_004139829.1| succinyl-diaminopimelate desuccinylase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166241|gb|ADV09779.1| succinyl-diaminopimelate desuccinylase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 397

 Score =  438 bits (1127), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 220/394 (55%), Positives = 270/394 (68%), Gaps = 18/394 (4%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D  E+L  LI+C SVTP +GGA   L   LK LGF ++   F    T  ++NLYAR    
Sbjct: 6   DPAENLAALIRCASVTPAEGGALTALETMLKPLGFLVDRPVFSEDGTPDIENLYARRSGN 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI-- 121
            PHLMFAGH DVVP GD   WT+PPF+A IA G++YGRG VDMKG IACFIAAVAR +  
Sbjct: 66  GPHLMFAGHTDVVPVGDEAAWTHPPFAAEIANGEMYGRGAVDMKGGIACFIAAVARHVEA 125

Query: 122 ---PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
              PK    GS+SLLITGDEEGPAINGT K+L W   +GEKWDA +VGEPT    +GD I
Sbjct: 126 NGGPK----GSVSLLITGDEEGPAINGTVKLLEWAASRGEKWDASVVGEPTNPDALGDMI 181

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGS+SG +T++G+QGHVAYP L +NP+RGL+ L+  L +  FD G   F PTN+EI
Sbjct: 182 KIGRRGSMSGAVTVNGRQGHVAYPLLADNPVRGLMSLVDALLHPVFDKGTRDFQPTNLEI 241

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQN--------VPKL 290
           T+IDVGNP+ NVIPA+   +FNIRFND W ++TL+ EI +RL +  +          P  
Sbjct: 242 TSIDVGNPATNVIPAKATATFNIRFNDTWTDETLQAEIHNRLDQAARRKKYRQGKKTPVD 301

Query: 291 SHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEF 350
              V    P S VFLT D +L   L  SI +  G  P LSTSGGTSDARFIKDYCPV+EF
Sbjct: 302 YELVWRDRP-SHVFLTRDDRLIETLRGSIKSAVGKEPTLSTSGGTSDARFIKDYCPVVEF 360

Query: 351 GLVGRTMHALNENASLQDLEDLTCIYENFLQNWF 384
           GLVG+TMH ++E  ++ DLE LT IY+ F+++WF
Sbjct: 361 GLVGKTMHMVDERVAIADLETLTQIYQRFIEDWF 394


>gi|163757851|ref|ZP_02164940.1| putative succinyl-diaminopimelate desuccinylase [Hoeflea
           phototrophica DFL-43]
 gi|162285353|gb|EDQ35635.1| putative succinyl-diaminopimelate desuccinylase [Hoeflea
           phototrophica DFL-43]
          Length = 398

 Score =  437 bits (1125), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 212/388 (54%), Positives = 267/388 (68%), Gaps = 7/388 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D  + L  LI+CPSVTP++GGA   L   L  LGF+ +   F  + T  V+NLY+R G+E
Sbjct: 5   DPTQTLTALIRCPSVTPEEGGALTELAGMLSELGFANDRVTFSDEGTPDVENLYSRLGSE 64

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVP GD   WT  PFSA I +G++YGRG VDMKG IACF++A+AR I +
Sbjct: 65  GPHLMFAGHTDVVPVGDAEAWTQGPFSADIVDGEMYGRGAVDMKGGIACFVSALARLIER 124

Query: 124 YKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
                GS+SLLITGDEEGP+INGT+K+L     KGE+WDA +VGEPT    +GD IKIGR
Sbjct: 125 KGPLKGSVSLLITGDEEGPSINGTEKLLVHAAGKGERWDAAVVGEPTNPDQLGDMIKIGR 184

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSLSG +T+ G QGHVAYPHL +NP+ G++ L   L +   D GN  F P+N+EIT+ID
Sbjct: 185 RGSLSGTLTVEGVQGHVAYPHLADNPLPGMMALASALIDPPLDAGNERFPPSNLEITSID 244

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGI------QNVPKLSHTVHF 296
            GN + NVIPA+    FNIRFND W  ++LK E+R+R+ +            K+ +TV F
Sbjct: 245 TGNTATNVIPARCTAKFNIRFNDQWTAESLKAELRARIEQASGGGSSRTGQEKVRYTVKF 304

Query: 297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRT 356
           +   S  FLTHD  L   LS ++   TG  P LST+GGTSDARFIKDYCPV+EFGLVG+T
Sbjct: 305 ADRPSSSFLTHDAPLIEALSNAVTEATGRTPALSTTGGTSDARFIKDYCPVVEFGLVGKT 364

Query: 357 MHALNENASLQDLEDLTCIYENFLQNWF 384
           MH ++E  ++ DLE LT IYE FL+ WF
Sbjct: 365 MHMVDERVAVSDLEALTGIYELFLERWF 392


>gi|150395289|ref|YP_001325756.1| succinyl-diaminopimelate desuccinylase [Sinorhizobium medicae
           WSM419]
 gi|150026804|gb|ABR58921.1| succinyl-diaminopimelate desuccinylase [Sinorhizobium medicae
           WSM419]
          Length = 426

 Score =  437 bits (1124), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 214/388 (55%), Positives = 266/388 (68%), Gaps = 7/388 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D + +L  LI+CPSVTP +GGA   L + L  +GF  +    +   T  ++NLYAR G  
Sbjct: 34  DPVSNLATLIRCPSVTPAEGGALTALESMLTPIGFKADRIVAREAGTPDIENLYARIGVG 93

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVP GD   W++PPFSA IAEG++YGRG VDMKG IACF+AAVAR I K
Sbjct: 94  GPHLMFAGHTDVVPVGDEIAWSHPPFSAAIAEGEMYGRGAVDMKGGIACFVAAVARHIEK 153

Query: 124 YKN-FGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
           +    GSIS LITGDEEGPAINGT K+L W   KGE+WDAC+VGEPT    IG+ IKIGR
Sbjct: 154 HGAPKGSISFLITGDEEGPAINGTVKLLEWAAAKGERWDACLVGEPTNPGGIGEMIKIGR 213

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSLSG IT+ G QGH AYPHL +NP+R ++ L H L +  FD G   F P+N+E+TTID
Sbjct: 214 RGSLSGRITVQGVQGHAAYPHLADNPVRSILQLAHALMDPPFDDGTENFQPSNLEVTTID 273

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQ------NVPKLSHTVHF 296
           VGN + NVIPA+   +FN+RFNDLW  ++L  EI +RL +             + + + +
Sbjct: 274 VGNAAVNVIPAKASAAFNVRFNDLWTAESLMTEIVARLDRAASAGALRPGRAPVKYEIVW 333

Query: 297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRT 356
           +   S VFLT +  L   LS ++   TG  P LST+GGTSDARFIKDYCPV+EFGLVG+T
Sbjct: 334 NERPSHVFLTRNDALIESLSGAVEAVTGQQPRLSTTGGTSDARFIKDYCPVVEFGLVGKT 393

Query: 357 MHALNENASLQDLEDLTCIYENFLQNWF 384
           MH ++E  +L DLE LT IYE F+  WF
Sbjct: 394 MHMVDERVALADLETLTGIYETFIARWF 421


>gi|238055330|sp|A6U5J1|DAPE_SINMW RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 397

 Score =  437 bits (1123), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 214/388 (55%), Positives = 266/388 (68%), Gaps = 7/388 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D + +L  LI+CPSVTP +GGA   L + L  +GF  +    +   T  ++NLYAR G  
Sbjct: 5   DPVSNLATLIRCPSVTPAEGGALTALESMLTPIGFKADRIVAREAGTPDIENLYARIGVG 64

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVP GD   W++PPFSA IAEG++YGRG VDMKG IACF+AAVAR I K
Sbjct: 65  GPHLMFAGHTDVVPVGDEIAWSHPPFSAAIAEGEMYGRGAVDMKGGIACFVAAVARHIEK 124

Query: 124 YKN-FGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
           +    GSIS LITGDEEGPAINGT K+L W   KGE+WDAC+VGEPT    IG+ IKIGR
Sbjct: 125 HGAPKGSISFLITGDEEGPAINGTVKLLEWAAAKGERWDACLVGEPTNPGGIGEMIKIGR 184

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSLSG IT+ G QGH AYPHL +NP+R ++ L H L +  FD G   F P+N+E+TTID
Sbjct: 185 RGSLSGRITVQGVQGHAAYPHLADNPVRSILQLAHALMDPPFDDGTENFQPSNLEVTTID 244

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQ------NVPKLSHTVHF 296
           VGN + NVIPA+   +FN+RFNDLW  ++L  EI +RL +             + + + +
Sbjct: 245 VGNAAVNVIPAKASAAFNVRFNDLWTAESLMTEIVARLDRAASAGALRPGRAPVKYEIVW 304

Query: 297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRT 356
           +   S VFLT +  L   LS ++   TG  P LST+GGTSDARFIKDYCPV+EFGLVG+T
Sbjct: 305 NERPSHVFLTRNDALIESLSGAVEAVTGQQPRLSTTGGTSDARFIKDYCPVVEFGLVGKT 364

Query: 357 MHALNENASLQDLEDLTCIYENFLQNWF 384
           MH ++E  +L DLE LT IYE F+  WF
Sbjct: 365 MHMVDERVALADLETLTGIYETFIARWF 392


>gi|260461126|ref|ZP_05809375.1| succinyl-diaminopimelate desuccinylase [Mesorhizobium opportunistum
           WSM2075]
 gi|259033160|gb|EEW34422.1| succinyl-diaminopimelate desuccinylase [Mesorhizobium opportunistum
           WSM2075]
          Length = 397

 Score =  435 bits (1119), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 219/394 (55%), Positives = 267/394 (67%), Gaps = 18/394 (4%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D   +L  LI+C SVTP +GGA   L   LK LGF +E   F    T  ++NLYAR    
Sbjct: 6   DPAANLATLIRCASVTPAEGGALGALETMLKPLGFLVERPVFSEDGTPDIENLYARRSGN 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI-- 121
            PHLMFAGH DVVP GD   WT+PPF+A IA G++YGRG VDMKG IACFIAAVAR +  
Sbjct: 66  GPHLMFAGHTDVVPVGDEAAWTHPPFAAEIANGEMYGRGAVDMKGGIACFIAAVARHVEA 125

Query: 122 ---PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
              PK    GS+SLLITGDEEGPAINGT K+L W   +GEKWDA IVGEPT    +GD I
Sbjct: 126 NGGPK----GSVSLLITGDEEGPAINGTVKLLEWAASRGEKWDASIVGEPTNPDALGDMI 181

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGS+SG +T++G+QGH AYP L +NP+RGL+ L+  L +  FD G   F PTN+E+
Sbjct: 182 KIGRRGSMSGAVTVNGRQGHAAYPQLADNPVRGLMSLVDALLHPVFDKGTRDFQPTNLEV 241

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGI--------QNVPKL 290
           T+IDVGNP+ NVIPA+    FNIRFND W  +TL+ EI +RL +          +  P  
Sbjct: 242 TSIDVGNPATNVIPAKAVAVFNIRFNDTWTAETLQAEIHNRLDQAAGRKKYRPGKKTPVD 301

Query: 291 SHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEF 350
              V    P S VFLT D +L   L+ SI +  G  P LSTSGGTSDARFIKDYCPV+EF
Sbjct: 302 YDLVWRDRP-SHVFLTRDDRLVETLAGSIKSAVGKEPTLSTSGGTSDARFIKDYCPVVEF 360

Query: 351 GLVGRTMHALNENASLQDLEDLTCIYENFLQNWF 384
           GLVG+TMH ++E  ++ DLE LT IY+ F+++WF
Sbjct: 361 GLVGKTMHMVDERVAIADLETLTRIYQRFIEDWF 394


>gi|13474060|ref|NP_105628.1| succinyl-diaminopimelate desuccinylase [Mesorhizobium loti
           MAFF303099]
 gi|81778660|sp|Q98D57|DAPE_RHILO RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|14024812|dbj|BAB51414.1| succinyl-diaminopimelate desuccinylase [Mesorhizobium loti
           MAFF303099]
          Length = 397

 Score =  435 bits (1118), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 216/393 (54%), Positives = 268/393 (68%), Gaps = 16/393 (4%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D   +L  LI+C SVTP +GGA   L   LK LGF ++   F    T  ++NLYAR    
Sbjct: 6   DPAANLAALIRCASVTPAEGGALGALETMLKPLGFLVDRPVFSEDGTPDIENLYARRSGN 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI-- 121
            PHLMFAGH DVVP GD   WT+PPF+A IA G++YGRG VDMKG IACF+AA+AR +  
Sbjct: 66  GPHLMFAGHTDVVPVGDEAAWTHPPFAAEIANGEMYGRGAVDMKGGIACFVAAIARHVEN 125

Query: 122 ---PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
              PK    GS+SLLITGDEEGPAINGT K+L W   +GEKWDA IVGEPT    +GD I
Sbjct: 126 NGGPK----GSVSLLITGDEEGPAINGTVKLLEWAASRGEKWDASIVGEPTNPDTLGDMI 181

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGSLSG IT++G+QGH AYP L +NP+RGL+ L+  L +  FD G   F PTN+E+
Sbjct: 182 KIGRRGSLSGSITVNGRQGHAAYPQLADNPVRGLMGLVDALLHPVFDKGTKDFQPTNLEV 241

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVP-------KLS 291
           T+IDVGNP+ NVIPA+   +FNIRFND W  +T++ EI +RL +  +           + 
Sbjct: 242 TSIDVGNPATNVIPAKATATFNIRFNDTWTAETVQAEIHNRLDQAAKRKKYRPGKKTPVD 301

Query: 292 HTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFG 351
           + + +    S VFLT D KL   L+ SI    G  P LSTSGGTSDARFIKDYCPV+EFG
Sbjct: 302 YDLVWRDRPSHVFLTRDDKLVDTLAGSIKAAVGKEPTLSTSGGTSDARFIKDYCPVVEFG 361

Query: 352 LVGRTMHALNENASLQDLEDLTCIYENFLQNWF 384
           LVG+TMH ++E  +L DLE LT IY+ F+++WF
Sbjct: 362 LVGKTMHMVDERVALADLETLTRIYQRFIEDWF 394


>gi|153008681|ref|YP_001369896.1| succinyl-diaminopimelate desuccinylase [Ochrobactrum anthropi ATCC
           49188]
 gi|238064762|sp|A6WYL3|DAPE_OCHA4 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|151560569|gb|ABS14067.1| succinyl-diaminopimelate desuccinylase [Ochrobactrum anthropi ATCC
           49188]
          Length = 395

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 212/386 (54%), Positives = 267/386 (69%), Gaps = 8/386 (2%)

Query: 7   EHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPH 66
           ++L  LI+C SVTP +GGA   L   LK +GFS+E   F  ++T  ++NLYAR     PH
Sbjct: 9   DNLAALIRCASVTPAEGGALTALEAMLKPMGFSVERPVFHDEDTPDIENLYARKSGNGPH 68

Query: 67  LMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKN 126
           LMFAGH DVVPPG+   W +PPFSA I +G +YGRG VDMKG +ACF+AAVAR I K+ +
Sbjct: 69  LMFAGHTDVVPPGNEGDWKHPPFSAAIEDGVMYGRGAVDMKGGVACFVAAVARHIEKHGS 128

Query: 127 F-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGS 185
             GS+S LITGDEEGPAINGT K+L W +++GE WDA IVGEP+  + +GD IKIGRRGS
Sbjct: 129 IKGSVSFLITGDEEGPAINGTVKLLDWAKQRGESWDASIVGEPSNPNALGDAIKIGRRGS 188

Query: 186 LSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGN 245
           LSG IT+HG QGH AYPHL ENP+RG+  L+  L    FD G   F  +N+E+T+IDVGN
Sbjct: 189 LSGTITVHGVQGHAAYPHLAENPVRGITTLVDSLLYPAFDQGTANFQASNLEVTSIDVGN 248

Query: 246 PSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQN-------VPKLSHTVHFSS 298
            + NVI  +   SFNIRFND W  +TL+ EI +RL K  ++          + + + +  
Sbjct: 249 KATNVIANKATASFNIRFNDTWTAETLQAEIIARLEKAARDNRLRPGRETPIKYELTWRE 308

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
             S VFLT D KL   L+ S+   TG  P LSTSGGTSDARFIKDYCPV+EFGLVG+TMH
Sbjct: 309 HPSHVFLTRDEKLIGTLTDSVEAVTGKRPELSTSGGTSDARFIKDYCPVVEFGLVGQTMH 368

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E  +L DLE LT IYE F+ ++F
Sbjct: 369 MVDERVALADLEGLTQIYERFIADFF 394


>gi|163867354|ref|YP_001608548.1| succinyl-diaminopimelate desuccinylase [Bartonella tribocorum CIP
           105476]
 gi|238055171|sp|A9ILD7|DAPE_BART1 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|161016995|emb|CAK00553.1| succinyl-diaminopimelate desuccinylase [Bartonella tribocorum CIP
           105476]
          Length = 390

 Score =  433 bits (1114), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 214/385 (55%), Positives = 266/385 (69%), Gaps = 3/385 (0%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D L+ L  LI+CPSVTP + GA   L   LK +GF +E   F  KNT  V+NLYA+ G E
Sbjct: 6   DPLQLLQALIRCPSVTPHEAGALSALEQFLKKMGFHVERPIFTDKNTDNVENLYAKMGNE 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVPPG    WTYPPF A I +GK+YGRG VDMKG IACFIAA+AR + K
Sbjct: 66  GPHLMFAGHTDVVPPGALEDWTYPPFEAVIDQGKLYGRGAVDMKGGIACFIAALARVLEK 125

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               G +SLLITGDEEG AINGT K+L W EKKGEKW A +VGEPT    +GD IKIGRR
Sbjct: 126 RSIKGRVSLLITGDEEGTAINGTVKLLKWAEKKGEKWTAALVGEPTSVKTVGDIIKIGRR 185

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS+SG IT+ G+QGHVA+P    NP+     L+  LT I  D G   F P+N+E+TTID 
Sbjct: 186 GSISGIITVKGRQGHVAFPERAANPLPLASKLIQALTQIALDQGTENFQPSNLELTTIDT 245

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSR--LIKGIQNVPKLS-HTVHFSSPV 300
           GN + NVIPAQ  + FNIR+NDLW ++TL EEI  R  L++   N  +   + + +   +
Sbjct: 246 GNLAVNVIPAQTTVRFNIRYNDLWTKETLMEEIEKRLSLVQEKNNSGQYPFYQLEWIPSL 305

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL 360
             VFLT + KL  +LS +I + TG++P  STSGGTSDARFIKDYCPV+EFGL G+TMH +
Sbjct: 306 GDVFLTKNDKLIQVLSNAIKSVTGSLPECSTSGGTSDARFIKDYCPVVEFGLPGQTMHMV 365

Query: 361 NENASLQDLEDLTCIYENFLQNWFI 385
           +E  +L  +E LT IYE F+ ++F+
Sbjct: 366 DECVALDAVETLTAIYERFIIDFFV 390


>gi|240849727|ref|YP_002971115.1| succinyl-diaminopimelate desuccinylase [Bartonella grahamii as4aup]
 gi|240266850|gb|ACS50438.1| succinyl-diaminopimelate desuccinylase [Bartonella grahamii as4aup]
          Length = 390

 Score =  433 bits (1113), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 213/384 (55%), Positives = 266/384 (69%), Gaps = 3/384 (0%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D L+ L +LI+CPSVTP + GA   L   LK +GF +E   F  KNT  V+NLYA+ G E
Sbjct: 6   DPLQLLQRLIRCPSVTPHEAGALSTLEQFLKKMGFHVERPIFTDKNTDNVENLYAKMGNE 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVPPG  + WTY PF A I +GK+YGRG VDMKG IACFIAA+AR + K
Sbjct: 66  GPHLMFAGHTDVVPPGALDEWTYSPFEAVIDQGKLYGRGAVDMKGGIACFIAALARVLEK 125

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               G +S LITGDEEGPA+NGT K+L W EKKGEKW A +VGEPT    +GD IKIGRR
Sbjct: 126 RSIKGMVSFLITGDEEGPAVNGTVKLLKWAEKKGEKWTAALVGEPTSVKTVGDVIKIGRR 185

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS+SG IT+ G+QGHVA+P    NP+     L+  LT    D G   F P+N+E+T+ID 
Sbjct: 186 GSISGIITVRGRQGHVAFPERAANPLPLASKLIQALTQTALDKGTEDFQPSNLELTSIDT 245

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSR--LIKGIQNVPKL-SHTVHFSSPV 300
           GN + NVIPAQ  + FNIR+NDLW ++TL EEI+ R  L++   N  +  S+ + +   +
Sbjct: 246 GNLAVNVIPAQTTVHFNIRYNDLWTKETLMEEIKKRLALVQSKNNGDQYPSYQLEWIPSL 305

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL 360
             VFLT + KL   LS +I + TGNIP  STSGGTSDARFIKDYCPV+EFGL G+TMH +
Sbjct: 306 GDVFLTKNDKLIQTLSNAIKSVTGNIPECSTSGGTSDARFIKDYCPVVEFGLPGQTMHMV 365

Query: 361 NENASLQDLEDLTCIYENFLQNWF 384
           +E  +L  +E LT IYE F+ ++F
Sbjct: 366 DECVALDAVETLTTIYERFIVDFF 389


>gi|222084713|ref|YP_002543242.1| succinyl-diaminopimelate desuccinylase protein [Agrobacterium
           radiobacter K84]
 gi|238055202|sp|B9J8D0|DAPE_AGRRK RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|221722161|gb|ACM25317.1| succinyl-diaminopimelate desuccinylase protein [Agrobacterium
           radiobacter K84]
          Length = 397

 Score =  432 bits (1112), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 214/388 (55%), Positives = 267/388 (68%), Gaps = 7/388 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D + +L  LI+C SVTP +GGA   L + L  LGF +E        T  ++NLYAR GTE
Sbjct: 5   DPVANLQTLIRCASVTPAEGGALTALADMLLPLGFKVERMTASEAGTPDIENLYARLGTE 64

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVP GD   W++PPF+A IA G+++GRG VDMKG IACF AAVAR I K
Sbjct: 65  GPHLMFAGHTDVVPVGDAASWSHPPFAADIAGGELFGRGAVDMKGGIACFAAAVARHIEK 124

Query: 124 Y-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
           +    GSIS LITGDEEGPAINGT K+L W  ++GE+WDA +VGEPT    +GD IKIGR
Sbjct: 125 HGPPAGSISFLITGDEEGPAINGTVKLLQWAAERGEQWDASLVGEPTNPDQLGDMIKIGR 184

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGS+SG IT+HG QGH AYPHL +NP+R ++ L   L +  FD G   F P+N+E+TTID
Sbjct: 185 RGSISGFITVHGVQGHAAYPHLADNPVRSIVKLTEALLDPPFDAGTDNFQPSNLEVTTID 244

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQ------NVPKLSHTVHF 296
           VGN + NVIPA+   +FNIRFND W  +TL+ EI +RL                 + + +
Sbjct: 245 VGNAATNVIPAKATAAFNIRFNDTWTVETLRAEILARLDAAAADQTLRPGREPTKYDITW 304

Query: 297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRT 356
           S   S VFLT +  L + LS ++ N TG+ P LST+GGTSDARFIKDYCPV+EFGLVG+T
Sbjct: 305 SDRPSQVFLTRNNALIASLSSAVENVTGHTPKLSTTGGTSDARFIKDYCPVVEFGLVGQT 364

Query: 357 MHALNENASLQDLEDLTCIYENFLQNWF 384
           MH ++E  ++ DLE LT IYE F+Q WF
Sbjct: 365 MHMVDERVAVADLETLTEIYETFIQRWF 392


>gi|307317992|ref|ZP_07597429.1| succinyl-diaminopimelate desuccinylase [Sinorhizobium meliloti
           AK83]
 gi|306896394|gb|EFN27143.1| succinyl-diaminopimelate desuccinylase [Sinorhizobium meliloti
           AK83]
          Length = 397

 Score =  432 bits (1111), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 214/388 (55%), Positives = 264/388 (68%), Gaps = 7/388 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D + +L  LI+CPSVTP +GGA   L   L  +GF ++    +   T  ++NLYAR G E
Sbjct: 5   DPVSNLAALIRCPSVTPAEGGALAALEAMLAPVGFKVDRVVAKEPGTPDIENLYARIGGE 64

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVP GD   W+ PPFSA IAEG++YGRG VDMKG IACF+AAVAR + K
Sbjct: 65  GPHLMFAGHTDVVPVGDEAAWSRPPFSAAIAEGEMYGRGAVDMKGGIACFVAAVARHVEK 124

Query: 124 YKN-FGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
           +    GSIS LITGDEEGPAINGT K+L W   +GE+WDAC+VGEPT    IGD IKIGR
Sbjct: 125 HGAPKGSISFLITGDEEGPAINGTVKLLEWAAARGERWDACLVGEPTNPDCIGDMIKIGR 184

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSLSG IT+HG QGH AYPHL +NP+R ++ L   L +  FD G   F P+N+E+TTID
Sbjct: 185 RGSLSGRITVHGIQGHAAYPHLADNPVRSILQLAQALMDPPFDDGTENFQPSNLEVTTID 244

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVP------KLSHTVHF 296
           VGN + NVIPA+   +FNIRFND W  ++L  EI +RL +               + + +
Sbjct: 245 VGNTAVNVIPAKASAAFNIRFNDRWTAESLMAEIVARLDRAAAGSALRPGRGSARYEIVW 304

Query: 297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRT 356
           +   S VFLT +  L   LS ++   TG  P LST+GGTSDARFIKDYCPV+EFGLVG+T
Sbjct: 305 NERPSHVFLTRNNALIDSLSGAVEAVTGRQPQLSTTGGTSDARFIKDYCPVVEFGLVGKT 364

Query: 357 MHALNENASLQDLEDLTCIYENFLQNWF 384
           MH ++E  +L DLE LT IYE F+  WF
Sbjct: 365 MHMVDERVALADLETLTGIYETFIARWF 392


>gi|15964178|ref|NP_384531.1| succinyl-diaminopimelate desuccinylase [Sinorhizobium meliloti
           1021]
 gi|307301322|ref|ZP_07581084.1| succinyl-diaminopimelate desuccinylase [Sinorhizobium meliloti
           BL225C]
 gi|81635219|sp|Q92SH1|DAPE_RHIME RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|15073354|emb|CAC41862.1| Probable succinyl-diaminopimelate desuccinylase [Sinorhizobium
           meliloti 1021]
 gi|306903778|gb|EFN34365.1| succinyl-diaminopimelate desuccinylase [Sinorhizobium meliloti
           BL225C]
          Length = 397

 Score =  432 bits (1111), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 217/389 (55%), Positives = 263/389 (67%), Gaps = 9/389 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D + +L  LI+CPSVTP +GGA   L   L  +GF ++    +   T  ++NLYAR G E
Sbjct: 5   DPVSNLAALIRCPSVTPAEGGALAALEAMLAPVGFKVDRVVAKEPGTPDIENLYARTGGE 64

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVP GD   W+ PPFSA IAEG++YGRG VDMKG IACF+AAVAR I K
Sbjct: 65  GPHLMFAGHTDVVPVGDEAAWSRPPFSAAIAEGEMYGRGAVDMKGGIACFVAAVARHIEK 124

Query: 124 YKN-FGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
           +    GSIS LITGDEEGPAINGT K+L W   +GE+WDAC+VGEPT    IGD IKIGR
Sbjct: 125 HGAPKGSISFLITGDEEGPAINGTVKLLEWAAARGERWDACLVGEPTNPDCIGDMIKIGR 184

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSLSG IT+HG QGH AYPHL +NP+R ++ +   L +  FD G   F P+N+E+TTID
Sbjct: 185 RGSLSGRITVHGVQGHAAYPHLADNPVRSILQIAQALMDPPFDDGTENFQPSNLEVTTID 244

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQ-------NVPKLSHTVH 295
           VGN + NVIPA+   +FNIRFND W  ++L  EI +RL +            P     V 
Sbjct: 245 VGNTAVNVIPAKASAAFNIRFNDRWTAESLMAEIVARLDRAAAGSALRPGRAPARYEIVW 304

Query: 296 FSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGR 355
              P S VFLT +  L   LS ++   TG  P LST+GGTSDARFIKDYCPV+EFGLVG+
Sbjct: 305 NERP-SHVFLTRNNALIDSLSGAVEAVTGRQPQLSTTGGTSDARFIKDYCPVVEFGLVGK 363

Query: 356 TMHALNENASLQDLEDLTCIYENFLQNWF 384
           TMH ++E  +L DLE LT IYE F+  WF
Sbjct: 364 TMHMVDERVALADLETLTGIYETFIARWF 392


>gi|319403534|emb|CBI77115.1| succinyl-diaminopimelate desuccinylase [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 388

 Score =  427 bits (1099), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 210/382 (54%), Positives = 267/382 (69%), Gaps = 1/382 (0%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D ++ L  LI+CPSVTP + GA   L + L+ +GF +E   F  KN   V+NLYA+ G+E
Sbjct: 6   DPVQILQTLIRCPSVTPHEAGALSTLEHFLRKMGFCVERPIFVDKNAEDVENLYAKIGSE 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVPPG+  +WTYPPF   I++GK+YGRG VDMKG IACFIAA+ARF+ K
Sbjct: 66  GPHLMFAGHSDVVPPGELENWTYPPFEGVISQGKLYGRGAVDMKGGIACFIAAMARFLKK 125

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               G +S LITGDEEGPAINGT K+L W  +KGEKW+A IVGEPT  +I+GD IKIGRR
Sbjct: 126 KTLKGMVSFLITGDEEGPAINGTVKLLEWAVQKGEKWNAAIVGEPTSVNIVGDMIKIGRR 185

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS+SG ITI G QGHVA+P    NP+     L+  LT    D G   F  +++E+T+ID 
Sbjct: 186 GSISGIITIKGCQGHVAFPERAANPLPLASKLIQALTQTALDQGTKDFQASHLELTSIDT 245

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSP 302
           GN S N+IPAQ  + FNIR+NDLW ++TL  EI  RL     +N   L + + +   +  
Sbjct: 246 GNLSVNIIPAQTVIRFNIRYNDLWTKETLVAEIEKRLASVHSENDQVLYYQLEWICSLGD 305

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNE 362
           VFLT + KL  +LS +I + TGNIP  STSGGTSDARFIKDYCPV+EFGL G+TMH ++E
Sbjct: 306 VFLTKNDKLIGILSNAIKSVTGNIPECSTSGGTSDARFIKDYCPVVEFGLPGQTMHMVDE 365

Query: 363 NASLQDLEDLTCIYENFLQNWF 384
             +L  +E+LT IYE F+ ++F
Sbjct: 366 CVTLDAIENLTSIYERFITDFF 387


>gi|319406448|emb|CBI80088.1| succinyl-diaminopimelate desuccinylase [Bartonella sp. 1-1C]
          Length = 388

 Score =  422 bits (1084), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 210/382 (54%), Positives = 265/382 (69%), Gaps = 1/382 (0%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D ++ L  LI+CPSVTP + GA   L + LK +GF +E   F  KNT  V+NLYA+ G+E
Sbjct: 6   DPVQILQTLIRCPSVTPHEAGALSTLEHFLKKMGFCVERPIFVDKNTEDVENLYAKIGSE 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVPPG   +WTYPPF   I++GK+YGRG VDMKG IACFIAA+ARF+ K
Sbjct: 66  GPHLMFAGHSDVVPPGKLENWTYPPFEGVISQGKLYGRGAVDMKGGIACFIAALARFLKK 125

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               G +S LIT DEEGPAINGT K+L W  +KGEKW+A IVGEPT  +I+GD IKIGRR
Sbjct: 126 KTLKGMVSFLITSDEEGPAINGTVKLLEWAVQKGEKWNAAIVGEPTSVNIVGDMIKIGRR 185

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS+SG ITI G QGHVA+P    NP+     L+  LT    D G   F  +++E+T+ID 
Sbjct: 186 GSISGIITIKGCQGHVAFPERAANPLPLASKLIQALTQTALDQGTKDFQASHLELTSIDT 245

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSP 302
           GN S N+IPAQ  + FNIR+NDLW ++TL  EI  RL     +N     + + +   +  
Sbjct: 246 GNFSVNIIPAQTVIRFNIRYNDLWTKETLVAEIEKRLASVHSENDQVPYYQLEWIYGLGG 305

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNE 362
           VFLT + KL  +LS +I + TGNIP  STSGGTSDARFIKDYCPV+EFGL G+TMH ++E
Sbjct: 306 VFLTKNDKLIGILSNAIKSVTGNIPECSTSGGTSDARFIKDYCPVVEFGLPGQTMHMIDE 365

Query: 363 NASLQDLEDLTCIYENFLQNWF 384
             +L  +E+LT IYE F+ ++F
Sbjct: 366 CVTLDAIENLTSIYERFITDFF 387


>gi|319898241|ref|YP_004158334.1| succinyl-diaminopimelate desuccinylase [Bartonella clarridgeiae 73]
 gi|319402205|emb|CBI75736.1| succinyl-diaminopimelate desuccinylase [Bartonella clarridgeiae 73]
          Length = 388

 Score =  422 bits (1084), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 209/382 (54%), Positives = 266/382 (69%), Gaps = 1/382 (0%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D ++ L  LI+CPSVTP + G    L + L+ +GF +E   F  KNT  V+NLYA+ G+E
Sbjct: 6   DPVQLLQALIRCPSVTPHEAGVLSTLEHFLRKMGFCVERPVFVDKNTEDVENLYAKIGSE 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVPPG+  +WTYPPF   I +G++YGRG VDMKG IACFIAA+ARF+ K
Sbjct: 66  GPHLMFAGHSDVVPPGELENWTYPPFEGVINQGRLYGRGAVDMKGGIACFIAALARFLKK 125

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               G +S LITGDEEGPAINGT K+L W  KKGEKW+A IVGEPT  +I+GDTIKIGRR
Sbjct: 126 KSLKGMVSFLITGDEEGPAINGTVKLLEWAVKKGEKWNAAIVGEPTSINIVGDTIKIGRR 185

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS+SG IT+ G QGHVA+P    NP+     L+  LT    D G   F  +++E+T+ID 
Sbjct: 186 GSISGIITVKGYQGHVAFPERAANPLPLANKLIQALTQNALDQGTKDFQASHLELTSIDT 245

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRL-IKGIQNVPKLSHTVHFSSPVSP 302
           GN S N+IPAQ  + FNIR+NDLW ++TL  EI  RL     +N     + + +   +  
Sbjct: 246 GNFSVNIIPAQTVIRFNIRYNDLWTKETLIAEIEKRLAFVHSKNDQVPYYQLEWIYGLGG 305

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNE 362
           VFLT + KL  +LS +I + TGNIP  STSGGTSDARFIKDYCPV+EFGL G+TMH ++E
Sbjct: 306 VFLTKNDKLVGILSNAIKSITGNIPECSTSGGTSDARFIKDYCPVVEFGLPGQTMHMVDE 365

Query: 363 NASLQDLEDLTCIYENFLQNWF 384
             +L  +E+LT IYE F+ ++F
Sbjct: 366 YVTLDAIENLTSIYERFITDFF 387


>gi|49474876|ref|YP_032917.1| succinyl-diaminopimelate desuccinylase [Bartonella henselae str.
           Houston-1]
 gi|81648343|sp|Q6G567|DAPE_BARHE RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|49237681|emb|CAF26868.1| Succinyl-diaminopimelate desuccinylase [Bartonella henselae str.
           Houston-1]
          Length = 390

 Score =  422 bits (1084), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 207/384 (53%), Positives = 261/384 (67%), Gaps = 3/384 (0%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D L+ L  LI+CPSVTP + GA   L   L  +GF +E   F  KNT  V+NLYA+ G E
Sbjct: 6   DPLQILQALIRCPSVTPHEAGALSTLEQFLTKMGFHVERPIFADKNTEDVENLYAKMGKE 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVPPGD  +W YPPF   I +GK+YGRG VDMKG IACF+AA AR + K
Sbjct: 66  GPHLMFAGHTDVVPPGDLENWKYPPFEGVIDQGKLYGRGAVDMKGGIACFVAAFARVLEK 125

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               G +SLLITGDEEGPA+NGT K+L W E+KGEKW A +VGEPT    +GD IKIGRR
Sbjct: 126 RTIKGRVSLLITGDEEGPALNGTVKLLKWAEQKGEKWTAALVGEPTSVKTVGDVIKIGRR 185

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS+SG +T+ G+QGHVA+P    NP+     L+  L     D G   F P+N+E+T ID 
Sbjct: 186 GSISGIMTVKGRQGHVAFPERAANPLPLASKLIQSLIQTTLDEGTENFQPSNLELTAIDT 245

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSR--LIKGIQNVPKLS-HTVHFSSPV 300
           GNP+ NVIPAQ  + FNIR+NDLW ++ L  EI +R  L++   N  +   + + +   +
Sbjct: 246 GNPAMNVIPAQATVHFNIRYNDLWTKEMLMAEIENRLALVQSKNNNGQYPYYQLEWIPSL 305

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL 360
             VFLT + KL + LS +I + TGNIP  STSGGTSDARFIKDYCPVIEFGL G+TMH +
Sbjct: 306 GDVFLTKNDKLINTLSNAIKSVTGNIPECSTSGGTSDARFIKDYCPVIEFGLPGQTMHMV 365

Query: 361 NENASLQDLEDLTCIYENFLQNWF 384
           +E  ++  +E LT IYE F+ ++F
Sbjct: 366 DECVTVDAMETLTSIYECFIVDFF 389


>gi|49473730|ref|YP_031772.1| succinyl-diaminopimelate desuccinylase [Bartonella quintana str.
           Toulouse]
 gi|81647447|sp|Q6G1H9|DAPE_BARQU RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|49239233|emb|CAF25553.1| Succinyl-diaminopimelate desuccinylase [Bartonella quintana str.
           Toulouse]
          Length = 390

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 205/385 (53%), Positives = 260/385 (67%), Gaps = 5/385 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D L+ L  LI+CPSVTP + GA   L   L  +GF+++   F  KNT  V+NLYA+ G E
Sbjct: 6   DPLQLLQALIRCPSVTPYEAGALSTLEQILTKMGFNVKRPVFTDKNTEDVENLYAKMGGE 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
             HLMFAGH DVVPPG    WTYPPF   I +GK+YGRG VDMKG IACF+AA+AR + K
Sbjct: 66  GRHLMFAGHTDVVPPGALEDWTYPPFEGVIDQGKLYGRGAVDMKGGIACFVAALARILEK 125

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               G +SLLITGDEEGPA+NGT K+L W E+KGEKW A +VGEPT    +GD IKIGRR
Sbjct: 126 RSIKGMVSLLITGDEEGPALNGTVKLLKWAEQKGEKWTAALVGEPTSVKTVGDVIKIGRR 185

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSLSG +T+ G+QGHVA+P    NP+     L+  LT    D G   F P+N+E+TTID 
Sbjct: 186 GSLSGVVTVKGRQGHVAFPERAANPLPLAGKLIQALTQTALDRGTENFQPSNLELTTIDT 245

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQ----NVPKLSHTVHFSSP 299
            NP+ NVIPAQ  + FNIR+ND+W ++TL  EI  RL   +Q    +     + + +   
Sbjct: 246 DNPAVNVIPAQTTIRFNIRYNDVWTKETLMTEIEKRL-ASVQLKNNDYQYPYYQLEWIPS 304

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
           +  VF+T + KL   LS +I + TGNIP  STSGGTSDARFIKDYCPV+EFGL G+TMH 
Sbjct: 305 LGSVFITKNDKLIKTLSNAIESVTGNIPEYSTSGGTSDARFIKDYCPVVEFGLPGQTMHM 364

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           ++E  +L  +E LT +YE F+ ++F
Sbjct: 365 VDECVTLDAIETLTSVYERFIVDFF 389


>gi|319404960|emb|CBI78562.1| succinyl-diaminopimelate desuccinylase [Bartonella sp. AR 15-3]
          Length = 388

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 208/382 (54%), Positives = 263/382 (68%), Gaps = 1/382 (0%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D ++ L  LI+CPS+TP + GA   L + L+ +GF +E   F  KNT  V+NLYA+ G+E
Sbjct: 6   DPVQLLQILIRCPSITPHEAGALSTLEHFLRKMGFCVERPVFVDKNTEDVENLYAKIGSE 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVPPG   +WTYPPF   I +GK+YGRG VDMKG IACFIAA+ARF+ K
Sbjct: 66  GPHLMFAGHSDVVPPGKLENWTYPPFEGVINQGKLYGRGAVDMKGGIACFIAALARFLEK 125

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               G +S LITGDEEGPAINGT K+L W  +KGEKW+A IVGEPT  +I+GD IKIGRR
Sbjct: 126 KTLKGKVSFLITGDEEGPAINGTVKLLEWAVQKGEKWNAAIVGEPTSVNIVGDVIKIGRR 185

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS+SG ITI G QGHVA+P    NP+     L+  LT    D G   F  +++E+T+ID 
Sbjct: 186 GSISGIITIKGCQGHVAFPERAVNPLPLANKLIQALTQNALDQGTKDFQASHLELTSIDT 245

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLS-HTVHFSSPVSP 302
           GN S N+IPAQ  + FNIR+NDLW ++ L  EI  RL        +L  + + +   +  
Sbjct: 246 GNFSVNIIPAQTVIRFNIRYNDLWTKEALVAEIEKRLASVHSKNDQLPYYQLEWIYGLGG 305

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNE 362
           VFLT + KL  +LS +I + TGNIP  STSGGTSDARFIKDYCPV+EFGL G TMH ++E
Sbjct: 306 VFLTKNDKLVGILSNAIKSVTGNIPECSTSGGTSDARFIKDYCPVVEFGLPGLTMHMVDE 365

Query: 363 NASLQDLEDLTCIYENFLQNWF 384
             +L  +E+LT IYE F+ ++F
Sbjct: 366 CVTLDAIENLTSIYERFITDFF 387


>gi|121602384|ref|YP_989585.1| succinyl-diaminopimelate desuccinylase [Bartonella bacilliformis
           KC583]
 gi|238055170|sp|A1UUD2|DAPE_BARBK RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|120614561|gb|ABM45162.1| acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase
           [Bartonella bacilliformis KC583]
          Length = 390

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 204/384 (53%), Positives = 262/384 (68%), Gaps = 3/384 (0%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D ++ L  LI+CPS+TP + GA  IL   L+ +GFS+E   F  KNT+ V+NLYA+ G +
Sbjct: 6   DPVQLLQALIRCPSITPNEAGALSILEQFLRKMGFSVERPIFSDKNTADVENLYAKMGNK 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVPPG+ ++W YPPF   I +GKIYGRG VDMKG+IACFIAA+AR + K
Sbjct: 66  GPHLMFAGHSDVVPPGELDNWMYPPFEGIINQGKIYGRGAVDMKGAIACFIAALARVLEK 125

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               G++SLLITGDEEGPAINGT K+L W  +KGEKW+A IVGEPT    +GD IKIGRR
Sbjct: 126 QPIKGAVSLLITGDEEGPAINGTVKLLKWAAQKGEKWNAAIVGEPTSVKRVGDMIKIGRR 185

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS+SG IT+ G+QGHVA+P    NP+     L+  LT+   D G   F  +N+E+TTID 
Sbjct: 186 GSISGIITVKGRQGHVAFPERAANPLPLAHKLIQALTDTALDQGTKNFQASNLELTTIDT 245

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSR--LIKGIQNVPKLS-HTVHFSSPV 300
           GN + N+IPAQ  + FNIR+NDLW ++ L  EI  R  L+    N  +   + + +   +
Sbjct: 246 GNSATNIIPAQTVIRFNIRYNDLWTKEALIAEIEKRLALVHSENNSNQYPYYQLEWIQNL 305

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL 360
             VFL  +  L  +LS +I   TG  P  STSGGTSDARFIKDYCPV+EFGL G TMH +
Sbjct: 306 GSVFLIKNDHLIEILSNAIEIVTGKRPECSTSGGTSDARFIKDYCPVVEFGLPGNTMHMV 365

Query: 361 NENASLQDLEDLTCIYENFLQNWF 384
           +E  +L  +E LT IYE F+ ++F
Sbjct: 366 DECVTLDAMESLTVIYERFIIDFF 389


>gi|163851060|ref|YP_001639103.1| succinyl-diaminopimelate desuccinylase [Methylobacterium extorquens
           PA1]
 gi|163662665|gb|ABY30032.1| succinyl-diaminopimelate desuccinylase [Methylobacterium extorquens
           PA1]
          Length = 403

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 202/375 (53%), Positives = 251/375 (66%), Gaps = 4/375 (1%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+CPSVTP++GGA   L + L   GFS+E   F    T  ++NLYAR GT  P L+FAG
Sbjct: 31  LIRCPSVTPEEGGALSFLADRLSRAGFSVERPVFSEPGTPDIQNLYARIGTAGPVLVFAG 90

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFG-S 129
           H DVVPPG+   WT+ PFS  +AEG +YGRG VDMKG IAC +AA   F+ ++  +FG S
Sbjct: 91  HTDVVPPGEVGSWTHGPFSGEVAEGFLYGRGAVDMKGGIACMLAATLAFLDRHGPDFGGS 150

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I+ L+TGDEEGPA+NGT K+L W + +GE++D C++GEPT    +G+ IKIGRRGSL+G 
Sbjct: 151 IAFLVTGDEEGPAVNGTVKLLDWAKARGERFDHCLLGEPTNPDTLGEMIKIGRRGSLTGR 210

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           IT+HG+QGHVAYPH  ENPI GL+ L   LT    D G   F  +N+E TTIDVGNP+ N
Sbjct: 211 ITVHGRQGHVAYPHRAENPIPGLLRLASALTADPLDGGTAHFDASNLEFTTIDVGNPATN 270

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIPA  K  FN+RFND W   TL  EIR RL     N  + S  +  S+  SP FLT   
Sbjct: 271 VIPASAKAVFNVRFNDDWTADTLGAEIRRRLEAAAGNAVRFSLDLQPSN--SPAFLTQPD 328

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDL 369
                ++ +I   TG  P LST+GGTSDARFIKD CPVIEFGLVGRTMH  +E  ++ DL
Sbjct: 329 AFVDRVADAIEAETGRRPALSTTGGTSDARFIKDACPVIEFGLVGRTMHETDERVAVADL 388

Query: 370 EDLTCIYENFLQNWF 384
           + LT IY   L  +F
Sbjct: 389 DRLTAIYGRVLDAYF 403


>gi|238064825|sp|A9W376|DAPE_METEP RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 385

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 202/375 (53%), Positives = 251/375 (66%), Gaps = 4/375 (1%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+CPSVTP++GGA   L + L   GFS+E   F    T  ++NLYAR GT  P L+FAG
Sbjct: 13  LIRCPSVTPEEGGALSFLADRLSRAGFSVERPVFSEPGTPDIQNLYARIGTAGPVLVFAG 72

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFG-S 129
           H DVVPPG+   WT+ PFS  +AEG +YGRG VDMKG IAC +AA   F+ ++  +FG S
Sbjct: 73  HTDVVPPGEVGSWTHGPFSGEVAEGFLYGRGAVDMKGGIACMLAATLAFLDRHGPDFGGS 132

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I+ L+TGDEEGPA+NGT K+L W + +GE++D C++GEPT    +G+ IKIGRRGSL+G 
Sbjct: 133 IAFLVTGDEEGPAVNGTVKLLDWAKARGERFDHCLLGEPTNPDTLGEMIKIGRRGSLTGR 192

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           IT+HG+QGHVAYPH  ENPI GL+ L   LT    D G   F  +N+E TTIDVGNP+ N
Sbjct: 193 ITVHGRQGHVAYPHRAENPIPGLLRLASALTADPLDGGTAHFDASNLEFTTIDVGNPATN 252

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIPA  K  FN+RFND W   TL  EIR RL     N  + S  +  S+  SP FLT   
Sbjct: 253 VIPASAKAVFNVRFNDDWTADTLGAEIRRRLEAAAGNAVRFSLDLQPSN--SPAFLTQPD 310

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDL 369
                ++ +I   TG  P LST+GGTSDARFIKD CPVIEFGLVGRTMH  +E  ++ DL
Sbjct: 311 AFVDRVADAIEAETGRRPALSTTGGTSDARFIKDACPVIEFGLVGRTMHETDERVAVADL 370

Query: 370 EDLTCIYENFLQNWF 384
           + LT IY   L  +F
Sbjct: 371 DRLTAIYGRVLDAYF 385


>gi|218529890|ref|YP_002420706.1| succinyl-diaminopimelate desuccinylase [Methylobacterium
           chloromethanicum CM4]
 gi|218522193|gb|ACK82778.1| succinyl-diaminopimelate desuccinylase [Methylobacterium
           chloromethanicum CM4]
          Length = 388

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 201/375 (53%), Positives = 252/375 (67%), Gaps = 4/375 (1%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+CPSVTP++GGA   L + L   GFS+E   F    T  ++NLYAR GT  P L+FAG
Sbjct: 16  LIRCPSVTPEEGGALSFLADRLSRAGFSVERPVFSEPGTPDIQNLYARIGTAGPVLVFAG 75

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK-NFG-S 129
           H DVVPPG+   WT+ PFS  +A+G +YGRG VDMKG IAC +AA   F+ +++ +FG S
Sbjct: 76  HTDVVPPGETEAWTHGPFSGEVADGFLYGRGAVDMKGGIACMLAATLAFLDRHRPDFGGS 135

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I+ L+TGDEEGPA+NGT K+L W + +GE++D C++GEPT    +G+ IKIGRRGSL+G 
Sbjct: 136 IAFLVTGDEEGPAVNGTVKLLDWAKARGERFDHCLLGEPTNPDTLGEMIKIGRRGSLTGR 195

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           IT+HG+QGHVAYPH  ENPI GL+ L   LT    D G   F  +N+E TTIDVGNP+ N
Sbjct: 196 ITVHGRQGHVAYPHRAENPIPGLLRLASALTADPLDGGTAHFDASNLEFTTIDVGNPATN 255

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIPA  K  FN+RFND W   TL  EIR RL     N  + S  +  S+  SP FLT   
Sbjct: 256 VIPASAKAVFNVRFNDDWTADTLGAEIRRRLEAAAGNAVRFSLDLQPSN--SPAFLTQPD 313

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDL 369
                ++ +I   TG  P LST+GGTSDARFIKD CPVIEFGLVGRTMH  +E  ++ DL
Sbjct: 314 AFVDRVADAIEAETGRRPALSTTGGTSDARFIKDACPVIEFGLVGRTMHETDERVAVADL 373

Query: 370 EDLTCIYENFLQNWF 384
           + LT IY   L  +F
Sbjct: 374 DRLTAIYGRVLDAYF 388


>gi|238064826|sp|B7KVW2|DAPE_METC4 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 385

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 201/375 (53%), Positives = 252/375 (67%), Gaps = 4/375 (1%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+CPSVTP++GGA   L + L   GFS+E   F    T  ++NLYAR GT  P L+FAG
Sbjct: 13  LIRCPSVTPEEGGALSFLADRLSRAGFSVERPVFSEPGTPDIQNLYARIGTAGPVLVFAG 72

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK-NFG-S 129
           H DVVPPG+   WT+ PFS  +A+G +YGRG VDMKG IAC +AA   F+ +++ +FG S
Sbjct: 73  HTDVVPPGETEAWTHGPFSGEVADGFLYGRGAVDMKGGIACMLAATLAFLDRHRPDFGGS 132

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I+ L+TGDEEGPA+NGT K+L W + +GE++D C++GEPT    +G+ IKIGRRGSL+G 
Sbjct: 133 IAFLVTGDEEGPAVNGTVKLLDWAKARGERFDHCLLGEPTNPDTLGEMIKIGRRGSLTGR 192

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           IT+HG+QGHVAYPH  ENPI GL+ L   LT    D G   F  +N+E TTIDVGNP+ N
Sbjct: 193 ITVHGRQGHVAYPHRAENPIPGLLRLASALTADPLDGGTAHFDASNLEFTTIDVGNPATN 252

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIPA  K  FN+RFND W   TL  EIR RL     N  + S  +  S+  SP FLT   
Sbjct: 253 VIPASAKAVFNVRFNDDWTADTLGAEIRRRLEAAAGNAVRFSLDLQPSN--SPAFLTQPD 310

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDL 369
                ++ +I   TG  P LST+GGTSDARFIKD CPVIEFGLVGRTMH  +E  ++ DL
Sbjct: 311 AFVDRVADAIEAETGRRPALSTTGGTSDARFIKDACPVIEFGLVGRTMHETDERVAVADL 370

Query: 370 EDLTCIYENFLQNWF 384
           + LT IY   L  +F
Sbjct: 371 DRLTAIYGRVLDAYF 385


>gi|188580855|ref|YP_001924300.1| succinyl-diaminopimelate desuccinylase [Methylobacterium populi
           BJ001]
 gi|238064790|sp|B1ZGA7|DAPE_METPB RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|179344353|gb|ACB79765.1| succinyl-diaminopimelate desuccinylase [Methylobacterium populi
           BJ001]
          Length = 387

 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 205/386 (53%), Positives = 255/386 (66%), Gaps = 6/386 (1%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
            +P  L H   LI+CPSVTP++GGA   L   L   GFS+E   F    T  ++NLYAR 
Sbjct: 4   QSPLALAH--ALIRCPSVTPEEGGALSFLAERLTEAGFSVERPVFSEAGTPDIENLYARI 61

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT  P L+FAGH DVVPPG+   WT+ PFS  I +G +YGRG VDMKG IAC +AA   F
Sbjct: 62  GTAGPVLVFAGHTDVVPPGEAASWTHGPFSGEITDGFLYGRGAVDMKGGIACMLAATLSF 121

Query: 121 IPKY-KNFG-SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           + ++  +FG SI+ LITGDEEGPA+NGT K+L W + +GE++D C++GEPT    +G+ I
Sbjct: 122 LDRHGPDFGGSIAFLITGDEEGPAVNGTVKLLDWAKARGERFDHCLLGEPTNPDSLGEMI 181

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGSL+G IT+HG+QGHVAYPH  ENPI GL+ L   L     D G   F  +N+E 
Sbjct: 182 KIGRRGSLTGRITVHGRQGHVAYPHRAENPIPGLLRLASALIAEPLDGGTAHFDASNLEF 241

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           TTIDVGNP+ NVIPA  K  FN+RFND W  +TL  EIR RL     N  + S  +  S+
Sbjct: 242 TTIDVGNPATNVIPASAKAVFNVRFNDDWTAETLGAEIRKRLEAAAGNAVRFSLDLQPSN 301

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
             SP FLT       L++ +I   TG  P LST+GGTSDARFIKD CPVIEFGLVGRTMH
Sbjct: 302 --SPAFLTQPDAFVDLVADAIAAETGRRPALSTTGGTSDARFIKDACPVIEFGLVGRTMH 359

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
             +E  ++ DL+ LT IY   L+ +F
Sbjct: 360 ETDERVAVADLDRLTAIYGRVLERYF 385


>gi|240138194|ref|YP_002962666.1| N-succinyl-diaminopimelate deacylase (dapE) [Methylobacterium
           extorquens AM1]
 gi|240008163|gb|ACS39389.1| N-succinyl-diaminopimelate deacylase (dapE) [Methylobacterium
           extorquens AM1]
          Length = 388

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 201/375 (53%), Positives = 251/375 (66%), Gaps = 4/375 (1%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+CPSVTP++GGA   L + L   GFS+E   F    T  ++NLYAR GT  P L+FAG
Sbjct: 16  LIRCPSVTPEEGGALSFLADRLSRAGFSVERPVFSEPGTPDIQNLYARIGTAGPVLVFAG 75

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFG-S 129
           H DVVPPG+   WT+ PFS  +A+G +YGRG VDMKG IAC +AA   F+ ++  +FG S
Sbjct: 76  HTDVVPPGETEAWTHGPFSGEVADGFLYGRGAVDMKGGIACMLAATLAFLDRHGPDFGGS 135

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I+ L+TGDEEGPA+NGT K+L W + +GE++D C++GEPT    +G+ IKIGRRGSL+G 
Sbjct: 136 IAFLVTGDEEGPAVNGTVKLLDWAKARGERFDHCLLGEPTNPDTLGEMIKIGRRGSLTGR 195

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           IT+HG+QGHVAYPH  ENPI GL+ L   LT    D G   F  +N+E TTIDVGNP+ N
Sbjct: 196 ITVHGRQGHVAYPHRAENPIPGLLRLASALTADPLDGGTAHFDASNLEFTTIDVGNPATN 255

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIPA  K  FN+RFND W   TL  EIR RL     N  + S  +  S+  SP FLT   
Sbjct: 256 VIPASAKAVFNVRFNDDWTADTLGAEIRRRLEAAAGNAVRFSLDLQPSN--SPAFLTQPD 313

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDL 369
                ++ +I   TG  P LST+GGTSDARFIKD CPVIEFGLVGRTMH  +E  ++ DL
Sbjct: 314 AFVDRVADAIEAETGRRPALSTTGGTSDARFIKDACPVIEFGLVGRTMHETDERVAVADL 373

Query: 370 EDLTCIYENFLQNWF 384
           + LT IY   L  +F
Sbjct: 374 DRLTAIYGRVLDAYF 388


>gi|319407921|emb|CBI81575.1| succinyl-diaminopimelate desuccinylase [Bartonella schoenbuchensis
           R1]
          Length = 390

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 205/384 (53%), Positives = 261/384 (67%), Gaps = 3/384 (0%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D ++ L  LI+CPSVTP + GA   L + L  LGF++E   F  KNT  V+NLYA+ G +
Sbjct: 6   DPIQLLQALIRCPSVTPHEAGALSTLEHFLTKLGFTVERPVFVDKNTEDVENLYAKIGNK 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVPPG+  +WTYPPF   I +GK+YGRG VDMKG IACFIAA+AR   K
Sbjct: 66  GPHLMFAGHSDVVPPGELGNWTYPPFKGVIDQGKLYGRGAVDMKGGIACFIAALARVFKK 125

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               G+IS LITGDEEGPA+NGT K+L W  +KGEKW A IVGEPT   ++GD IKIGRR
Sbjct: 126 QPIKGTISFLITGDEEGPALNGTVKLLKWAVEKGEKWTAAIVGEPTSVKVVGDMIKIGRR 185

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS+SG I + G+QGHVA+P    NP+     L+  L     D G   F  +N+E+T+ID 
Sbjct: 186 GSISGIIRVQGRQGHVAFPERAANPLPLAHKLVQALIQTPLDQGTKNFQASNLELTSIDT 245

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRL--IKGIQNVPKL-SHTVHFSSPV 300
           GN S N+IP    + FNIR+NDLW  +TL  E+ +RL  ++   N  +L  + + +   +
Sbjct: 246 GNCSVNIIPMHTVIRFNIRYNDLWTRETLIAEVENRLASVQSENNHNELPCYQLEWVPNL 305

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL 360
             VFLT + KL   LS +I + TGN P LSTSGGTSDARFIKDYCPV+EFGL G+TMH +
Sbjct: 306 GSVFLTQNGKLIETLSNAIESMTGNRPELSTSGGTSDARFIKDYCPVVEFGLPGQTMHMV 365

Query: 361 NENASLQDLEDLTCIYENFLQNWF 384
           +E  +L  LE+LT IYE F+ ++F
Sbjct: 366 DECVTLDALENLTSIYERFIVDFF 389


>gi|90419796|ref|ZP_01227705.1| succinyl-diaminopimelate desuccinylase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335837|gb|EAS49585.1| succinyl-diaminopimelate desuccinylase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 410

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 200/388 (51%), Positives = 257/388 (66%), Gaps = 7/388 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +  L +LI+CPSVTP +GGA   L   L  LGF++E   F   +T  V+NL+AR G  
Sbjct: 19  DPVAILTRLIRCPSVTPAEGGALAALQEILAPLGFAVERPVFSDIDTPDVENLFARAGAA 78

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHL+FAGH DVVPPGD + W   PFSA I +G++YGRG VDMKG IA F+AA AR + +
Sbjct: 79  GPHLVFAGHTDVVPPGDQSDWREGPFSAAIVDGELYGRGAVDMKGGIAAFVAAYARQVER 138

Query: 124 YKN-FGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
             +  G +SLLITGDEEGPA+NGT K+L W   +GE++DAC+VGEPT    +GD IKIGR
Sbjct: 139 AGHPAGQVSLLITGDEEGPAVNGTVKLLDWASARGERFDACVVGEPTNPAAMGDMIKIGR 198

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSLS E+ I G QGHVAYPHL +NP+R L  +   L +   D G+  F  +N+EIT+ID
Sbjct: 199 RGSLSAELRITGVQGHVAYPHLADNPLRTLTAIAEALMDEPLDAGSAEFPASNLEITSID 258

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGI------QNVPKLSHTVHF 296
            GN S NVIPA+ ++ FN+RF+D W   +LK E+  R+          +     +  + +
Sbjct: 259 TGNGSVNVIPARARLFFNVRFSDRWTPDSLKVELTRRIEAAAASGRFREGRDAANVEIVW 318

Query: 297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRT 356
            +  S  FLT D  LT  L+ ++   TG  P LSTSGGTSDARFIKD+CPV+EFGLVG+T
Sbjct: 319 RARPSESFLTRDDALTQALAGAVKAVTGRQPQLSTSGGTSDARFIKDFCPVVEFGLVGKT 378

Query: 357 MHALNENASLQDLEDLTCIYENFLQNWF 384
           MH  NE   ++DLE LT IYE F+  WF
Sbjct: 379 MHMSNERVPVEDLETLTRIYETFIARWF 406


>gi|114706679|ref|ZP_01439580.1| succinyl-diaminopimelate desuccinylase [Fulvimarina pelagi
           HTCC2506]
 gi|114538071|gb|EAU41194.1| succinyl-diaminopimelate desuccinylase [Fulvimarina pelagi
           HTCC2506]
          Length = 403

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 202/384 (52%), Positives = 259/384 (67%), Gaps = 10/384 (2%)

Query: 9   LIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLM 68
           L +LI+CPSVTP +GGA   L   L  LGF +    F  K+T  V+NL+A  G   PHL 
Sbjct: 14  LAELIRCPSVTPAEGGALSALGRMLNELGFDVMRPVFSDKDTPDVENLFAARGA-GPHLC 72

Query: 69  FAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK-YKNF 127
           FAGH DVVP GD + W+ PPFSA I +G++YGRG VDMKG IA F+AA+AR   +  ++ 
Sbjct: 73  FAGHTDVVPVGDESEWSLPPFSAEIRDGELYGRGAVDMKGGIAAFVAALARRRTRGERSD 132

Query: 128 GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLS 187
           G +SLLITGDEEGPAINGT K+L WI  +GE+ DAC+VGEPT    +GD +KIGRRGSLS
Sbjct: 133 GRVSLLITGDEEGPAINGTIKLLDWIAARGERLDACLVGEPTNPETLGDMVKIGRRGSLS 192

Query: 188 GEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPS 247
             +T+ G+QGHVAYPHL +NP+R +  +   L    FD G   F PTN+EIT+ID GN +
Sbjct: 193 AHVTVTGRQGHVAYPHLADNPLRTITAIAEALQAKPFDKGTEAFPPTNLEITSIDTGNDA 252

Query: 248 KNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLS-----HTVHFSSPVSP 302
            NVIP + ++SFN+RF DLW   +LK E+ +R ++  +N  K         V F+    P
Sbjct: 253 TNVIPGRARLSFNVRFCDLWTPDSLKAELLAR-VETARNGSKYRAGKEPAEVSFAWRGRP 311

Query: 303 --VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL 360
              FLT    L S LS ++   TG  P LST+GGTSDARFIKD+CPV+EFGLVG+TMH +
Sbjct: 312 SEAFLTRSEDLISALSGAVAAVTGKAPRLSTTGGTSDARFIKDFCPVVEFGLVGQTMHMI 371

Query: 361 NENASLQDLEDLTCIYENFLQNWF 384
           +E+ +L DLE LT IY+ F+  WF
Sbjct: 372 DEHVALADLEALTEIYDRFISRWF 395


>gi|254560754|ref|YP_003067849.1| N-succinyl-diaminopimelate deacylase [Methylobacterium extorquens
           DM4]
 gi|254268032|emb|CAX23903.1| N-succinyl-diaminopimelate deacylase (dapE) [Methylobacterium
           extorquens DM4]
          Length = 388

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 200/375 (53%), Positives = 249/375 (66%), Gaps = 4/375 (1%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+CPSVTP++GGA   L + L   GFS+E   F    T  ++NLYAR GT  P L+FAG
Sbjct: 16  LIRCPSVTPEEGGALSFLADRLSRAGFSVERPVFSEPGTPDIQNLYARIGTAGPVLVFAG 75

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFG-S 129
           H DVVPPG+   WT+ PFS  + +G +YGRG VDMKG IAC +AA   F+ ++  +FG S
Sbjct: 76  HTDVVPPGETEAWTHGPFSGEVTDGFLYGRGAVDMKGGIACMLAATLAFLDRHGPDFGGS 135

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I+ L+TGDEEGPA+NGT K+L W + +GE +D C++GEPT    +G+ IKIGRRGSL+G 
Sbjct: 136 IAFLVTGDEEGPAVNGTVKLLDWAKARGECFDHCLLGEPTNPDTLGEMIKIGRRGSLTGR 195

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           IT+HG+QGHVAYPH  ENPI GL+ L   LT    D G   F  +N+E TTIDVGNP+ N
Sbjct: 196 ITVHGRQGHVAYPHRAENPIPGLLRLASALTADPLDGGTAHFDASNLEFTTIDVGNPATN 255

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIPA  K  FN+RFND W   TL  EIR RL     N  + S  +  S+  SP FLT   
Sbjct: 256 VIPASAKAVFNVRFNDDWTADTLGAEIRRRLEAAAGNAVRFSLDLQPSN--SPAFLTQPD 313

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDL 369
                ++ +I   TG  P LST+GGTSDARFIKD CPVIEFGLVGRTMH  +E  ++ DL
Sbjct: 314 AFVDRVADAIEAETGRRPALSTTGGTSDARFIKDACPVIEFGLVGRTMHETDERVAVADL 373

Query: 370 EDLTCIYENFLQNWF 384
           + LT IY   L  +F
Sbjct: 374 DRLTAIYGRVLDAYF 388


>gi|23010393|ref|ZP_00051097.1| COG0624: Acetylornithine deacetylase/Succinyl-diaminopimelate
           desuccinylase and related deacylases [Magnetospirillum
           magnetotacticum MS-1]
          Length = 382

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 202/378 (53%), Positives = 249/378 (65%), Gaps = 6/378 (1%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           +TP  L     LI+CPSVTP++GGA   L   L   GF IE   F    T  ++NLYAR 
Sbjct: 7   LTPLALAQ--ALIRCPSVTPEEGGALSFLAEVLARAGFRIERPVFSQDGTPDIENLYARI 64

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   P L+ AGH DVVPPG+   WT+ PFS  +A G +YGRG VDMKG IAC +AA   F
Sbjct: 65  GGGGPVLLLAGHTDVVPPGEVGAWTHGPFSGEVAGGFLYGRGAVDMKGGIACMLAATLAF 124

Query: 121 IP-KYKNFG-SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           +  K  +FG S++ LITGDEEGPAINGT K+L W +++GE++D C++GEPT    +GD I
Sbjct: 125 LDRKGPDFGGSLAFLITGDEEGPAINGTVKLLDWAKRRGERFDHCLLGEPTNPDALGDMI 184

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGSL+G +T+HG+QGHVAYPH  ENPI GL+ L   L     D G   F  +N+E 
Sbjct: 185 KIGRRGSLTGRLTVHGRQGHVAYPHRAENPIPGLLRLASALIAEPLDGGTAHFDASNLEF 244

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           TTIDVGNP+ NVIPA  K  FN+RFND W  +TL  EIR RL     N  + S  +  S+
Sbjct: 245 TTIDVGNPATNVIPASAKAVFNVRFNDDWTAETLGAEIRRRLEAAAGNAVRFSLDLQPSN 304

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
             SP FLT       L++ +I   TG  P+LST+GGTSDARFIKD CPVIEFGLVG+TMH
Sbjct: 305 --SPAFLTRPDAFVDLVADAIEAETGRRPVLSTTGGTSDARFIKDACPVIEFGLVGQTMH 362

Query: 359 ALNENASLQDLEDLTCIY 376
             +E  ++ DLE LT IY
Sbjct: 363 ETDERVAVTDLERLTAIY 380


>gi|304392395|ref|ZP_07374336.1| succinyl-diaminopimelate desuccinylase [Ahrensia sp. R2A130]
 gi|303295499|gb|EFL89858.1| succinyl-diaminopimelate desuccinylase [Ahrensia sp. R2A130]
          Length = 404

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 195/388 (50%), Positives = 253/388 (65%), Gaps = 12/388 (3%)

Query: 9   LIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLM 68
           L  LI CPSVTP++GGA  +L   L+ LGF++E +      T  V+NLYAR G  +P+L 
Sbjct: 11  LRDLIACPSVTPEEGGALTVLQKRLEPLGFTVERRVSTAPGTPDVENLYARLGNASPNLC 70

Query: 69  FAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF- 127
           FAGH DVVP GD   WT  PF   + +G++ GRG VDMKG IACF+AAV + I   K   
Sbjct: 71  FAGHTDVVPTGDEAAWTSGPFQGDVVDGEMIGRGAVDMKGGIACFLAAVEQHIAAGKPVP 130

Query: 128 GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLS 187
           GSIS LITGDEEGPA+NGT  +L W+ ++GEK DAC+VGEPT  + +GD IKIGRRGS+S
Sbjct: 131 GSISFLITGDEEGPAVNGTSAVLDWLVERGEKIDACVVGEPTNPNQLGDAIKIGRRGSVS 190

Query: 188 GEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPS 247
           G +T+HG QGH AYPHL +NP RG++ L + L    FD G   F PTN+E+T+ID+GNP+
Sbjct: 191 GTVTVHGTQGHAAYPHLADNPARGIVALCNALMAEPFDEGTEDFQPTNLEVTSIDIGNPA 250

Query: 248 KNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQN-----------VPKLSHTVHF 296
            NV+  Q    FNIRFND W   ++K EI  RL    ++            P +   V +
Sbjct: 251 FNVVAQQATARFNIRFNDTWTADSVKAEIERRLAVASESNAVRPDLPDGARPPVRFDVVY 310

Query: 297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRT 356
           +   S VFLT D  L   L+ ++ +  G  P  ST GGTSDARFIKD C V+EFGLVG+T
Sbjct: 311 TERPSHVFLTRDDTLIDSLAGAVEDVIGRRPETSTGGGTSDARFIKDVCSVVEFGLVGQT 370

Query: 357 MHALNENASLQDLEDLTCIYENFLQNWF 384
           MH ++E  +L DL+ LT IY  F++++F
Sbjct: 371 MHQVDERVALADLDQLTAIYARFIESYF 398


>gi|254501028|ref|ZP_05113179.1| succinyl-diaminopimelate desuccinylase [Labrenzia alexandrii
           DFL-11]
 gi|222437099|gb|EEE43778.1| succinyl-diaminopimelate desuccinylase [Labrenzia alexandrii
           DFL-11]
          Length = 390

 Score =  398 bits (1022), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 196/376 (52%), Positives = 250/376 (66%), Gaps = 4/376 (1%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            LI+CPSVTP++GGA   L   LK  GF ++   FQ  +T  V+NL+A  G+ APH +FA
Sbjct: 15  NLIRCPSVTPKEGGALSALETLLKDAGFRVDRVVFQDDDTPDVENLFASVGSGAPHFVFA 74

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFG- 128
           GH DVVP G    WT+ PF   +  G +YGRG VDMKG IA F AA   F+ +   +FG 
Sbjct: 75  GHTDVVPAGSEADWTHGPFEGEVDSGVLYGRGAVDMKGGIASFAAAALEFVDQNGTDFGG 134

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           +IS LITGDEEGPAINGT K+L W +K+G ++DACIVGEPT    +GD IK+GRRGSLSG
Sbjct: 135 TISFLITGDEEGPAINGTVKLLEWADKQGHRFDACIVGEPTNPAALGDAIKVGRRGSLSG 194

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
            +T+ G QGH AYPHL +NPI GL  L+  L ++  D GN  F P+N+EI T+DVGN + 
Sbjct: 195 IVTVTGVQGHAAYPHLADNPIPGLTNLMAALNDLKLDEGNERFQPSNLEIVTVDVGNTAF 254

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHD 308
           NVIPA+ +  FNIR+ND W   +LK +I   L     N+  L   + F    S  FLT D
Sbjct: 255 NVIPARAEFRFNIRYNDAWTLDSLKAKILETL--ETVNLGSLKMNIEFKRDASESFLTKD 312

Query: 309 RKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQD 368
             L   LSK++   TG  P LST GGTSDARFIK+YCPV+EFGLVG+TMH ++E  +++D
Sbjct: 313 ETLIEALSKAVSEETGRTPELSTGGGTSDARFIKNYCPVVEFGLVGQTMHKVDECVAVED 372

Query: 369 LEDLTCIYENFLQNWF 384
           L+ L  IY  FL ++F
Sbjct: 373 LDRLAAIYHRFLVSYF 388


>gi|298293966|ref|YP_003695905.1| succinyl-diaminopimelate desuccinylase [Starkeya novella DSM 506]
 gi|296930477|gb|ADH91286.1| succinyl-diaminopimelate desuccinylase [Starkeya novella DSM 506]
          Length = 397

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 198/396 (50%), Positives = 252/396 (63%), Gaps = 26/396 (6%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +E L  LI+CPS+TP++GGA   L + L+  GF++      + NT  V+NLYARFG +
Sbjct: 8   DPVEILRALIRCPSITPEEGGALAFLESLLRAAGFTVHRVKLTSPNTPDVENLYARFGDK 67

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF--- 120
            P+L FAGH DVVPPGD  HW +PPF   I +G IYGRG VDMKG +A FIAA   F   
Sbjct: 68  GPNLCFAGHTDVVPPGDPEHWRFPPFEGAIHDGLIYGRGAVDMKGGVAAFIAAGLDFAGA 127

Query: 121 --------IPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNH 172
                   +P     GSIS LITGDEEGPAINGT+K+L W+  + E+ D C++GEP+   
Sbjct: 128 NGWSGDGALP-----GSISFLITGDEEGPAINGTEKLLRWLADRDERIDHCVLGEPSSRA 182

Query: 173 IIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFS 232
            +GD +KIGRRGSLSG +T+HGKQGHV YPHL ENPI G++ LL  L     D G   F 
Sbjct: 183 ALGDMVKIGRRGSLSGSLTVHGKQGHVGYPHLAENPIPGMVKLLAGLQAEPLDRGTEHFQ 242

Query: 233 PTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSH 292
            +N+E+ ++DVGNP+ NVIPA+ +  FNIRFN+LW   TL  EI  RL     N      
Sbjct: 243 ASNLEVVSVDVGNPAFNVIPAEARARFNIRFNELWTPATLTAEIERRLKAAAGN------ 296

Query: 293 TVHFSSPVSP----VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVI 348
            V FS  + P     FLT   +   L+  +I   TG  P LST+GGTSDARFIKDYCPV+
Sbjct: 297 EVRFSLAIEPRNSDSFLTAPGEFVDLVVDAIATATGQKPELSTTGGTSDARFIKDYCPVV 356

Query: 349 EFGLVGRTMHALNENASLQDLEDLTCIYENFLQNWF 384
           EFGLVG TMH ++E   + ++E LT +Y   +  +F
Sbjct: 357 EFGLVGTTMHQVDEATPVDEVERLTDVYAGIIARYF 392


>gi|307943165|ref|ZP_07658510.1| succinyl-diaminopimelate desuccinylase [Roseibium sp. TrichSKD4]
 gi|307773961|gb|EFO33177.1| succinyl-diaminopimelate desuccinylase [Roseibium sp. TrichSKD4]
          Length = 391

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 200/376 (53%), Positives = 258/376 (68%), Gaps = 6/376 (1%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+CPSVTP++GGA   L +TL+  GF +E   F  ++T  V+NL+A  G+  PH +FAG
Sbjct: 14  LIRCPSVTPKEGGALNSLQSTLEAAGFKVERVTFSDQDTPDVENLFASIGSGKPHFVFAG 73

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFG-S 129
           H DVVPPGD + W++ PF+  IA G++YGRG VDMKG IA F AA   F+ +   +FG  
Sbjct: 74  HTDVVPPGDNSSWSHDPFAGDIAGGRLYGRGAVDMKGGIAAFAAAALWFVEENGTDFGGQ 133

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           IS LITGDEEGPA+NGT K+L W + +G  +DACIVGEPT    +GD IK+GRRGSLSG 
Sbjct: 134 ISFLITGDEEGPAVNGTAKLLDWAQSQGHVFDACIVGEPTNPDHLGDAIKVGRRGSLSGT 193

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           I + G QGH AYPHL +NPI GLI LL  L  +  D GN  F P+N+EI T+DVGN + N
Sbjct: 194 IEVTGTQGHAAYPHLADNPIPGLIKLLSGLDQMKLDDGNERFQPSNLEIVTVDVGNTAFN 253

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPK-LSHTVHFSSPVSPVFLTHD 308
           VIP +    FNIRFND W+   LK+++   L    Q  P+ L+ T+ F    S  FLT D
Sbjct: 254 VIPERATGKFNIRFNDEWDLAGLKDKVTGVL---QQAAPEGLNWTIEFKRDASEPFLTKD 310

Query: 309 RKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQD 368
           +KL   LS +I NT G  P LST GGTSDARFIK+YCPV+EFGLVG+TMH ++E+ ++ D
Sbjct: 311 QKLIETLSNAIENTVGRTPELSTGGGTSDARFIKNYCPVVEFGLVGQTMHKVDEHVAIAD 370

Query: 369 LEDLTCIYENFLQNWF 384
           L+ L  +Y  FL+++F
Sbjct: 371 LDQLAVVYSQFLKSYF 386


>gi|316932093|ref|YP_004107075.1| succinyl-diaminopimelate desuccinylase [Rhodopseudomonas palustris
           DX-1]
 gi|315599807|gb|ADU42342.1| succinyl-diaminopimelate desuccinylase [Rhodopseudomonas palustris
           DX-1]
          Length = 385

 Score =  388 bits (997), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 192/386 (49%), Positives = 246/386 (63%), Gaps = 4/386 (1%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT   LE    L++CPSVTP D GA  +L   LK  GF +    F    T+ + NLYAR 
Sbjct: 1   MTATALEIAQALLRCPSVTPADAGALGVLETLLKGAGFDVHRITFSEPGTADIDNLYARI 60

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT APHL FAGH DVVP GD + WT+  FS  +A+G +YGRG VDMKG IAC +AA   +
Sbjct: 61  GTSAPHLCFAGHTDVVPAGDTDAWTHDAFSGDVADGLLYGRGAVDMKGGIACAVAATLDY 120

Query: 121 IP--KYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           +   + K  GSIS LITGDEE  A+NGT K+L W  ++GEK+D CIVGEP+    IGDTI
Sbjct: 121 LAANEGKPKGSISFLITGDEEDVAVNGTVKLLQWAAERGEKFDHCIVGEPSNVEAIGDTI 180

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGS SG + + G QGHVAYPH   NP+  +  L+  L +   D G+  F P+N+E 
Sbjct: 181 KIGRRGSQSGVLIVDGTQGHVAYPHRAANPVPDIARLITALNDEPLDAGSAQFQPSNLEF 240

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           T++DVGNP+ NVIPAQ +  FNIRFND   + TLK  +  RL     N  ++   + +  
Sbjct: 241 TSVDVGNPATNVIPAQARAKFNIRFNDHHTQDTLKALVEQRLAAACGN--RIRARIEWLP 298

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
             + VF+T     T L+S SI + TG  P L+T GGTSDARFI  +CPV+EFGLVG+TMH
Sbjct: 299 SNADVFVTKPGAFTDLVSASIADVTGRTPDLNTGGGTSDARFIAKFCPVVEFGLVGQTMH 358

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E   + DL+ LT IY   L+ +F
Sbjct: 359 QIDERTPMSDLDKLTAIYRGVLERYF 384


>gi|254473705|ref|ZP_05087100.1| succinyl-diaminopimelate desuccinylase [Pseudovibrio sp. JE062]
 gi|211957091|gb|EEA92296.1| succinyl-diaminopimelate desuccinylase [Pseudovibrio sp. JE062]
          Length = 401

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 191/376 (50%), Positives = 249/376 (66%), Gaps = 4/376 (1%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            LI+CPSVTP +GGA   L N L   GF +    F  ++T  V+NL+A  G   PH +FA
Sbjct: 26  DLIRCPSVTPAEGGALSTLENLLAGAGFDVSRVTFTDEDTPDVENLFATIGKGKPHFVFA 85

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF--G 128
           GH DVVP GD   WT+ PF  TIA+G ++GRG  DMKG +A F AA   ++  + +   G
Sbjct: 86  GHTDVVPVGDEAAWTHGPFDGTIADGMLHGRGTADMKGGVAAFAAAALDYVKAHPDGIPG 145

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
            IS LITGDEEGPAINGT K+L W +++G ++DACIVGEPT   ++GD IK+GRRGSL+G
Sbjct: 146 QISFLITGDEEGPAINGTVKLLEWAKEQGHEFDACIVGEPTNPDVLGDAIKVGRRGSLTG 205

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
            I ++G QGHVAY HL +NP+ G++ LL  +  +  D GN  F P+N+EITT+DVGN + 
Sbjct: 206 TIKVNGTQGHVAYQHLADNPVPGMLKLLSAVAEVELDKGNERFQPSNLEITTVDVGNTAT 265

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHD 308
           NVIPA V   FNIRFND W+ K+L E +   L         L  ++ ++   +  FLTHD
Sbjct: 266 NVIPAHVMAKFNIRFNDQWSVKSLSEHVTKLLSDAAPE--GLDWSIEYAKEATDSFLTHD 323

Query: 309 RKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQD 368
             L   LS SI   TG  P LST GGTSDARFIK+YC V+EFGLVG+TMH ++E+ ++ D
Sbjct: 324 EALIQTLSNSIKTVTGRTPELSTGGGTSDARFIKNYCAVVEFGLVGQTMHKVDEHVAVAD 383

Query: 369 LEDLTCIYENFLQNWF 384
           +E L  IY  FLQ++F
Sbjct: 384 IEQLADIYLRFLQDYF 399


>gi|170749554|ref|YP_001755814.1| succinyl-diaminopimelate desuccinylase [Methylobacterium
           radiotolerans JCM 2831]
 gi|238064792|sp|B1M6P0|DAPE_METRJ RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|170656076|gb|ACB25131.1| succinyl-diaminopimelate desuccinylase [Methylobacterium
           radiotolerans JCM 2831]
          Length = 392

 Score =  385 bits (990), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 190/386 (49%), Positives = 253/386 (65%), Gaps = 6/386 (1%)

Query: 2   TPDCLEHLIQ-LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
            PD    L Q LI+CPSVTP+D GA  ++ + L+  GF+IE   F         NLYAR 
Sbjct: 7   APDAALRLAQDLIRCPSVTPEDRGALDVVADALRPAGFAIERPVFAEPGYPDTPNLYARI 66

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   P L+FAGH DVVP G+   W + PF+  +A+G +YGRG  DMKG +AC +AA   F
Sbjct: 67  GQNGPCLVFAGHTDVVPEGE-GAWRHDPFAGAVADGMLYGRGAADMKGGVACMLAATLAF 125

Query: 121 IPKY-KNFG-SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           + +   +FG SI+ LITGDEEGPA+NGT K+L W  ++GE++D C++GEPT    +G+ I
Sbjct: 126 LDRRGADFGGSIAFLITGDEEGPAVNGTVKLLDWARRRGERFDHCVLGEPTNPGRLGEMI 185

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGSL+G++T+ G+QGHVAYPH  ENPI GL+ L   L     D G   F  +N+E 
Sbjct: 186 KIGRRGSLTGKLTVLGRQGHVAYPHKAENPIPGLLRLASALIAEPLDRGTAHFDASNLEF 245

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           TT+DVGNP+ NVIP+  + +FN+RFND W  ++L  EIR RL +   N  + +  +  S+
Sbjct: 246 TTVDVGNPATNVIPSTARATFNVRFNDDWTAESLGAEIRRRLEQAAGNAVRFTLDLQPSN 305

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
             +P FLT      +L++++I   TG  P LST+GGTSDARFIKD CPVIEFGLVG TMH
Sbjct: 306 --APAFLTRPDAFVTLVAEAIRAETGLTPTLSTTGGTSDARFIKDACPVIEFGLVGETMH 363

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E  ++ DLE LT IY   L  +F
Sbjct: 364 QVDECVAVADLERLTAIYGRVLDAYF 389


>gi|323137570|ref|ZP_08072647.1| succinyl-diaminopimelate desuccinylase [Methylocystis sp. ATCC
           49242]
 gi|322397196|gb|EFX99720.1| succinyl-diaminopimelate desuccinylase [Methylocystis sp. ATCC
           49242]
          Length = 386

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 188/375 (50%), Positives = 245/375 (65%), Gaps = 4/375 (1%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            LI+CPSVTP D GA  ++  TLK +GF      F    T  + NL+A+ G  APHL FA
Sbjct: 13  DLIRCPSVTPADAGALDVVEKTLKAVGFETHRLTFSEPGTPDIDNLFAKIGAGAPHLAFA 72

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKN-FGS 129
           GH DVVP GD   W   PF+  IA+G+IYGRG  DMKG+IA F+AA   ++ K+    G+
Sbjct: 73  GHTDVVPTGDVARWRCDPFAGEIADGRIYGRGASDMKGAIAAFLAATLAYVEKHGAPKGA 132

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           IS LITGDEEGP+INGT K+L W   +GEK+D CIVGEPT    +GDTIKIGRRGSL+G 
Sbjct: 133 ISFLITGDEEGPSINGTVKLLEWARARGEKFDHCIVGEPTNVSALGDTIKIGRRGSLNGR 192

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           I + GKQGHVAYPH  ENP+  +  ++  L+   FD G T F  TN+E+++IDVGNP+ N
Sbjct: 193 IRVLGKQGHVAYPHRAENPVPVIARIVAALSAHEFDRGTTHFDRTNLEVSSIDVGNPAVN 252

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIPA+ +  FNIRFND W    L+E + S +++      K    V F    +  F+T   
Sbjct: 253 VIPAEARAQFNIRFNDAWTIPALQEHV-SAVVREAAGATKAE--VEFLPSNAISFITEPG 309

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDL 369
             T L+S ++ + TG  P LSTSGGTSDARFI  YCPV+EFGL   T+HA++EN S++D+
Sbjct: 310 DFTELVSHAVKDMTGVTPELSTSGGTSDARFITRYCPVVEFGLTNETIHAVDENVSVEDI 369

Query: 370 EDLTCIYENFLQNWF 384
           + L  +YE  +  +F
Sbjct: 370 DVLAAVYERIMTRYF 384


>gi|209965578|ref|YP_002298493.1| succinyl-diaminopimelate desuccinylase [Rhodospirillum centenum SW]
 gi|238064798|sp|B6IPH8|DAPE_RHOCS RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|209959044|gb|ACI99680.1| succinyl-diaminopimelate desuccinylase [Rhodospirillum centenum SW]
          Length = 386

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 192/385 (49%), Positives = 246/385 (63%), Gaps = 7/385 (1%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M PD +     LI+CPSVTP D GA   + + L+ LGF+     FQ   T  V NLYAR 
Sbjct: 1   MAPDPIALARDLIRCPSVTPADAGALDRVQSVLEGLGFTCHRLPFQEPGTERVDNLYARL 60

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G + P+  FAGH DVVP GD   WT  PF   I +G++YGRG  DMKG +A FIAAV  F
Sbjct: 61  GDKGPNFCFAGHTDVVPAGDAAAWTVDPFGGEIIDGRLYGRGAADMKGGVAAFIAAVGSF 120

Query: 121 IPKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + +     GSISLLITGDEEGPA+NGT+K+L W+   GE+ DAC+VGEPT    +GD IK
Sbjct: 121 LERNGPPAGSISLLITGDEEGPAVNGTRKVLDWMAAAGERIDACLVGEPTNPRALGDMIK 180

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           +GRRGSL+  +T  G QGH AYPHL +NP+  L   LH L +   D G   F P+ + +T
Sbjct: 181 VGRRGSLTATLTALGAQGHTAYPHLADNPLPRLAEALHLLASSPLDMGTPHFQPSTLALT 240

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           +IDVGNP+ NVIPA+    FNIRFNDL   ++L+  IR  L    + V         +S 
Sbjct: 241 SIDVGNPASNVIPARGTARFNIRFNDLHTPESLEAHIRDVL----EEVGGAWELALQTSG 296

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
           V+  FLT    L+ +++ ++   TG  P LSTSGGTSDARFIKD+CPV+EFGLVG +MH 
Sbjct: 297 VA--FLTPPGALSDIVAAAVEAHTGRTPELSTSGGTSDARFIKDHCPVVEFGLVGASMHK 354

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           ++EN ++ DL +LT IY   L+ WF
Sbjct: 355 VDENVAVADLLELTAIYRTVLERWF 379


>gi|118589725|ref|ZP_01547130.1| succinyl-diaminopimelate desuccinylase [Stappia aggregata IAM
           12614]
 gi|118437811|gb|EAV44447.1| succinyl-diaminopimelate desuccinylase [Stappia aggregata IAM
           12614]
          Length = 390

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 197/376 (52%), Positives = 259/376 (68%), Gaps = 4/376 (1%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            LI+CPSVTP +GGA   L   L  +GF++    FQ ++T  V+NL+A  G+ APH +FA
Sbjct: 11  DLIRCPSVTPAEGGALASLEALLGKVGFNVSRVTFQDEDTPDVENLFASIGSGAPHFVFA 70

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIP-KYKNFG- 128
           GH DVVP G  + W + PF   I  G ++GRG VDMKG IA F AA   ++  K  +FG 
Sbjct: 71  GHTDVVPAGAESDWRHGPFEGAIDNGMLFGRGAVDMKGGIAAFAAAALDYVAEKGPDFGG 130

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           +IS LITGDEEGPA+NGT K+L W + +G  +DACIVGEPT    +GD IK+GRRGSLSG
Sbjct: 131 TISFLITGDEEGPAVNGTVKLLQWAKDQGHVFDACIVGEPTNPDKLGDAIKVGRRGSLSG 190

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
            IT+ G QGHVAYPHL ENPI GL+ LL  L  +  D GN  F P+N+EI ++DVGNP+ 
Sbjct: 191 TITVRGVQGHVAYPHLAENPIPGLVRLLAALDALELDQGNERFQPSNLEIVSVDVGNPAF 250

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHD 308
           NVIPA+ +  FNIR+ND W  ++LK  I ++ ++G++ + KL+  + F    S  FLT D
Sbjct: 251 NVIPARAEARFNIRYNDEWTLESLKARI-TQTLEGVE-LGKLALALEFKRDSSESFLTRD 308

Query: 309 RKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQD 368
             L   LSK++   TG +P LST GGTSDARFIKDYCPV+EFGLVG+TMH ++E  +++D
Sbjct: 309 EVLIEALSKAVEAETGRVPELSTGGGTSDARFIKDYCPVVEFGLVGQTMHKVDECVAVED 368

Query: 369 LEDLTCIYENFLQNWF 384
           L+ L  IY+ FL ++F
Sbjct: 369 LDRLAAIYKKFLLSYF 384


>gi|238064819|sp|B8IFQ0|DAPE_METNO RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 396

 Score =  379 bits (972), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 201/385 (52%), Positives = 253/385 (65%), Gaps = 4/385 (1%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           TP  L     LI+CPSVTP +GGA  +L + L   GFS+E   F    T  V+NLYAR G
Sbjct: 4   TPSPLALTQGLIRCPSVTPAEGGALSLLADLLGAAGFSVERPVFSEPGTPDVENLYARIG 63

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
           T  P L+ AGH DVVPPGD   W + PF   + EG+++GRG VDMKG IAC  AA+  F+
Sbjct: 64  TAGPCLLLAGHTDVVPPGDLAAWRHDPFGGVVEEGEVHGRGAVDMKGGIACLAAAILAFL 123

Query: 122 -PKYKNFG-SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
             +  +FG SI+ LITGDEEGPA+NGT K+L+W  +KGE++D CI+ EPT    +GD IK
Sbjct: 124 AERGPDFGGSIAFLITGDEEGPAVNGTVKLLAWARQKGERFDHCILAEPTNPDRLGDMIK 183

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGSL+  +T+HG QGHVAYPH  ENPI GLI L   L     D G   F  +N+E T
Sbjct: 184 IGRRGSLTAALTVHGVQGHVAYPHRAENPIPGLIRLAGALLAAPLDAGTAHFDASNLEFT 243

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           T+DVGNP+ NVIPA+ +  FNIRFNDLW   TL+ E+R RL     N  + +  V  ++ 
Sbjct: 244 TVDVGNPASNVIPAEARAVFNIRFNDLWTPATLEAELRRRLDAAAGNAVRYTLAVQPTNA 303

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
           V+  FLT       L++ +I   TG  P LST+GGTSDARFIKD CPVIEFGLVG+TMH 
Sbjct: 304 VA--FLTQPDPFVDLVTAAIEAETGRRPALSTTGGTSDARFIKDACPVIEFGLVGQTMHQ 361

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           ++E A+L DL+ LT I+   L  +F
Sbjct: 362 IDERAALADLDRLTAIFRRVLDAYF 386


>gi|220924611|ref|YP_002499913.1| succinyl-diaminopimelate desuccinylase [Methylobacterium nodulans
           ORS 2060]
 gi|219949218|gb|ACL59610.1| succinyl-diaminopimelate desuccinylase [Methylobacterium nodulans
           ORS 2060]
          Length = 410

 Score =  378 bits (971), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 201/385 (52%), Positives = 253/385 (65%), Gaps = 4/385 (1%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           TP  L     LI+CPSVTP +GGA  +L + L   GFS+E   F    T  V+NLYAR G
Sbjct: 18  TPSPLALTQGLIRCPSVTPAEGGALSLLADLLGAAGFSVERPVFSEPGTPDVENLYARIG 77

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
           T  P L+ AGH DVVPPGD   W + PF   + EG+++GRG VDMKG IAC  AA+  F+
Sbjct: 78  TAGPCLLLAGHTDVVPPGDLAAWRHDPFGGVVEEGEVHGRGAVDMKGGIACLAAAILAFL 137

Query: 122 -PKYKNFG-SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
             +  +FG SI+ LITGDEEGPA+NGT K+L+W  +KGE++D CI+ EPT    +GD IK
Sbjct: 138 AERGPDFGGSIAFLITGDEEGPAVNGTVKLLAWARQKGERFDHCILAEPTNPDRLGDMIK 197

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGSL+  +T+HG QGHVAYPH  ENPI GLI L   L     D G   F  +N+E T
Sbjct: 198 IGRRGSLTAALTVHGVQGHVAYPHRAENPIPGLIRLAGALLAAPLDAGTAHFDASNLEFT 257

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           T+DVGNP+ NVIPA+ +  FNIRFNDLW   TL+ E+R RL     N  + +  V  ++ 
Sbjct: 258 TVDVGNPASNVIPAEARAVFNIRFNDLWTPATLEAELRRRLDAAAGNAVRYTLAVQPTNA 317

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
           V+  FLT       L++ +I   TG  P LST+GGTSDARFIKD CPVIEFGLVG+TMH 
Sbjct: 318 VA--FLTQPDPFVDLVTAAIEAETGRRPALSTTGGTSDARFIKDACPVIEFGLVGQTMHQ 375

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           ++E A+L DL+ LT I+   L  +F
Sbjct: 376 IDERAALADLDRLTAIFRRVLDAYF 400


>gi|86747802|ref|YP_484298.1| succinyl-diaminopimelate desuccinylase [Rhodopseudomonas palustris
           HaA2]
 gi|123408898|sp|Q2J2C3|DAPE_RHOP2 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|86570830|gb|ABD05387.1| succinyldiaminopimelate desuccinylase [Rhodopseudomonas palustris
           HaA2]
          Length = 389

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 186/390 (47%), Positives = 245/390 (62%), Gaps = 8/390 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT   LE    L++CPSVTP D GA  +L   L+  GF+     F    T+ + NLYAR 
Sbjct: 1   MTATALEIAQALLRCPSVTPADAGALGVLEALLQDAGFATHRVTFSEPGTADIDNLYARI 60

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G  APHL FAGH DVVPPG+   W++  F+  +  G +YGRG VDMKG IAC +AA   +
Sbjct: 61  GDGAPHLCFAGHTDVVPPGEETAWSHGAFAGDVEGGLLYGRGAVDMKGGIACAVAATLDY 120

Query: 121 I------PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHII 174
           +      P+    GSIS LITGDEE  A+NGT K+L W  ++GE++D CIVGEP+    I
Sbjct: 121 LAANGGQPQQSGKGSISFLITGDEEDVAVNGTVKLLQWAAERGERFDHCIVGEPSNVEAI 180

Query: 175 GDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPT 234
           GDTIKIGRRGS SG + + G+QGHVAYPH   NPI  +  L+  L +   D G+  F P+
Sbjct: 181 GDTIKIGRRGSQSGVLIVDGRQGHVAYPHRASNPIPDIATLITALNDEPLDQGSAQFQPS 240

Query: 235 NMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTV 294
           N+E T++DVGNP+ NVIPAQ +  FNIRFND   ++TL+  +  RL     N  ++   +
Sbjct: 241 NLEFTSVDVGNPATNVIPAQARAKFNIRFNDHHTQETLRALVEQRLAAACGN--RIRARI 298

Query: 295 HFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVG 354
            +    + VF+T     T L+S +I + TG  P L+T GGTSDARFI  YCPV+EFGLVG
Sbjct: 299 EWLPSNADVFVTKPGGFTDLVSAAIADITGRSPDLNTGGGTSDARFIAKYCPVVEFGLVG 358

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNWF 384
           +TMH ++E   + DL+ LT IY   L+ +F
Sbjct: 359 QTMHQIDERTPVSDLDKLTAIYRGVLERYF 388


>gi|192289058|ref|YP_001989663.1| succinyl-diaminopimelate desuccinylase [Rhodopseudomonas palustris
           TIE-1]
 gi|238064799|sp|B3QCH4|DAPE_RHOPT RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|192282807|gb|ACE99187.1| succinyl-diaminopimelate desuccinylase [Rhodopseudomonas palustris
           TIE-1]
          Length = 387

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 186/385 (48%), Positives = 243/385 (63%), Gaps = 4/385 (1%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           TP  L     L++CPSVTP D GA  +L   LK  GF++    F    T+ + NLYAR G
Sbjct: 4   TPTALSIAQDLLRCPSVTPADAGALDVLETLLKGAGFTVHRVTFSEPGTADIDNLYARIG 63

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
             +PHL FAGH DVVPPGD + WT+  F+  +A+G +YGRG VDMKG IAC +AA   ++
Sbjct: 64  NTSPHLCFAGHTDVVPPGDASAWTHGAFAGDVADGLLYGRGAVDMKGGIACAVAATLDYL 123

Query: 122 PKY--KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
                +  GSIS LITGDEE  A+NGT K+L W  ++GE++D CIVGEP+    IGDTIK
Sbjct: 124 AANGGQPKGSISFLITGDEEDVAVNGTVKLLQWAAERGEQFDHCIVGEPSNVETIGDTIK 183

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGS SG + + G QGHVAYPH   NP+  +  L+  L +   D G+  F P+N+E T
Sbjct: 184 IGRRGSQSGVLIVDGVQGHVAYPHRAANPVPDIARLITTLNDEPLDHGSAQFQPSNLEFT 243

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           ++DVGNP+ NVIPAQ +  FNIRFND   ++TLK  +  RL     N  ++   + +   
Sbjct: 244 SVDVGNPATNVIPAQARAKFNIRFNDHHTQETLKALVEQRLAAACGN--RIRAHIEWLPS 301

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
            + VF+T     T L+  +I   TG  P L+T GGTSDARFI  YC V+EFGLVG+TMH 
Sbjct: 302 NADVFVTKPGAFTDLVGAAIAEVTGRTPELNTGGGTSDARFIAKYCQVVEFGLVGQTMHQ 361

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           ++E   + DL+ LT IY   LQ +F
Sbjct: 362 IDERTPVSDLDKLTAIYRGVLQRYF 386


>gi|148258518|ref|YP_001243103.1| succinyl-diaminopimelate desuccinylase [Bradyrhizobium sp. BTAi1]
 gi|238055174|sp|A5ESQ3|DAPE_BRASB RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|146410691|gb|ABQ39197.1| succinyldiaminopimelate desuccinylase [Bradyrhizobium sp. BTAi1]
          Length = 384

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 186/383 (48%), Positives = 242/383 (63%), Gaps = 4/383 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D L     LI+CPSVTP D GA  +L   LK  GF+     F    T+ + NLYAR GTE
Sbjct: 3   DALTITRDLIRCPSVTPADAGALGVLEALLKQAGFTTHRITFSEAGTADIDNLYARIGTE 62

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PH+ FAGH DVVPPGD   W+ P FS  + +G IYGRG VDMKG IAC +AA   ++  
Sbjct: 63  GPHITFAGHTDVVPPGDEAAWSLPAFSGEVRDGYIYGRGAVDMKGGIACSVAAALDYLRD 122

Query: 124 YKNF--GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
           +     GSIS LITGDEE  +INGT K+L W  ++GEK+D C++GEP+   ++GD IKIG
Sbjct: 123 HDGQPKGSISFLITGDEEDVSINGTIKLLQWAAERGEKFDHCVLGEPSNQEVMGDCIKIG 182

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGS SG + + G+QGHVAYPH  ENP+  +  L+  L++   D G+  F P+N+E T++
Sbjct: 183 RRGSQSGTLIVEGRQGHVAYPHRAENPVPDISRLIVALSDEPLDHGSAQFQPSNLEFTSV 242

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
           DVGN + NVIP   +  FNIR+ND   + +L+  +  RL K   N  ++   + +    S
Sbjct: 243 DVGNTASNVIPGLARAKFNIRYNDCHTQDSLRALVEERLAKACGN--RIRAHIDWLPSNS 300

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALN 361
            VFLT     T L   +I + TG  P LST+GGTSDARFI  YCPVIEFGLVG+TMH ++
Sbjct: 301 KVFLTKPGPFTDLAVAAIESVTGRKPELSTTGGTSDARFIASYCPVIEFGLVGQTMHQID 360

Query: 362 ENASLQDLEDLTCIYENFLQNWF 384
           E AS+ D+  LT IY   L  +F
Sbjct: 361 ERASVADIATLTKIYRGILDRYF 383


>gi|300021567|ref|YP_003754178.1| succinyl-diaminopimelate desuccinylase [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299523388|gb|ADJ21857.1| succinyl-diaminopimelate desuccinylase [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 390

 Score =  375 bits (963), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 187/377 (49%), Positives = 244/377 (64%), Gaps = 4/377 (1%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+C SVTP +GGA  +L N L+  GF+     F    T  V NLYAR G+  PHL FAG
Sbjct: 15  LIRCESVTPDEGGALTLLQNVLEPAGFTCHRLVFSEPGTPDVDNLYARLGSGRPHLSFAG 74

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF--GS 129
           H DVVP GD   WT PPFS  I +GK+YGRG VDMKG +A F++A  ++I  +     GS
Sbjct: 75  HTDVVPVGDEKVWTVPPFSGDIRDGKVYGRGAVDMKGCVAAFVSAALKYIHHHNGLPRGS 134

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           +S LITGDEEGP+INGT K+L W++ + E  DAC+VGEP+    +GD I+IGRRGS++ E
Sbjct: 135 LSFLITGDEEGPSINGTMKILDWLKSRDEVVDACLVGEPSNPKALGDEIRIGRRGSVNAE 194

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           I +HGKQGH AYP L +NP+  L  L+ +L+    D G   F P+N+++T I V N + N
Sbjct: 195 IVVHGKQGHSAYPQLADNPVPKLARLIDRLSTAKLDDGTPDFQPSNLQVTVISVPNTATN 254

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP Q     NIR+NDLW+  T++  +R +L      V    + V FS     VFLT   
Sbjct: 255 VIPGQAVAKINIRYNDLWHRPTIEAWVRDKLAHAAAEV-GAKYEVSFSG-TGDVFLTKPG 312

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDL 369
            L S L+ ++ + TG IP L+T GGTSDARFIKD CPV+EFGLV  T+H ++E+ S+ DL
Sbjct: 313 PLVSTLTDAVQSVTGRIPKLTTGGGTSDARFIKDICPVVEFGLVNATIHQVDEHTSIVDL 372

Query: 370 EDLTCIYENFLQNWFIT 386
           E LT IY  F+ N+F T
Sbjct: 373 EQLTEIYGRFITNYFRT 389


>gi|288957349|ref|YP_003447690.1| succinyl-diaminopimelate desuccinylase [Azospirillum sp. B510]
 gi|288909657|dbj|BAI71146.1| succinyl-diaminopimelate desuccinylase [Azospirillum sp. B510]
          Length = 390

 Score =  375 bits (963), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 191/384 (49%), Positives = 251/384 (65%), Gaps = 7/384 (1%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT D +     LI+CPSVTP+D GA  +L   L  +GF+     FQ + T  V+NLYAR 
Sbjct: 9   MTIDPVALAQDLIRCPSVTPRDDGALGVLEAALTPMGFTCHRLRFQQEGTEPVENLYARL 68

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GTE P+  FAGH DVVPPGD   WT  PF+  +  G+++GRG VDMKG+IA F+AAV+R 
Sbjct: 69  GTEGPNFCFAGHTDVVPPGD-RGWTVDPFAGAVMGGRLFGRGAVDMKGAIAAFVAAVSRR 127

Query: 121 IPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
           +      GSISLLITGDEEG A+NGT+K+L W+ ++GE+ DAC+VGEPT    +GD IKI
Sbjct: 128 LQDGPPAGSISLLITGDEEGVAVNGTRKVLDWMTERGERIDACVVGEPTNPKALGDMIKI 187

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGSL+G +T+ G QGHVAYPHL +NP+  L+ +L  +T    D G   F P+ + +TT
Sbjct: 188 GRRGSLTGFLTVFGAQGHVAYPHLADNPLPRLVRMLAAITEQPMDEGTEHFQPSTLALTT 247

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV 300
           IDV N + NVIPAQ K +FNIRFND      ++  +R R    +    +L       S  
Sbjct: 248 IDVDNAATNVIPAQGKATFNIRFNDAHTPAGIEAWLR-RTFDAVGGAYELEVYCSGDS-- 304

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL 360
              F+T    LT L+++++   TG  P  ST+GGTSDARFIK+ CPV+EFGLVG+TMH +
Sbjct: 305 ---FVTPPGPLTELVAEAVEGVTGRRPDYSTTGGTSDARFIKNVCPVVEFGLVGQTMHKV 361

Query: 361 NENASLQDLEDLTCIYENFLQNWF 384
           +E  S++DL  LT IYE+ L   F
Sbjct: 362 DEYCSVEDLRQLTAIYESILTGVF 385


>gi|91974559|ref|YP_567218.1| succinyl-diaminopimelate desuccinylase [Rhodopseudomonas palustris
           BisB5]
 gi|123735883|sp|Q13F22|DAPE_RHOPS RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|91681015|gb|ABE37317.1| succinyldiaminopimelate desuccinylase [Rhodopseudomonas palustris
           BisB5]
          Length = 388

 Score =  375 bits (962), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 187/383 (48%), Positives = 239/383 (62%), Gaps = 4/383 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D L     L++CPSVTP D GA  +L   LK  GF+     F     + + NLYAR G  
Sbjct: 6   DALSIAQALLRCPSVTPADAGALGVLETLLKDAGFTAHRVTFSEPGAADIDNLYARIGDG 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
           APHL FAGH DVVPPGD + W++  FS  +  G +YGRG VDMKG IAC +AAV   +  
Sbjct: 66  APHLCFAGHTDVVPPGDADAWSHGAFSGDVEGGLLYGRGAVDMKGGIACAVAAVLDHLAA 125

Query: 124 Y--KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
           +  +  GSIS LITGDEE  A+NGT K+L W   +GE +D CIVGEP+    IGDTIKIG
Sbjct: 126 HGGRPKGSISFLITGDEEDVAVNGTVKLLQWAADRGETFDHCIVGEPSNVEAIGDTIKIG 185

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGS SG + + G QGHVAYPH   NPI  +  L+  L +   D G+  F P+N+E T++
Sbjct: 186 RRGSQSGMLIVDGLQGHVAYPHRASNPIPDIAALITALNDEPLDQGSAQFQPSNLEFTSV 245

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
           DVGNP+ NVIPAQ +  FNIRFND   + +LK  I  RL     N  ++   + +    +
Sbjct: 246 DVGNPATNVIPAQARAKFNIRFNDHHTQDSLKALIEQRLAAACGN--RIRARIEWLPSNA 303

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALN 361
            VF+T     T L++ SI + TG  P L+T GGTSDARFI  YCPV+EFGLVG+TMH ++
Sbjct: 304 DVFVTKPGNFTDLVTASIADVTGRTPDLNTGGGTSDARFIAKYCPVVEFGLVGQTMHQID 363

Query: 362 ENASLQDLEDLTCIYENFLQNWF 384
           E   + DL+ LT IY   L+ +F
Sbjct: 364 ERTPVADLDQLTAIYRGVLERYF 386


>gi|85717148|ref|ZP_01048107.1| succinyl-diaminopimelate desuccinylase [Nitrobacter sp. Nb-311A]
 gi|85696039|gb|EAQ33938.1| succinyl-diaminopimelate desuccinylase [Nitrobacter sp. Nb-311A]
          Length = 389

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 185/390 (47%), Positives = 244/390 (62%), Gaps = 8/390 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  + L     L++CPSVTP D GA  +L   LK  GF +    F     + + NLYAR 
Sbjct: 1   MENNALSIARDLVRCPSVTPADAGALGVLETLLKGAGFDVHRITFSEPGAADIDNLYARI 60

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT  PH+ FAGH DVVPPGD + WT   FS  + +G +YGRG VDMKG IAC +AA   +
Sbjct: 61  GTTGPHIAFAGHTDVVPPGDESAWTRGAFSGDVVDGFLYGRGAVDMKGGIACGVAAALDY 120

Query: 121 I------PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHII 174
           +      P     GSIS LITGDEE  A+NGT K++ W + +GEK+D C++GEP+    +
Sbjct: 121 LAAHGGQPGKDGNGSISFLITGDEEDIAVNGTVKLMQWADARGEKFDHCVLGEPSNVEEL 180

Query: 175 GDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPT 234
           GD IKIGRRGS SG + + G QGHVAYPH   NPI  +  L+  L +   D G+  F P+
Sbjct: 181 GDCIKIGRRGSQSGTLYVDGVQGHVAYPHRASNPIPDIAALITALVSEPLDQGSAQFQPS 240

Query: 235 NMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTV 294
           N+E T++DVGNP+ NVIP Q +  FNIRFND  ++++L+  I +R+ K   N  ++   +
Sbjct: 241 NLEFTSVDVGNPAANVIPGQARAKFNIRFNDHHSQESLRALIEARVAKASGN--RIRTRI 298

Query: 295 HFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVG 354
            +    + VFLT     T L++ ++ + TG  P LST GGTSDARFIKDYCPVIEFGLVG
Sbjct: 299 VWEPSNADVFLTKPGPFTDLVAAAVEDVTGRRPELSTGGGTSDARFIKDYCPVIEFGLVG 358

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNWF 384
           +TMH ++E   + DLE LT IY   L  +F
Sbjct: 359 QTMHQIDERTPVTDLERLTRIYRGVLDRYF 388


>gi|83312973|ref|YP_423237.1| succinyl-diaminopimelate desuccinylase [Magnetospirillum magneticum
           AMB-1]
 gi|123540742|sp|Q2W0E7|DAPE_MAGMM RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|82947814|dbj|BAE52678.1| Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase
           and related deacylase [Magnetospirillum magneticum
           AMB-1]
          Length = 379

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 191/370 (51%), Positives = 246/370 (66%), Gaps = 11/370 (2%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+CPSVTP+D GA  +L   L+ LGF+       T    I +NLYAR GTEAP+L FAG
Sbjct: 13  LIRCPSVTPEDAGALDVLAGALEELGFACHHIRSATGGPEI-RNLYARLGTEAPNLCFAG 71

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSIS 131
           H DVVPPG    WT  PF+A I +G+++GRG  DMKG+IACF+AAVAR +      GS+S
Sbjct: 72  HTDVVPPG--KGWTVEPFAAGIDQGRLFGRGSADMKGAIACFVAAVARLLEDGAPKGSLS 129

Query: 132 LLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEIT 191
           LLITGDEEGPA++GT K+L W+  +GE+ D CIVGEPT    +GD +KIGRRGSL+  +T
Sbjct: 130 LLITGDEEGPAVDGTVKVLDWLAARGERIDCCIVGEPTNPRKLGDMMKIGRRGSLNCRLT 189

Query: 192 IHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVI 251
           + G QGH AYPHL +NPI  L+ +L +LT    D G   F  + + +TT+DVGNP+ NVI
Sbjct: 190 VFGTQGHSAYPHLADNPIPRLLDILRRLTEAPLDEGTPHFQASTLALTTVDVGNPATNVI 249

Query: 252 PAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS-PVFLTHDRK 310
           PA+ +  FNIRFNDL +  +L+  IR         V +    V     VS   FLT    
Sbjct: 250 PAEARAGFNIRFNDLHSGASLERWIR-------DTVAQAGGEVEIKVEVSGESFLTPPGA 302

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDLE 370
           L+  L+++ +  TG  P LSTSGGTSDARFIK++CPV+EFGLVG+TMH  +E+ S+ D+E
Sbjct: 303 LSDALAEAAFEVTGLRPELSTSGGTSDARFIKNHCPVVEFGLVGQTMHKSDEHVSVADME 362

Query: 371 DLTCIYENFL 380
            LT IY   L
Sbjct: 363 ALTEIYRRVL 372


>gi|39933701|ref|NP_945977.1| succinyl-diaminopimelate desuccinylase [Rhodopseudomonas palustris
           CGA009]
 gi|81564119|sp|Q6NC49|DAPE_RHOPA RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|39647547|emb|CAE26068.1| putative succinyl-diaminopimelate desuccinylase [Rhodopseudomonas
           palustris CGA009]
          Length = 387

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 184/385 (47%), Positives = 243/385 (63%), Gaps = 4/385 (1%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           TP  L     L++CPSVTP D GA  +L   LK  GF++    F    T+ + NLYAR G
Sbjct: 4   TPTALSIAQDLLRCPSVTPADAGALDVLETLLKGAGFTVHRVTFSEPGTADIDNLYARIG 63

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
             +PHL FAGH DVVPPGD + WT+  F+  +A+G +YGRG VDMKG IAC +AA   ++
Sbjct: 64  NTSPHLCFAGHTDVVPPGDASAWTHGAFAGDVADGLLYGRGAVDMKGGIACAVAATLDYL 123

Query: 122 PKY--KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
                +  GSIS LITGDEE  A+NGT K+L W  ++GE++D CIVGEP+    IGDTIK
Sbjct: 124 AANGGQPKGSISFLITGDEEDVAVNGTVKLLQWAAERGEQFDHCIVGEPSNVETIGDTIK 183

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGS SG + + G QGHVAYPH   NP+  +  L+  L +   D G+  F P+N+E T
Sbjct: 184 IGRRGSQSGVLIVDGVQGHVAYPHRAANPVPDIAKLITALNDEPLDHGSAQFQPSNLEFT 243

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           ++DVGNP+ NVIPAQ +  FNIRFND   ++TLK  +  RL+    N  ++   + +   
Sbjct: 244 SVDVGNPATNVIPAQARAKFNIRFNDHHTQETLKALVEHRLVAACGN--RIRAHIEWLPS 301

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
            + VF+T     T L+  +I   T   P L+T GGTSDARFI  YC V+EFGLVG+TMH 
Sbjct: 302 NADVFVTKPGAFTDLVGAAIAEVTRRTPELNTGGGTSDARFIAKYCQVVEFGLVGQTMHQ 361

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           ++E   + DL+ LT IY   L+ +F
Sbjct: 362 IDERTPVSDLDKLTAIYRGVLERYF 386


>gi|90422329|ref|YP_530699.1| succinyl-diaminopimelate desuccinylase [Rhodopseudomonas palustris
           BisB18]
 gi|122477312|sp|Q21B56|DAPE_RHOPB RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|90104343|gb|ABD86380.1| succinyldiaminopimelate desuccinylase [Rhodopseudomonas palustris
           BisB18]
          Length = 392

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 184/387 (47%), Positives = 242/387 (62%), Gaps = 8/387 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D L     L++CPSVTP D GA  +L   L   GF++    F    T+ + NLYAR GT 
Sbjct: 7   DALAIAQDLLRCPSVTPADAGALGVLERLLHAAGFAVHRVTFSEPGTADIDNLYARIGTT 66

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI-- 121
           APH+ FAGH DVVPPGD   W++  F+  + +G +YGRG VDMKG IAC +AAV + +  
Sbjct: 67  APHICFAGHTDVVPPGDEAAWSHDAFAGEVHDGLLYGRGAVDMKGGIACSVAAVLQHLAT 126

Query: 122 ----PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDT 177
               P     GSIS LITGDEE  A+NGT K+L W   +GE +D C++GEP+    +GDT
Sbjct: 127 HGGQPHESGQGSISFLITGDEEDVAVNGTVKLLQWAAARGETFDHCVLGEPSNVEALGDT 186

Query: 178 IKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNME 237
           IKIGRRGSLSG + + G QGHVAYPH   NP+  +  L+  L     D G  TF P+N+E
Sbjct: 187 IKIGRRGSLSGTLIVDGVQGHVAYPHRASNPVPDIAALIVALGAEPLDAGTDTFQPSNLE 246

Query: 238 ITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFS 297
            T++DVGNP+ NVIPAQ +  FNIRFND  + ++L+  I +R+     N  ++   + + 
Sbjct: 247 FTSVDVGNPATNVIPAQARAKFNIRFNDRHSAESLQTLIEARVQAACGN--RIRARIDWQ 304

Query: 298 SPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTM 357
              +  F+T     T L++ +I + TG  P L+T GGTSDARFI  YCPVIEFGLVG+TM
Sbjct: 305 PSNAGAFVTKPGAFTDLVAAAIEDVTGRKPELNTGGGTSDARFITHYCPVIEFGLVGQTM 364

Query: 358 HALNENASLQDLEDLTCIYENFLQNWF 384
           H ++E   + DLE LT IY   LQ +F
Sbjct: 365 HKIDERTPVADLETLTQIYRGVLQRYF 391


>gi|75677247|ref|YP_319668.1| succinyl-diaminopimelate desuccinylase [Nitrobacter winogradskyi
           Nb-255]
 gi|123612579|sp|Q3SN25|DAPE_NITWN RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|74422117|gb|ABA06316.1| succinyldiaminopimelate desuccinylase [Nitrobacter winogradskyi
           Nb-255]
          Length = 389

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 184/390 (47%), Positives = 242/390 (62%), Gaps = 8/390 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D L     LI+CPSVTP D GA  +L   LK  GF +    F     + + NLYAR 
Sbjct: 1   MGNDALSIARDLIRCPSVTPADAGALGVLEPLLKNAGFDVHRITFSEPGVADIDNLYARI 60

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G+  PH+ FAGH DVVPPGD   WT   FS  + +G +YGRG VDMKG +AC +AA   +
Sbjct: 61  GSGRPHIAFAGHTDVVPPGDEAAWTRGAFSGDVVDGFLYGRGAVDMKGGVACGVAAALDY 120

Query: 121 I------PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHII 174
           +      P     GSIS LITGDEE  A+NGT K+L W   +GEK+D C++GEP+    +
Sbjct: 121 LAAHGGRPGKDGSGSISFLITGDEEDIAVNGTVKLLQWAAARGEKFDHCVLGEPSNVEEL 180

Query: 175 GDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPT 234
           GD IKIGRRGS SG + + G QGHVAYPH   NPI  +  L+  L +   D G++ F P+
Sbjct: 181 GDCIKIGRRGSQSGTLYVDGVQGHVAYPHRASNPIPEIAALITALVSEPLDQGSSQFQPS 240

Query: 235 NMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTV 294
           N+E T++DVGNP+ NVIP Q +  FNIRFND  ++++L+  + +R+     N  ++   +
Sbjct: 241 NLEFTSVDVGNPAANVIPGQARARFNIRFNDHHDQQSLRALVEARVAGASGN--RVRTRI 298

Query: 295 HFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVG 354
            +    + VFLT     T L++ ++ + TG  P LST GGTSDARFIKDYCPVIEFGLVG
Sbjct: 299 VWEPSNADVFLTEPGPFTDLVAAAVEDVTGRRPELSTGGGTSDARFIKDYCPVIEFGLVG 358

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNWF 384
           RTMH ++E   + DLE LT +Y   L  +F
Sbjct: 359 RTMHQIDERVPIADLEKLTRVYRGVLDRYF 388


>gi|115522680|ref|YP_779591.1| succinyl-diaminopimelate desuccinylase [Rhodopseudomonas palustris
           BisA53]
 gi|122297687|sp|Q07TX3|DAPE_RHOP5 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|115516627|gb|ABJ04611.1| succinyldiaminopimelate desuccinylase [Rhodopseudomonas palustris
           BisA53]
          Length = 387

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 185/385 (48%), Positives = 243/385 (63%), Gaps = 4/385 (1%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           TPD L     L++CPSVTP D GA  +L   L+  GF +    F     + + NLYAR G
Sbjct: 4   TPDALSIARDLLRCPSVTPADAGALDVLDRLLRGAGFEVHRVTFSEPGAADIDNLYARIG 63

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
           T APHLMFAGH DVVPPGD + W++  F+  +A+G++YGRG VDMKG IAC +AAV  ++
Sbjct: 64  TGAPHLMFAGHTDVVPPGDVSAWSHGAFAGEVADGQLYGRGAVDMKGGIACAVAAVLVYL 123

Query: 122 PKY--KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
                +  GSIS LITGDEE  A+NGT K+L W + +GE +D CIVGEP+    +GD IK
Sbjct: 124 AACGGQPKGSISFLITGDEEDIAVNGTVKLLQWADARGENFDHCIVGEPSNVEELGDCIK 183

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGSLSG + + G QGHVAYP    NP+  +  L+  L++   D G   F P+N+E T
Sbjct: 184 IGRRGSLSGTLIVDGVQGHVAYPQRAVNPVPDIATLIVALSHEPLDHGTAQFQPSNLEFT 243

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           ++DVGN + NVIPAQ +  FNIRFND  + K+L+  I   L     N  ++   + +   
Sbjct: 244 SVDVGNAATNVIPAQARAKFNIRFNDQHSIKSLQALIEHHLAAACGN--RIRARIEWLPS 301

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
            +  F+T     T L++ +I   TG  P L+T GGTSDARFI  YCPVIEFGLVG+TMH 
Sbjct: 302 NAGAFVTKPGPFTDLVTAAIEQVTGRRPELNTGGGTSDARFITHYCPVIEFGLVGQTMHK 361

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           ++E   + DLE LT IY   L+ +F
Sbjct: 362 VDERTPVSDLEKLTAIYRGVLERYF 386


>gi|146337889|ref|YP_001202937.1| succinyl-diaminopimelate desuccinylase [Bradyrhizobium sp. ORS278]
 gi|238055175|sp|A4YLC3|DAPE_BRASO RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|146190695|emb|CAL74699.1| Succinyl-diaminopimelate desuccinylase (SDAP) [Bradyrhizobium sp.
           ORS278]
          Length = 384

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 185/383 (48%), Positives = 239/383 (62%), Gaps = 4/383 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D L     LI+CPSVTP D GA  +L   LK  GF+     F    T+ + NLYAR GTE
Sbjct: 3   DALTITRDLIRCPSVTPADAGALGVLEALLKQAGFTTHRVTFSEPGTADIDNLYARIGTE 62

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PH+ FAGH DVVPPGD   W+ P FS  + +G IYGRG VDMKG IAC +AA   ++  
Sbjct: 63  GPHITFAGHTDVVPPGDEASWSLPAFSGEVKDGYIYGRGAVDMKGGIACSVAAALDYLRD 122

Query: 124 YKNF--GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
           + +   GSIS LITGDEE  +INGT K+L W   +GE +D C++GEP+   ++GD IKIG
Sbjct: 123 HGSQPKGSISFLITGDEEDVSINGTIKLLQWAADRGETFDHCVLGEPSNQEVMGDCIKIG 182

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGS SG + + GKQGHVAYPH   NP+  +  L+  L++   D G+  F P+N+E TT+
Sbjct: 183 RRGSQSGTLIVEGKQGHVAYPHRASNPVPDISRLIVALSDEPLDNGSAQFQPSNLEFTTV 242

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
           DVGN + NVI    +  FNIR+ND   +++L+  +  RL K   N  ++   + +    S
Sbjct: 243 DVGNTATNVIAGIARAKFNIRYNDCHTQESLRALVEQRLAKACGN--RIRAHIDWLPSNS 300

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALN 361
            VFLT     T L   +I   TG  P LST+GGTSDARFI  YCPVIEFGLVG+TMH ++
Sbjct: 301 DVFLTKPGPFTDLAVAAIEEVTGRKPELSTTGGTSDARFISSYCPVIEFGLVGQTMHQID 360

Query: 362 ENASLQDLEDLTCIYENFLQNWF 384
           E AS+ D+  LT IY   L  +F
Sbjct: 361 ERASVADIATLTKIYRGILDRYF 383


>gi|23014944|ref|ZP_00054737.1| COG0624: Acetylornithine deacetylase/Succinyl-diaminopimelate
           desuccinylase and related deacylases [Magnetospirillum
           magnetotacticum MS-1]
          Length = 379

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 189/370 (51%), Positives = 243/370 (65%), Gaps = 11/370 (2%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+CPSVTP+D GA  +L   L+ LGF+       T    I +NLYAR GTE P+L FAG
Sbjct: 13  LIRCPSVTPEDAGALDVLAGALERLGFTCHHIRSSTGGPEI-RNLYARLGTEGPNLCFAG 71

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSIS 131
           H DVVPPG    WT  PF   I +G+++GRG  DMKG+I CF+AAVAR +      GSIS
Sbjct: 72  HTDVVPPG--KGWTLEPFDGGIDQGRLFGRGSADMKGAIGCFVAAVARMLKDGAPKGSIS 129

Query: 132 LLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEIT 191
           LLITGDEEGPA++GT K+L W+  +GE+ D CIVGEPT    +GD +KIGRRGSL+  +T
Sbjct: 130 LLITGDEEGPAVDGTVKVLDWLAARGERLDCCIVGEPTNPRKLGDMMKIGRRGSLNCRLT 189

Query: 192 IHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVI 251
           + G QGH AYPHL +NPI  L+ +L  LT    D G   F  + + +TT+DVGNP+ NVI
Sbjct: 190 VFGTQGHSAYPHLADNPIPRLLEILRLLTEAPLDEGTPHFQASTLALTTVDVGNPATNVI 249

Query: 252 PAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS-PVFLTHDRK 310
           PA+ +  FNIRFNDL +  +L + IR       + V K    V     VS   FLT   K
Sbjct: 250 PAEARAGFNIRFNDLHSGASLGKWIR-------EIVAKAGGEVEAKIEVSGESFLTPPGK 302

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDLE 370
           L+  ++++ +  TG  P LSTSGGTSDARFIK++CPV+EFGLVG+TMH  +E+ ++ D+E
Sbjct: 303 LSEAIAQAAFEVTGLTPELSTSGGTSDARFIKNHCPVVEFGLVGQTMHKSDEHVAIADME 362

Query: 371 DLTCIYENFL 380
            LT IY   L
Sbjct: 363 ALTEIYRRVL 372


>gi|238064822|sp|Q1QH74|DAPE_NITHX RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 389

 Score =  368 bits (945), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 183/390 (46%), Positives = 239/390 (61%), Gaps = 8/390 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D L     L++CPSVTP D GA  +L   L   GF +    F     + + NLYAR 
Sbjct: 1   MATDALSIARDLVRCPSVTPADAGALGVLEKLLGDAGFEVHRVTFSEPGAADIDNLYARI 60

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   PH+ FAGH DVVPPGD + WT+  FS  + +G +YGRG VDMKG IAC  AA   +
Sbjct: 61  GATGPHIAFAGHTDVVPPGDESAWTHGAFSGEVKDGFLYGRGTVDMKGGIACSAAATLEY 120

Query: 121 I------PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHII 174
           +      P     GSIS LITGDEE  A+NGT K++ W   +GEK+D C++GEP+    +
Sbjct: 121 LEAHGGRPGKDGNGSISFLITGDEEDIAVNGTVKLMQWAAARGEKFDHCVLGEPSNVAEL 180

Query: 175 GDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPT 234
           GD IKIGRRGS SG + + G QGHVAYPH   NPI  +  L+  L +   D G+  F P+
Sbjct: 181 GDCIKIGRRGSQSGTLYVEGVQGHVAYPHRASNPIPDIAALITALVSEPLDQGSAQFQPS 240

Query: 235 NMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTV 294
           N+  T++DVGNP+ NVIP Q +  FN+RFND  N+++L+  I +R+ K   N  ++   +
Sbjct: 241 NLAFTSVDVGNPANNVIPGQARAKFNVRFNDHHNQESLRALIEARVAKVSGN--RIRTRI 298

Query: 295 HFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVG 354
            +    + VF+T     T L+  +I   TG  P L+T GGTSDARFIKDYCPVIEFGLVG
Sbjct: 299 VWEPSNADVFVTRPGPFTDLVVAAIEEVTGRRPELNTGGGTSDARFIKDYCPVIEFGLVG 358

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNWF 384
           +TMH ++E A + DLE LT IY   L  +F
Sbjct: 359 QTMHQIDERAPVADLEKLTRIYHGVLDRYF 388


>gi|92119154|ref|YP_578883.1| succinyl-diaminopimelate desuccinylase [Nitrobacter hamburgensis
           X14]
 gi|91802048|gb|ABE64423.1| succinyldiaminopimelate desuccinylase [Nitrobacter hamburgensis
           X14]
          Length = 411

 Score =  367 bits (941), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 182/387 (47%), Positives = 238/387 (61%), Gaps = 8/387 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D L     L++CPSVTP D GA  +L   L   GF +    F     + + NLYAR G  
Sbjct: 26  DALSIARDLVRCPSVTPADAGALGVLEKLLGDAGFEVHRVTFSEPGAADIDNLYARIGAT 85

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI-- 121
            PH+ FAGH DVVPPGD + WT+  FS  + +G +YGRG VDMKG IAC  AA   ++  
Sbjct: 86  GPHIAFAGHTDVVPPGDESAWTHGAFSGEVKDGFLYGRGTVDMKGGIACSAAATLEYLEA 145

Query: 122 ----PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDT 177
               P     GSIS LITGDEE  A+NGT K++ W   +GEK+D C++GEP+    +GD 
Sbjct: 146 HGGRPGKDGNGSISFLITGDEEDIAVNGTVKLMQWAAARGEKFDHCVLGEPSNVAELGDC 205

Query: 178 IKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNME 237
           IKIGRRGS SG + + G QGHVAYPH   NPI  +  L+  L +   D G+  F P+N+ 
Sbjct: 206 IKIGRRGSQSGTLYVEGVQGHVAYPHRASNPIPDIAALITALVSEPLDQGSAQFQPSNLA 265

Query: 238 ITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFS 297
            T++DVGNP+ NVIP Q +  FN+RFND  N+++L+  I +R+ K   N  ++   + + 
Sbjct: 266 FTSVDVGNPANNVIPGQARAKFNVRFNDHHNQESLRALIEARVAKVSGN--RIRTRIVWE 323

Query: 298 SPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTM 357
              + VF+T     T L+  +I   TG  P L+T GGTSDARFIKDYCPVIEFGLVG+TM
Sbjct: 324 PSNADVFVTRPGPFTDLVVAAIEEVTGRRPELNTGGGTSDARFIKDYCPVIEFGLVGQTM 383

Query: 358 HALNENASLQDLEDLTCIYENFLQNWF 384
           H ++E A + DLE LT IY   L  +F
Sbjct: 384 HQIDERAPVADLEKLTRIYHGVLDRYF 410


>gi|182680238|ref|YP_001834384.1| succinyl-diaminopimelate desuccinylase [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|238055172|sp|B2IDW3|DAPE_BEII9 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|182636121|gb|ACB96895.1| succinyl-diaminopimelate desuccinylase [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 383

 Score =  362 bits (928), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 186/385 (48%), Positives = 251/385 (65%), Gaps = 4/385 (1%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   L+    LI CPSVTPQDGG   +L + LK  GF      F  + T  + NLYARF
Sbjct: 1   MSETALDLARALISCPSVTPQDGGTLGVLESRLKASGFRTHRLTFHEEGTPDIDNLYARF 60

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G+ AP L+FAGH DVVP G    W + PF+A + +G+++GRG  DMKG+IA F AA   F
Sbjct: 61  GSGAPCLVFAGHTDVVPVGTATDWRFDPFAAKVEDGQLWGRGAADMKGAIAAFTAAALTF 120

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           I ++K+F GSI+ LITGDEEGP+INGT K+L W  ++GE +D CIVGEPT   ++GD IK
Sbjct: 121 IEQHKDFKGSIAFLITGDEEGPSINGTIKLLKWAAEQGEHFDHCIVGEPTNPQVLGDMIK 180

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGSL+G ++I GKQGHVAYPH  +NP+  L+ L+  L     D G   F  +N+E+ 
Sbjct: 181 IGRRGSLNGILSITGKQGHVAYPHRADNPVPKLMRLIEALIGTPLDEGTDHFDASNLEVV 240

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            +  G  + NVIPA+ +  FNIRFNDLW  +TL+ E+ +RL    +     ++T+ F   
Sbjct: 241 ALSSGTDAYNVIPAKAEARFNIRFNDLWTPQTLELELLARLDSVAEGT---AYTLTFEPC 297

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
            +  F+T   + T L++ +I   TG  P LST+GGTSDARFI  YCPV+EFGLVG+TMH 
Sbjct: 298 NALAFITKPDQFTDLVANAIEKQTGRRPELSTTGGTSDARFISAYCPVVEFGLVGQTMHM 357

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           ++E  S+ D+  L  IY + L+ +F
Sbjct: 358 VDERVSVADIATLETIYTSILEGYF 382


>gi|27383217|ref|NP_774746.1| succinyl-diaminopimelate desuccinylase [Bradyrhizobium japonicum
           USDA 110]
 gi|81734107|sp|Q89BP2|DAPE_BRAJA RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|27356391|dbj|BAC53371.1| succinyl-diaminopimelate desuccinylase [Bradyrhizobium japonicum
           USDA 110]
          Length = 388

 Score =  361 bits (926), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 180/387 (46%), Positives = 240/387 (62%), Gaps = 8/387 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D L     LI+CPSVTP D GA  +L N L   GF+     F    T+ V NLYAR G+E
Sbjct: 3   DALSIARDLIRCPSVTPADAGALGVLENALNAAGFTCHRVTFSEPGTADVDNLYARIGSE 62

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI-- 121
            PH+ FAGH DVVP GD + W+   FS  + +G ++GRG VDMKG IAC +AAV   +  
Sbjct: 63  GPHITFAGHTDVVPAGDESAWSVGAFSGEVKDGFLHGRGAVDMKGGIACSVAAVLEHLAA 122

Query: 122 ----PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDT 177
               P+    GSIS LITGDEE  +INGT K+L W  ++GE +D C++GEP+    +GDT
Sbjct: 123 NGGKPRGDGTGSISFLITGDEEDVSINGTIKLLKWAAERGETFDHCVLGEPSNVETLGDT 182

Query: 178 IKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNME 237
           IK+GRRGS SG + + G QGHVAYPH   NP+  +  L+  +++   D G+  F  +N+E
Sbjct: 183 IKVGRRGSQSGTLYVDGVQGHVAYPHRASNPVPDISRLIVAISDEPLDHGSAQFQASNLE 242

Query: 238 ITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFS 297
            T++DVGN + NVIP + +  FNIR+ND   + +L+E + +RL K   N  ++   + + 
Sbjct: 243 FTSVDVGNKANNVIPGEARAKFNIRYNDNHTQASLRELVETRLAKACGN--RIKARIVWE 300

Query: 298 SPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTM 357
              S VF+T     T L   +I   TG  P LSTSGGTSDARFI  YCPVIEFGLVG+TM
Sbjct: 301 PSNSNVFVTKPGPFTDLAVSAIEEITGRKPELSTSGGTSDARFISSYCPVIEFGLVGQTM 360

Query: 358 HALNENASLQDLEDLTCIYENFLQNWF 384
           H ++E   ++DLE LT +Y   L  +F
Sbjct: 361 HQVDERVPVKDLEKLTQVYRGILTRYF 387


>gi|83859288|ref|ZP_00952809.1| succinyl-diaminopimelate desuccinylase [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852735|gb|EAP90588.1| succinyl-diaminopimelate desuccinylase [Oceanicaulis alexandrii
           HTCC2633]
          Length = 388

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 189/380 (49%), Positives = 238/380 (62%), Gaps = 14/380 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           +LI+ PSVTP D GA  +L   L+ LGF      F+      V NLYAR G  AP   FA
Sbjct: 16  RLIQAPSVTPADAGALDVLSEALETLGFECTRFKFEE-----VDNLYARLGQTAPVFCFA 70

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI-PKYKNFGS 129
           GH DVVPPGD   W+  PF A IA+  ++GRG  DMKG+IA  +A VAR +  + +  GS
Sbjct: 71  GHTDVVPPGDEAAWSRGPFEAEIADDVLWGRGASDMKGAIAAMVAGVARLLQSQGRPAGS 130

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I+ LITGDEEGPA+NGTKK+L  + +KGE++D C+VGEPT  H +GDTIK+GRRGSL+G 
Sbjct: 131 IAFLITGDEEGPAVNGTKKLLKAVAEKGERFDHCLVGEPTNPHHLGDTIKVGRRGSLNGV 190

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +T+ G+QGHVAYP   ENPI  LI  L+++T    D G   F P+N+E+TTIDVGN   N
Sbjct: 191 VTVTGQQGHVAYPEKAENPIPVLIDFLNRITLRTLDEGAPHFQPSNLEVTTIDVGNAPHN 250

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNV---PKLSHTVHFSSPVSPVFLT 306
           VIPA+    FNIRFN       LK  +R + +   Q       L  TV         FLT
Sbjct: 251 VIPAKATAKFNIRFNTAQTGDGLKTWLREQAVAAEQGFFGDIDLDLTV-----TGDAFLT 305

Query: 307 HDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASL 366
                T LL  ++ + TG+ P L+T GGTSDARFIKDYCPV EFGLVG TMH ++E   +
Sbjct: 306 ETGPFTDLLRAAVRDQTGHDPALTTGGGTSDARFIKDYCPVAEFGLVGETMHQVDERVPV 365

Query: 367 QDLEDLTCIYENFLQNWFIT 386
            D+  L  IY + LQ +F T
Sbjct: 366 SDVTRLAAIYADVLQRYFKT 385


>gi|163795440|ref|ZP_02189407.1| succinyl-diaminopimelate desuccinylase [alpha proteobacterium
           BAL199]
 gi|159179426|gb|EDP63957.1| succinyl-diaminopimelate desuccinylase [alpha proteobacterium
           BAL199]
          Length = 393

 Score =  360 bits (923), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 185/383 (48%), Positives = 245/383 (63%), Gaps = 8/383 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D ++    LI+CPSVTP +GGA  +L +TL  LGF+     F+   T  + NLYAR GT 
Sbjct: 16  DAVDFAGHLIRCPSVTPAEGGAIDVLESTLGALGFTCHRLRFEEAGTDPIDNLYARIGTA 75

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
           APH  FAGH DVVP GD   WT  PF   + +G ++GRG  DMKG IA F+AA AR I +
Sbjct: 76  APHFCFAGHTDVVPVGDAAAWTVGPFDGAVRDGLLWGRGAADMKGGIAAFVAAAARIIGE 135

Query: 124 YKNF--GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
           +     GSISLLITGDEEGPA+NGT K+L W+E  GE  DAC+VGEPT  + +GD +KIG
Sbjct: 136 HGGNPPGSISLLITGDEEGPAVNGTTKVLDWMEAAGEIPDACVVGEPTNPNALGDMMKIG 195

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSL+G +T+ G QGHVAYPHL +NPI  L+ +L    +   D G   F P+ + +TTI
Sbjct: 196 RRGSLTGTLTVLGTQGHVAYPHLADNPIHHLLRMLEPFAHGQLDEGTAHFQPSTLAVTTI 255

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
           DVGNP+ NV+PA+    FNIRFND  N ++L+  +R    +      K +     +S   
Sbjct: 256 DVGNPASNVVPAKATAVFNIRFNDAHNSQSLERMLRDSFDQ------KGARYELVTSCSG 309

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALN 361
             FLT   +L++L++ +  +  G  P LST+GGTSDARFI   CPV+EFGLVG+TMH ++
Sbjct: 310 ESFLTEPGRLSTLIADAAESVVGRRPELSTTGGTSDARFICRMCPVVEFGLVGQTMHKVD 369

Query: 362 ENASLQDLEDLTCIYENFLQNWF 384
           E  ++ D+  LT IY   L+ + 
Sbjct: 370 ERVAIADIRSLTDIYAALLRRFL 392


>gi|158422176|ref|YP_001523468.1| succinyl-diaminopimelate desuccinylase [Azorhizobium caulinodans
           ORS 571]
 gi|158329065|dbj|BAF86550.1| proteobacterial succinyl-diaminopimelate desuccinylase
           [Azorhizobium caulinodans ORS 571]
          Length = 390

 Score =  357 bits (917), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 181/375 (48%), Positives = 241/375 (64%), Gaps = 8/375 (2%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+ PSVTP  G A  ++ + LK  G+ +E   F T     V NLYAR GT +P+L FAG
Sbjct: 21  LIQAPSVTPDAGQALDVVADALKAAGYHVERLVFSTAGVP-VDNLYARIGTASPNLCFAG 79

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSIS 131
           H+DVVPPGD   W + PFS  + +G +YGRG VDMKG++A F+AA   +    +  GS+S
Sbjct: 80  HVDVVPPGDAASWRHGPFSGAVEDGVLYGRGAVDMKGAVAAFLAAALAYGAPAQ--GSLS 137

Query: 132 LLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEIT 191
            LITGDEEGP+I+GT K++ W+  KGE  D CIVGEPT  + +GD +KIGRRGSLSG IT
Sbjct: 138 FLITGDEEGPSIDGTAKVVDWLAAKGEVIDHCIVGEPTNPNALGDMVKIGRRGSLSGLIT 197

Query: 192 IHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVI 251
           + G+QGHVAYPHL +NP+  L+ LL  LT    D G+  F P+N+E+ ++DVGN + NVI
Sbjct: 198 VEGRQGHVAYPHLADNPVPRLVRLLTALTAAPLDNGSAHFPPSNLEVISVDVGNTAYNVI 257

Query: 252 PAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKL 311
           P      FN+R+NDL++ ++L  EI  RL     +     + + F    S  FLT     
Sbjct: 258 PGAATAKFNVRYNDLYSLESLMAEIARRL-----DTAGEPYVLTFRDGASESFLTAPGPF 312

Query: 312 TSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDLED 371
              +  ++ + TG  P +ST+GGTSDARFIK  CPV+EFGLVG+TMH +NE   + DL  
Sbjct: 313 VETVLDAVADVTGQRPQMSTTGGTSDARFIKSLCPVVEFGLVGQTMHMVNEATPVADLTA 372

Query: 372 LTCIYENFLQNWFIT 386
           LT IYE  +  +F T
Sbjct: 373 LTAIYERLIARYFAT 387


>gi|83594809|ref|YP_428561.1| succinyl-diaminopimelate desuccinylase [Rhodospirillum rubrum ATCC
           11170]
 gi|83577723|gb|ABC24274.1| succinyldiaminopimelate desuccinylase [Rhodospirillum rubrum ATCC
           11170]
          Length = 404

 Score =  357 bits (916), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 187/394 (47%), Positives = 241/394 (61%), Gaps = 15/394 (3%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D L     L+ CPSVTP+D GA  +L + L  LGF      F  +    V NLYAR G  
Sbjct: 15  DPLALARALVACPSVTPRDAGALDVLESALIALGFRCVRLPFGAEGGERVDNLYARRGGA 74

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIP- 122
            P   FAGH DVVP GD   W+ PPF A + +G + GRG  DMKG IACF+AAVAR I  
Sbjct: 75  GPCFGFAGHTDVVPAGD--GWSRPPFGAEVVDGALVGRGAADMKGGIACFVAAVARLISG 132

Query: 123 --------KYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHII 174
                   ++   GSI+LLITGDEEGPA++GT+K+L W+E  GE+ D C+VGEPT    +
Sbjct: 133 PDSTGSISRHDPTGSIALLITGDEEGPALHGTRKVLEWMEGAGERMDLCLVGEPTNPEGL 192

Query: 175 GDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPT 234
           GD IKIGRRGSL+  +T+ G+ GHVAYPHL +NP+  L  L   L     D G   F P+
Sbjct: 193 GDMIKIGRRGSLTATVTLLGRAGHVAYPHLADNPLHRLSTLTGLLLAETLDDGTAHFQPS 252

Query: 235 NMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQ-NVPKLSHT 293
           ++++T+IDVGNP+ NVIPA+  + FNIRFND  + ++L   IR+R +     +    S  
Sbjct: 253 SLQLTSIDVGNPAANVIPAKATLRFNIRFNDRHSGESLSAWIRARCLAACDGDESGFSLV 312

Query: 294 VHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLV 353
           +  S      FLT    L+ L++ +    TG  P LSTSGGTSDARFI+ +CPV EFGLV
Sbjct: 313 LEHS---GDAFLTPPGPLSDLIATACQAVTGRRPELSTSGGTSDARFIRSHCPVAEFGLV 369

Query: 354 GRTMHALNENASLQDLEDLTCIYENFLQNWFITP 387
           GRTMH  +E  ++ DLE L+ IY   L  +F  P
Sbjct: 370 GRTMHKPDERVAVADLEALSEIYRRVLVGFFEAP 403


>gi|238064823|sp|Q2RNM1|DAPE_RHORT RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 392

 Score =  357 bits (916), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 187/394 (47%), Positives = 241/394 (61%), Gaps = 15/394 (3%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D L     L+ CPSVTP+D GA  +L + L  LGF      F  +    V NLYAR G  
Sbjct: 3   DPLALARALVACPSVTPRDAGALDVLESALIALGFRCVRLPFGAEGGERVDNLYARRGGA 62

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIP- 122
            P   FAGH DVVP GD   W+ PPF A + +G + GRG  DMKG IACF+AAVAR I  
Sbjct: 63  GPCFGFAGHTDVVPAGD--GWSRPPFGAEVVDGALVGRGAADMKGGIACFVAAVARLISG 120

Query: 123 --------KYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHII 174
                   ++   GSI+LLITGDEEGPA++GT+K+L W+E  GE+ D C+VGEPT    +
Sbjct: 121 PDSTGSISRHDPTGSIALLITGDEEGPALHGTRKVLEWMEGAGERMDLCLVGEPTNPEGL 180

Query: 175 GDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPT 234
           GD IKIGRRGSL+  +T+ G+ GHVAYPHL +NP+  L  L   L     D G   F P+
Sbjct: 181 GDMIKIGRRGSLTATVTLLGRAGHVAYPHLADNPLHRLSTLTGLLLAETLDDGTAHFQPS 240

Query: 235 NMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQ-NVPKLSHT 293
           ++++T+IDVGNP+ NVIPA+  + FNIRFND  + ++L   IR+R +     +    S  
Sbjct: 241 SLQLTSIDVGNPAANVIPAKATLRFNIRFNDRHSGESLSAWIRARCLAACDGDESGFSLV 300

Query: 294 VHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLV 353
           +  S      FLT    L+ L++ +    TG  P LSTSGGTSDARFI+ +CPV EFGLV
Sbjct: 301 LEHS---GDAFLTPPGPLSDLIATACQAVTGRRPELSTSGGTSDARFIRSHCPVAEFGLV 357

Query: 354 GRTMHALNENASLQDLEDLTCIYENFLQNWFITP 387
           GRTMH  +E  ++ DLE L+ IY   L  +F  P
Sbjct: 358 GRTMHKPDERVAVADLEALSEIYRRVLVGFFEAP 391


>gi|296775671|gb|ADH42948.1| acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase
           [uncultured SAR11 cluster alpha proteobacterium
           H17925_23J24]
          Length = 379

 Score =  357 bits (915), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 177/374 (47%), Positives = 250/374 (66%), Gaps = 8/374 (2%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+ PS+TP+D GA  +L   L+ +GF+ +  +F+      +KNLYA+ G  +P+  +AG
Sbjct: 12  LIRKPSITPKDAGAINLLAKNLRSIGFNCKIINFKN-----IKNLYAKLGKSSPNFCYAG 66

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVPPG+  +WT  PF   +   K+ GRG  DMK SIACF+AAV+RF  + KNF GSI
Sbjct: 67  HTDVVPPGNIKNWTINPFKPIVRNNKLIGRGANDMKASIACFVAAVSRFKNQNKNFKGSI 126

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           SLLITGDEEG A+NGTK+++ ++++K EK + C+VGEPT  + +G+ IKIGRRGSL+G +
Sbjct: 127 SLLITGDEEGMALNGTKRVVKYLKRKKEKINFCLVGEPTNPNKLGEMIKIGRRGSLTGRL 186

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
           T+ G QGHVAYPH   NP   LI +L ++ ++  D G   F P+N+E+T I++ N + NV
Sbjct: 187 TVIGSQGHVAYPHRANNPSNTLIKILKRIKDLKLDRGTKNFQPSNLEVTKINIDNHADNV 246

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IP      FNIRFND  +  +LK ++ +++ K +    K    V++       FLT   K
Sbjct: 247 IPGSAYAVFNIRFNDKHSSGSLKRKL-NKIFKAVTKTNKSKFKVNYEVS-GEAFLTKPNK 304

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDLE 370
           +T ++  +I   TG  P LSTSGGTSDARFIK+  P +EFGLVG+TMH ++E+ S+ DL+
Sbjct: 305 ITFMIQNTIKKITGIKPKLSTSGGTSDARFIKNIAPCLEFGLVGKTMHKIDESVSVSDLK 364

Query: 371 DLTCIYENFLQNWF 384
            LT IYEN L ++F
Sbjct: 365 KLTKIYENILVSYF 378


>gi|238055324|sp|A8IMH3|DAPE_AZOC5 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 376

 Score =  356 bits (913), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 181/375 (48%), Positives = 241/375 (64%), Gaps = 8/375 (2%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+ PSVTP  G A  ++ + LK  G+ +E   F T     V NLYAR GT +P+L FAG
Sbjct: 7   LIQAPSVTPDAGQALDVVADALKAAGYHVERLVFSTAGVP-VDNLYARIGTASPNLCFAG 65

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSIS 131
           H+DVVPPGD   W + PFS  + +G +YGRG VDMKG++A F+AA   +    +  GS+S
Sbjct: 66  HVDVVPPGDAASWRHGPFSGAVEDGVLYGRGAVDMKGAVAAFLAAALAYGAPAQ--GSLS 123

Query: 132 LLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEIT 191
            LITGDEEGP+I+GT K++ W+  KGE  D CIVGEPT  + +GD +KIGRRGSLSG IT
Sbjct: 124 FLITGDEEGPSIDGTAKVVDWLAAKGEVIDHCIVGEPTNPNALGDMVKIGRRGSLSGLIT 183

Query: 192 IHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVI 251
           + G+QGHVAYPHL +NP+  L+ LL  LT    D G+  F P+N+E+ ++DVGN + NVI
Sbjct: 184 VEGRQGHVAYPHLADNPVPRLVRLLTALTAAPLDNGSAHFPPSNLEVISVDVGNTAYNVI 243

Query: 252 PAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKL 311
           P      FN+R+NDL++ ++L  EI  RL     +     + + F    S  FLT     
Sbjct: 244 PGAATAKFNVRYNDLYSLESLMAEIARRL-----DTAGEPYVLTFRDGASESFLTAPGPF 298

Query: 312 TSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDLED 371
              +  ++ + TG  P +ST+GGTSDARFIK  CPV+EFGLVG+TMH +NE   + DL  
Sbjct: 299 VETVLDAVADVTGQRPQMSTTGGTSDARFIKSLCPVVEFGLVGQTMHMVNEATPVADLTA 358

Query: 372 LTCIYENFLQNWFIT 386
           LT IYE  +  +F T
Sbjct: 359 LTAIYERLIARYFAT 373


>gi|170742363|ref|YP_001771018.1| succinyl-diaminopimelate desuccinylase [Methylobacterium sp. 4-46]
 gi|238064793|sp|B0UP37|DAPE_METS4 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|168196637|gb|ACA18584.1| succinyl-diaminopimelate desuccinylase [Methylobacterium sp. 4-46]
          Length = 396

 Score =  353 bits (906), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 192/387 (49%), Positives = 245/387 (63%), Gaps = 8/387 (2%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           TP  L     LI+CPSVTP++GGA   L   L   GFS+E   F    T  V+NLYAR G
Sbjct: 4   TPSPLALAQGLIRCPSVTPEEGGALAYLAGLLAAAGFSVERPVFSAPGTPDVENLYARIG 63

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
            + P L+ AGH DVVPPG+   W + PF+  +  G+++GRG VDMKG IAC  AA   F+
Sbjct: 64  ADGPCLLLAGHTDVVPPGEPALWRHDPFAGVVEGGELHGRGAVDMKGGIACLAAASLAFL 123

Query: 122 ----PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDT 177
               P +   GSI+ L+TGDEEGPA+NGT K+L+W   +GE++D CI+ EPT    +GD 
Sbjct: 124 AERGPAFG--GSIAFLVTGDEEGPAVNGTVKLLAWARARGERFDHCILAEPTNPDALGDM 181

Query: 178 IKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNME 237
           IKIGRRGSL+  +T+ G QGHVAYPH  ENPI GLI L   L     D G   F  +N+E
Sbjct: 182 IKIGRRGSLTATLTVLGAQGHVAYPHRAENPIPGLIRLAGALLAAPLDEGTAHFDASNLE 241

Query: 238 ITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFS 297
            TTIDVGNP+ NVIPAQ +   NIRFNDLWN  +L+ E+R RL     N  +    V  +
Sbjct: 242 FTTIDVGNPASNVIPAQARAVLNIRFNDLWNPASLEAELRRRLDAAAGNAVRYRLDVQPT 301

Query: 298 SPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTM 357
           + V+  FLT       L++ +I   TG  P LST+GGTSDARFIK+ CPVIEFGLVG+TM
Sbjct: 302 NAVA--FLTQPDAFVDLVTAAIEAETGRRPALSTTGGTSDARFIKEACPVIEFGLVGQTM 359

Query: 358 HALNENASLQDLEDLTCIYENFLQNWF 384
           H ++E  ++ DL+ L  I+   L  +F
Sbjct: 360 HQVDERVAVADLDRLAAIFRRILDAYF 386


>gi|238055320|sp|A7IH44|DAPE_XANP2 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 375

 Score =  352 bits (902), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 181/376 (48%), Positives = 247/376 (65%), Gaps = 8/376 (2%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           +LI+ PSVTP    A  ++   L+  G+ +E   F+T    I  NLYAR GT+ P+L FA
Sbjct: 6   ELIRAPSVTPHADDALELVAKRLEAAGYRVERLTFETGGVPI-PNLYARIGTDGPNLCFA 64

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSI 130
           GH+DVVP GD   W + PF+ T+ +G ++GRG VDMKG++A F+AA   F       GS+
Sbjct: 65  GHVDVVPEGDATQWHHAPFAGTVEDGVLHGRGAVDMKGAVAAFLAAALAF--GRPQRGSL 122

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           S LITGDEEGPA++GT K++ W++ +GE  D C++GEPT    +GD  K+GRRGSLSG +
Sbjct: 123 SFLITGDEEGPALDGTVKVVEWLKARGETIDHCVLGEPTNPDALGDAFKVGRRGSLSGIL 182

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
           T+ G QGHVAYPHL +NPI  L+ L+  LT    D G+  F P+N+E+ ++DVGNP  N+
Sbjct: 183 TVKGVQGHVAYPHLADNPIPRLLKLIGDLTAAPLDHGSDFFPPSNLEVVSVDVGNPVFNL 242

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IPAQ    FN+RFNDL++ ++LK EI  RL     +   L++ + F +  S  FLT    
Sbjct: 243 IPAQATARFNVRFNDLFSLESLKSEIIRRL-----DGAGLTYDLAFQTGASQSFLTAPGP 297

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDLE 370
            T L++ ++   TG  P  STSGGTSDARFIKD CPV+EFGLVGRTMH ++E   ++D+E
Sbjct: 298 FTDLVASAVEEVTGRRPEPSTSGGTSDARFIKDICPVVEFGLVGRTMHKVDEATPVKDIE 357

Query: 371 DLTCIYENFLQNWFIT 386
            LT IY   +  +F T
Sbjct: 358 ALTAIYGRIIARYFST 373


>gi|299132599|ref|ZP_07025794.1| succinyl-diaminopimelate desuccinylase [Afipia sp. 1NLS2]
 gi|298592736|gb|EFI52936.1| succinyl-diaminopimelate desuccinylase [Afipia sp. 1NLS2]
          Length = 384

 Score =  351 bits (901), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 181/386 (46%), Positives = 232/386 (60%), Gaps = 12/386 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L+    L++CPSVTP D GA  +L   LK  GF      F         NLYAR GT A
Sbjct: 4   ALDVARDLLRCPSVTPADAGALGVLEKLLKDAGFETHRLTFTEPGADDTDNLYARIGTAA 63

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI--- 121
           PH+ FAGH DVVPPGD   W++  F+  +    +YGRG VDMKG+IAC +AAV  ++   
Sbjct: 64  PHITFAGHTDVVPPGDDKAWSHDAFAGDVDGDVLYGRGAVDMKGAIACSVAAVLDYLQAN 123

Query: 122 ---PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
              PK    GSIS LITGDEEGPA+NGT K+L W  K+GEK+D C++GEP+  + +GD I
Sbjct: 124 GGQPK----GSISFLITGDEEGPAVNGTVKLLDWAAKRGEKFDHCVLGEPSNVNALGDCI 179

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K+GRRGSLSG + + GKQGHVAYP    NP+  +  L+  L     D G   F P+N+E 
Sbjct: 180 KVGRRGSLSGTLIVEGKQGHVAYPDRAHNPLPDIAALVSALNADPLDHGTDHFPPSNLEF 239

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
            +ID GNP+ NVIPAQ +  FNIR ND   + +L+  I  R+ K   N    +  V +  
Sbjct: 240 LSIDTGNPAWNVIPAQARARFNIRHNDYRTQDSLRALIEGRVEKLSGN--HTTARVEWEP 297

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
             +  FLT     T L+  +I   T   P L T GGTSDARFI  YCPV+EFGLVG+TMH
Sbjct: 298 SNADAFLTQPGPFTDLVVAAIEEVTKRRPKLDTGGGTSDARFIVHYCPVLEFGLVGQTMH 357

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E   + D+E LT IY + L  +F
Sbjct: 358 QIDERTPVADIEALTKIYRSVLDRYF 383


>gi|296447779|ref|ZP_06889693.1| succinyl-diaminopimelate desuccinylase [Methylosinus trichosporium
           OB3b]
 gi|296254698|gb|EFH01811.1| succinyl-diaminopimelate desuccinylase [Methylosinus trichosporium
           OB3b]
          Length = 385

 Score =  351 bits (901), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 183/375 (48%), Positives = 242/375 (64%), Gaps = 4/375 (1%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            L++CPSVTP D GA  +L   LK  GF+     F  + T  + NL+A+ G   PHL+FA
Sbjct: 12  DLLRCPSVTPADAGALGVLEQRLKEAGFTTHRLVFSEEGTPDINNLFAKIGEGRPHLVFA 71

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK-NFGS 129
           GH DVVP GD   W + PFS  IA+GKI+GRG  DMKG IA F AA   F+ ++    G+
Sbjct: 72  GHTDVVPSGDPARWRFDPFSGEIADGKIFGRGASDMKGGIAAFAAAAIDFVREHGVPRGA 131

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           IS LITGDEEGPA+NGT KML W   +GE +D  IVGEPT    IGDTIKIGRRGSL+G 
Sbjct: 132 ISFLITGDEEGPAVNGTVKMLDWARAQGEVFDHSIVGEPTNLEAIGDTIKIGRRGSLNGR 191

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           + + GKQGH A+PH  +NP   +  ++  L+   FD G   F  +N+E+T+ID+GN + N
Sbjct: 192 LVVRGKQGHSAHPHRADNPTPAVARIVTALSTHRFDEGTEHFDRSNLEVTSIDIGNQAAN 251

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP + +  FNIRFN+ W  +TL+ EIR R+I       ++   V F    S  FLT   
Sbjct: 252 VIPGEARARFNIRFNNSWTLETLQAEIR-RVIDEAAAGARVE--VEFLPCNSLPFLTAPG 308

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDL 369
             T+L++ +I   TG  P LSTSGGTSDARFI   CPV+EFGLV  ++HA++E+A L+D+
Sbjct: 309 DFTALVAGAIEEVTGRRPGLSTSGGTSDARFITRECPVLEFGLVNESIHAVDEHARLEDV 368

Query: 370 EDLTCIYENFLQNWF 384
           + LT +Y+  L+ +F
Sbjct: 369 DRLTAVYKRILEKYF 383


>gi|330813517|ref|YP_004357756.1| N-succinyl-L,L-diaminopimelate desuccinylase [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327486612|gb|AEA81017.1| N-succinyl-L,L-diaminopimelate desuccinylase [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 386

 Score =  350 bits (899), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 189/375 (50%), Positives = 242/375 (64%), Gaps = 3/375 (0%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           +LIK PSVTP D GA  ++   LK LGF     +F+ KNT  +KNLYAR GT +P+  FA
Sbjct: 13  ELIKIPSVTPIDAGAIDLVTKRLKSLGFKCTILNFKDKNTPPIKNLYARLGTSSPNFCFA 72

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVP G+   W   PFS  +  GKIYGRG  DMKG IACFIAAV+ FI   K F GS
Sbjct: 73  GHTDVVPTGNAKSWDAGPFSGIVKNGKIYGRGASDMKGGIACFIAAVSEFIKDQKKFKGS 132

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           IS +ITGDEEG AINGTKK++++++KK EK D CIVGEP+   ++G  +KIGRRGS++  
Sbjct: 133 ISFIITGDEEGVAINGTKKVVNYLKKKKEKIDFCIVGEPSNRKVLGQMMKIGRRGSITTH 192

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +T+ G QGHVAYPH   NP   LI +L +L +   D G   F P+N+EIT I   + + N
Sbjct: 193 LTLSGIQGHVAYPHEACNPSTPLIKILDKLKSTKLDNGTNNFQPSNLEITKIGTDSHADN 252

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIPA    +FNIRFN+  N  +LK++I S +++ I    K    V FS      F+T   
Sbjct: 253 VIPATSSATFNIRFNNKHNHSSLKKKI-STIVQTIAKKYKCKPIVKFSE-TGTAFITKPG 310

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDL 369
           +   ++S+ I   T   P+LSTSGGTSDARFIKD  P +EFGLVG TMH +NE  S+ DL
Sbjct: 311 ETVRMMSQVIKKITNKKPVLSTSGGTSDARFIKDIAPCVEFGLVGNTMHKINECVSVNDL 370

Query: 370 EDLTCIYENFLQNWF 384
           + L  IY   L+ +F
Sbjct: 371 KKLKKIYYKVLETYF 385


>gi|71083168|ref|YP_265887.1| succinyl-diaminopimelate desuccinylase [Candidatus Pelagibacter
           ubique HTCC1062]
 gi|123647068|sp|Q4FNF5|DAPE_PELUB RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|71062281|gb|AAZ21284.1| succinyl-diaminopimelate desuccinylase [Candidatus Pelagibacter
           ubique HTCC1062]
          Length = 384

 Score =  350 bits (897), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 179/375 (47%), Positives = 241/375 (64%), Gaps = 3/375 (0%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           +LI+ PS+TP D G    L   L  +GF  +  +F+ KN+  VKNLYAR G   P+ MFA
Sbjct: 12  ELIRFPSITPIDAGVMKFLAKKLTTIGFKCKILEFKDKNSKPVKNLYARLGNTQPNFMFA 71

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH+DVVPPG+   WT  PFS TI +  + GRG  DMK +IA ++ AV  ++   K   GS
Sbjct: 72  GHLDVVPPGNIQDWTIKPFSPTIKKNHLIGRGANDMKSAIASWVVAVNNYVLTNKKINGS 131

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           ISLLITGDEEG AINGTKK++ +++KK EK D C+VGEPT  + +G+ IKIGRRGS++ E
Sbjct: 132 ISLLITGDEEGVAINGTKKVVDYLKKKKEKIDFCLVGEPTNPNKLGEMIKIGRRGSINAE 191

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +TI G QGHVAYPH  +NP   LI +L+++  I FD G   F PTN+E+T I++ N + N
Sbjct: 192 LTIIGTQGHVAYPHRAKNPSTSLIKILNEIKEIKFDKGTKDFQPTNLEVTKININNTADN 251

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP   + +FNIRFN+     +LK  + +++ K I    K +  V +       FLT   
Sbjct: 252 VIPGLARATFNIRFNNKHTSSSLKNRL-NKIFKKITKKDKSNFKVEYRVS-GEAFLTKPN 309

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDL 369
           K T ++   I   T   P LST+GGTSDARFI+   P +EFGLVG+TMH ++E  S+ DL
Sbjct: 310 KTTYMIQDVIKKITKIKPQLSTTGGTSDARFIRKIAPCLEFGLVGKTMHKVDEAVSISDL 369

Query: 370 EDLTCIYENFLQNWF 384
           + LT IY   L+N+F
Sbjct: 370 KKLTKIYSEILKNYF 384


>gi|91762403|ref|ZP_01264368.1| succinyl-diaminopimelate desuccinylase [Candidatus Pelagibacter
           ubique HTCC1002]
 gi|91718205|gb|EAS84855.1| succinyl-diaminopimelate desuccinylase [Candidatus Pelagibacter
           ubique HTCC1002]
          Length = 385

 Score =  350 bits (897), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 180/375 (48%), Positives = 242/375 (64%), Gaps = 3/375 (0%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           +LI+ PS+TP D G    L   L  +GF  +  +F+ KN+  VKNLYAR G   P+ MFA
Sbjct: 12  ELIRFPSITPIDAGVMKFLAKKLTTIGFKCKILEFKDKNSKPVKNLYARLGNTQPNFMFA 71

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH+DVVPPG+   WT  PFS TI +  + GRG  DMK +IA ++ AV  ++   K   GS
Sbjct: 72  GHLDVVPPGNIQDWTIKPFSPTIKKNHLIGRGANDMKSAIASWVVAVNNYVLTNKKINGS 131

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           ISLLITGDEEG AINGTKK++ +++KK EK D C+VGEPT  + +G+ IKIGRRGS++ E
Sbjct: 132 ISLLITGDEEGIAINGTKKVVDYLKKKKEKIDFCLVGEPTNPNKLGEMIKIGRRGSVNVE 191

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +TI G QGHVAYPH  +NP   LI +L+++  I FD G   F PTN+E+T I++ N + N
Sbjct: 192 LTIIGTQGHVAYPHRAKNPSTSLIKILNEIKEIKFDKGTKDFQPTNLEVTKININNTADN 251

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP   + +FNIRFN+     +LK  + +++ K I    K +  V +       FLT   
Sbjct: 252 VIPGLARATFNIRFNNKHTSSSLKNRL-NKIFKKITKKDKSNFKVEYRVS-GEAFLTKPN 309

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDL 369
           K T ++   I   T   P LST+GGTSDARFI+   P +EFGLVG+TMH ++E  S+ DL
Sbjct: 310 KTTYMIQDVIKKITKIKPQLSTTGGTSDARFIRKIAPCLEFGLVGKTMHKVDEAVSISDL 369

Query: 370 EDLTCIYENFLQNWF 384
           + LT IY N L+N+F
Sbjct: 370 KKLTKIYYNILENYF 384


>gi|312115826|ref|YP_004013422.1| succinyl-diaminopimelate desuccinylase [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311220955|gb|ADP72323.1| succinyl-diaminopimelate desuccinylase [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 383

 Score =  347 bits (891), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 180/376 (47%), Positives = 231/376 (61%), Gaps = 3/376 (0%)

Query: 7   EHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPH 66
           E+   LI+C SVTP D GA   L   L   GF+ E   F    T+ V+NLYAR G   PH
Sbjct: 6   EYAQTLIRCESVTPDDAGALAYLERELGAAGFACERLRFSEPGTADVENLYARLGDGTPH 65

Query: 67  LMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKN 126
           + FAGHIDVVPPGD   W  PPF+  I  G +YGRG VDMKG++A  +AA   ++ +  +
Sbjct: 66  ICFAGHIDVVPPGDEAAWRLPPFAGEIENGVLYGRGAVDMKGAVAASLAAALEYLREKPD 125

Query: 127 F-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGS 185
             GSIS LIT DEEGP+INGT+K++  +  +GE+ DAC++GE T    + DTIKIGRRGS
Sbjct: 126 LVGSISFLITADEEGPSINGTRKVVERLIARGERPDACVLGECTSEDAVADTIKIGRRGS 185

Query: 186 LSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGN 245
           L  E+ + G QGHVAYPH   NP+  LI  L +L     D G+  F P+N+EITTID GN
Sbjct: 186 LGAELIVRGVQGHVAYPHKARNPLPALIDALTRLKARRLDDGSEHFQPSNLEITTIDTGN 245

Query: 246 PSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFL 305
            + N+IPAQ    FNIRFNDL     LK  I   +   + +   + HT++F  P S  FL
Sbjct: 246 KATNIIPAQASARFNIRFNDLHTAPQLKAWIEEEVAAALLDT-GVEHTLNFDQP-SDSFL 303

Query: 306 THDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENAS 365
           T       +L  ++   TG  P+LST GGTSDARFIKD CPV E GL+  T H ++E+ +
Sbjct: 304 TSPGGFVKMLGAAVQAETGREPVLSTGGGTSDARFIKDMCPVAELGLLNATAHKVDEHTA 363

Query: 366 LQDLEDLTCIYENFLQ 381
             D+E L  IY+ FL 
Sbjct: 364 TADIETLARIYKRFLH 379


>gi|217977205|ref|YP_002361352.1| succinyl-diaminopimelate desuccinylase [Methylocella silvestris
           BL2]
 gi|238064794|sp|B8ELJ6|DAPE_METSB RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|217502581|gb|ACK49990.1| succinyl-diaminopimelate desuccinylase [Methylocella silvestris
           BL2]
          Length = 388

 Score =  347 bits (890), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 189/381 (49%), Positives = 244/381 (64%), Gaps = 2/381 (0%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            +E   +L++ PSVTP D GA   L   L+  GF+     F  ++T  ++NLYAR G   
Sbjct: 8   AVELCRELLRRPSVTPLDAGAQDFLAAKLREAGFATHSVVFSDESTPDIQNLYARAGAGG 67

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
            HL+FAGH DVVPPGD   W + PF   +  G I+GRG VDMKG+IA F AA   F+ + 
Sbjct: 68  RHLVFAGHTDVVPPGDSASWRFDPFGGEMEGGLIFGRGAVDMKGAIAAFAAAAMAFVAEG 127

Query: 125 -KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               GSIS LITGDEEGPAINGT K+L W  ++GE++D CI+GEPT    +GD IKIGRR
Sbjct: 128 GAQKGSISFLITGDEEGPAINGTDKLLRWAHQRGERFDHCILGEPTNQQALGDMIKIGRR 187

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL+G +T+ G QGHVAYPH  +NPI  L+ LL  LT    D G   F  +N+EI ++DV
Sbjct: 188 GSLNGTLTVKGVQGHVAYPHRAKNPIPHLMRLLAALTAEPLDQGTELFDASNLEIVSVDV 247

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GNP+ NVIPA+ +  FNIRFND+W    L  E+R+R  K        +  +HF    +  
Sbjct: 248 GNPTFNVIPAEARARFNIRFNDIWTPDALAAELRARAEK-AGAAAGAASALHFEPCNALA 306

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           F+T     T L+S +I   TG  P LSTSGGTSDARFI+ YCPV+EFGLVG TMHA++E 
Sbjct: 307 FVTQPDAFTDLVSAAIEQATGRKPKLSTSGGTSDARFIRAYCPVLEFGLVGSTMHAVDER 366

Query: 364 ASLQDLEDLTCIYENFLQNWF 384
           A ++D+  L  IY + L ++F
Sbjct: 367 APVEDISALASIYADILNSYF 387


>gi|328545262|ref|YP_004305371.1| acetylornithine deacetylase/Succinyl-diaminopimelate
           desuccinylase-like deacylase [polymorphum gilvum
           SL003B-26A1]
 gi|326415004|gb|ADZ72067.1| Acetylornithine deacetylase/Succinyl-diaminopimelate
           desuccinylase-like deacylase [Polymorphum gilvum
           SL003B-26A1]
          Length = 393

 Score =  347 bits (890), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 187/376 (49%), Positives = 239/376 (63%), Gaps = 4/376 (1%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            LI+CPSVTP +GGA  +L   L+  GFS++   F   +T  V+NL+A  G  APH +FA
Sbjct: 14  DLIRCPSVTPAEGGALQLLQERLEGAGFSVQRLTFSDTDTPDVENLFASIGHGAPHFVFA 73

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI-PKYKNFG- 128
           GH DVVP G    W++ PF   I  G +YGRG VDMKG IA F AA   F+  +  +FG 
Sbjct: 74  GHTDVVPAGATADWSHGPFDGVIDAGLLYGRGAVDMKGGIAAFAAAALAFVAERGTDFGG 133

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           +IS LITGDEEGPA+NGT K+L W   +G  +DACIVGEPT    +GD IKIGRRGSLSG
Sbjct: 134 TISFLITGDEEGPAVNGTVKLLDWARAQGHVFDACIVGEPTNPVRLGDAIKIGRRGSLSG 193

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
            + + G QGHVAYPHL  NPI  L+ LL  L  +  D GN  F P+N+EI  ++VGN + 
Sbjct: 194 IVAVTGIQGHVAYPHLAHNPIPNLLRLLAALQALKLDEGNARFEPSNLEIVNLEVGNAAF 253

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHD 308
           NVIPA+ +  FNIR+ND W    LK ++ + +            ++ F    S  FLT D
Sbjct: 254 NVIPARAEARFNIRYNDEWTLDGLKAKVTAVIEAAADR--SCDWSLEFRRDASESFLTRD 311

Query: 309 RKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQD 368
            +L   L+ ++   TG  P LST GGTSDARFIKDYCPV+EFGLVG+TMH ++E  ++ D
Sbjct: 312 DRLIEGLADAVEAETGQRPDLSTGGGTSDARFIKDYCPVVEFGLVGQTMHKVDECVAVVD 371

Query: 369 LEDLTCIYENFLQNWF 384
           L+ L  IY  FL  +F
Sbjct: 372 LKRLAAIYRRFLDGYF 387


>gi|144900139|emb|CAM77003.1| Proteobacterial succinyl-diaminopimelate desuccinylase
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 380

 Score =  346 bits (887), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 180/371 (48%), Positives = 245/371 (66%), Gaps = 8/371 (2%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           +LIKC SVTP+D GA  +L   L+ LGF     D  T    +++NLYAR G++  +  FA
Sbjct: 12  ELIKCASVTPEDAGARDLLAGWLRELGFDCHAVDSATGG-PLIRNLYARRGSDGINFCFA 70

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSI 130
           GH DVVP G  + W+  PF+ TI   ++YGRG  DMKG+IACF+AAV+RF+   +  GSI
Sbjct: 71  GHTDVVPVG-ASGWSVEPFAGTILNNRLYGRGATDMKGAIACFVAAVSRFVATGQPAGSI 129

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           SLLITGDEEGPA++GT K+L W++ +GE+ D C+VGEPT    +G+ +KIGRRGSL+  I
Sbjct: 130 SLLITGDEEGPAVDGTVKVLDWLKARGERLDMCLVGEPTNPGRLGEMMKIGRRGSLNCRI 189

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
           T+ G QGH AYPHL +NPI  L+ +L+ LT    D G+  F  + + +TT+DVGN + NV
Sbjct: 190 TVFGTQGHSAYPHLADNPIPRLLAMLNALTAEPLDHGSPHFQASTLALTTVDVGNAATNV 249

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IPAQ +  FNIRFNDL +  +L++ IR  L   +    +    V   S     FLT    
Sbjct: 250 IPAQARAGFNIRFNDLHSGNSLEQWIRHTL-DSVGGDYECKIEVSGES-----FLTEPGV 303

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDLE 370
           L+  +++     TG  P LST+GGTSDARFIK++CPV+EFGLV +TMH ++E+ ++ DLE
Sbjct: 304 LSEAVAECARAVTGLTPELSTTGGTSDARFIKNHCPVLEFGLVSQTMHKVDEHVAVDDLE 363

Query: 371 DLTCIYENFLQ 381
            LT IY   L+
Sbjct: 364 ALTQIYLGVLE 374


>gi|209542532|ref|YP_002274761.1| succinyl-diaminopimelate desuccinylase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209530209|gb|ACI50146.1| succinyl-diaminopimelate desuccinylase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 385

 Score =  341 bits (874), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 181/375 (48%), Positives = 228/375 (60%), Gaps = 13/375 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            LI+ PSVTP DGGA  +L   L+ LGF + +  F  +  +   NL+AR G   PHL FA
Sbjct: 18  DLIRAPSVTPDDGGAIGVLTAALRGLGFDVTDLPFG-EGPARTPNLFARLGRSGPHLCFA 76

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVPPGD   WT  PF A + +G++YGRG  DMKG IA F+ AVAR +   +   GS
Sbjct: 77  GHTDVVPPGD-GGWTSGPFEAALRDGRLYGRGACDMKGGIAAFVGAVARILESGRTLRGS 135

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           +SLLITGDEEGPA  GT K+L W+   G+  D C+VGEPT    +GD IKIGRRGSL+  
Sbjct: 136 VSLLITGDEEGPATFGTVKVLEWMAAHGQVPDFCVVGEPTNPDHLGDVIKIGRRGSLNAR 195

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           I + G QGHVAYPH  +NP+  L+ +L  LT    D G   F P+++++TT+DVGN + N
Sbjct: 196 IVVPGIQGHVAYPHRADNPVHRLLAILSDLTARPLDQGTEWFEPSSLQVTTVDVGNEATN 255

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNV--PKLSHTVHFSSPVSPVFLTH 307
           VIP +     NIRFNDL   + L + IR     G+ +V  P    TV  S      F T 
Sbjct: 256 VIPGRATARLNIRFNDLHTGQGLADWIR-----GVAHVHAPGAEVTVQIS---GEAFRTE 307

Query: 308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQ 367
                 +L+ SI   TG  P L T GGTSDARFI  YCPV EFGLVG +MH ++E+  + 
Sbjct: 308 PTPELDMLAASIQAVTGRAPRLDTGGGTSDARFISRYCPVAEFGLVGASMHKVDEHVPVA 367

Query: 368 DLEDLTCIYENFLQN 382
           DL  LT IY  FL+ 
Sbjct: 368 DLLALTDIYAAFLER 382


>gi|154246036|ref|YP_001416994.1| succinyl-diaminopimelate desuccinylase [Xanthobacter autotrophicus
           Py2]
 gi|154160121|gb|ABS67337.1| succinyl-diaminopimelate desuccinylase [Xanthobacter autotrophicus
           Py2]
          Length = 363

 Score =  340 bits (873), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 176/369 (47%), Positives = 241/369 (65%), Gaps = 8/369 (2%)

Query: 18  VTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDVVP 77
           +TP    A  ++   L+  G+ +E   F+T    I  NLYAR GT+ P+L FAGH+DVVP
Sbjct: 1   MTPHADDALELVAKRLEAAGYRVERLTFETGGVPI-PNLYARIGTDGPNLCFAGHVDVVP 59

Query: 78  PGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGD 137
            GD   W + PF+ T+ +G ++GRG VDMKG++A F+AA   F       GS+S LITGD
Sbjct: 60  EGDATQWHHAPFAGTVEDGVLHGRGAVDMKGAVAAFLAAALAF--GRPQRGSLSFLITGD 117

Query: 138 EEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQG 197
           EEGPA++GT K++ W++ +GE  D C++GEPT    +GD  K+GRRGSLSG +T+ G QG
Sbjct: 118 EEGPALDGTVKVVEWLKARGETIDHCVLGEPTNPDALGDAFKVGRRGSLSGILTVKGVQG 177

Query: 198 HVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKM 257
           HVAYPHL +NPI  L+ L+  LT    D G+  F P+N+E+ ++DVGNP  N+IPAQ   
Sbjct: 178 HVAYPHLADNPIPRLLKLIGDLTAAPLDHGSDFFPPSNLEVVSVDVGNPVFNLIPAQATA 237

Query: 258 SFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSK 317
            FN+RFNDL++ ++LK EI  RL     +   L++ + F +  S  FLT     T L++ 
Sbjct: 238 RFNVRFNDLFSLESLKSEIIRRL-----DGAGLTYDLAFQTGASQSFLTAPGPFTDLVAS 292

Query: 318 SIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDLEDLTCIYE 377
           ++   TG  P  STSGGTSDARFIKD CPV+EFGLVGRTMH ++E   ++D+E LT IY 
Sbjct: 293 AVEEVTGRRPEPSTSGGTSDARFIKDICPVVEFGLVGRTMHKVDEATPVKDIEALTAIYG 352

Query: 378 NFLQNWFIT 386
             +  +F T
Sbjct: 353 RIIARYFST 361


>gi|209886646|ref|YP_002290503.1| succinyl-diaminopimelate desuccinylase [Oligotropha carboxidovorans
           OM5]
 gi|238064763|sp|B6JJP4|DAPE_OLICO RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|209874842|gb|ACI94638.1| succinyl-diaminopimelate desuccinylase [Oligotropha carboxidovorans
           OM5]
          Length = 384

 Score =  340 bits (872), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 179/376 (47%), Positives = 229/376 (60%), Gaps = 4/376 (1%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            L+ CPSVTP D GA  +L   LK  GF      F         NLYAR G   PH+ FA
Sbjct: 10  DLLACPSVTPADAGALGVLEKLLKDAGFETYRLTFSEPGADDTDNLYARIGAGHPHITFA 69

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY--KNFG 128
           GH DVVPPGD   W++  F+AT+  G +YGRG VDMKG+IAC  AAV  ++     K  G
Sbjct: 70  GHTDVVPPGDNAAWSHDAFAATVDGGVLYGRGAVDMKGAIACAAAAVLDYLEANGGKPKG 129

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           SIS LITGDEEGPA+NGT K+L W  K+GEK+D C++GEP+  + +GD IK GRRGSLSG
Sbjct: 130 SISFLITGDEEGPAVNGTVKLLDWAAKRGEKFDHCLLGEPSNVNALGDCIKAGRRGSLSG 189

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
            + + GKQGH AYP    NP+  +  L+  L     D G+  F P+N+E  +ID GNP+ 
Sbjct: 190 TLIVEGKQGHAAYPDRAHNPLPEIASLVAALDADPLDQGSDHFPPSNLEFLSIDTGNPAW 249

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHD 308
           NVIPAQ +  FNIR ND   +  L+  I +R+ K   N  +++  + +    +  FLT  
Sbjct: 250 NVIPAQARARFNIRHNDCRTQDALRALIEARVEKLTGN--RITARIEWEPSNADAFLTQP 307

Query: 309 RKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQD 368
              T L+  +I   TG  P L T GGTSDARFI  YCPV+EFGLVG+TMH ++E   + D
Sbjct: 308 GAFTDLVIDAIEEVTGRKPKLDTGGGTSDARFITHYCPVLEFGLVGQTMHQIDERTPVAD 367

Query: 369 LEDLTCIYENFLQNWF 384
           L+ LT IY   L  +F
Sbjct: 368 LDALTQIYRGVLTRYF 383


>gi|262277959|ref|ZP_06055752.1| succinyl-diaminopimelate desuccinylase [alpha proteobacterium
           HIMB114]
 gi|262225062|gb|EEY75521.1| succinyl-diaminopimelate desuccinylase [alpha proteobacterium
           HIMB114]
          Length = 386

 Score =  340 bits (872), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 179/382 (46%), Positives = 244/382 (63%), Gaps = 3/382 (0%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +    +LIK PSVTP+D GA  ++V  LK LGF  +   FQ K T  + NLYA++G +
Sbjct: 6   DEIRFTQELIKKPSVTPKDLGAMNVVVKHLKKLGFKCKLMSFQEKGTDKIVNLYAKYGNQ 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
           +P+L FAGH DVVP GD + W+  PF A I +G +YGRG+ DMKG I CFIAAV++F+ +
Sbjct: 66  SPNLCFAGHTDVVPAGDVSSWSNNPFGAKIKKGYLYGRGVSDMKGCIGCFIAAVSQFLKE 125

Query: 124 YKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
            K F GSIS LITGDEEG AINGTKK++ +++KK EK D CIVGEP+    +G  +KIGR
Sbjct: 126 NKKFKGSISFLITGDEEGVAINGTKKVVEYLKKKKEKIDFCIVGEPSNRSKLGQMMKIGR 185

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGS++  +T+ GKQGH+AYP    NP   +I +L +L +   D GN  F P+N+EIT I 
Sbjct: 186 RGSITTHLTVIGKQGHIAYPLEALNPATPIIKILDELKSKALDKGNKNFQPSNLEITKIS 245

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
           + N + NVIPA+   +FNIR+N L    +LK+ I   + K  +     +  + F      
Sbjct: 246 IDNSADNVIPAKASATFNIRYNTLHTFSSLKKYISKIIKKYEKKYKCKTQ-IQFQG-TGT 303

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNE 362
            FLT   +    +   I   T    +LST GGTSDARFIKD  P IEFGLVG TMH ++E
Sbjct: 304 AFLTKPNQTVKKIQSIIKKETKQNTVLSTIGGTSDARFIKDIAPCIEFGLVGNTMHQVDE 363

Query: 363 NASLQDLEDLTCIYENFLQNWF 384
            +S++D++ L  IY   ++++F
Sbjct: 364 RSSIKDMKKLKSIYLKIIKSFF 385


>gi|238064828|sp|Q5FPX5|DAPE_GLUOX RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 381

 Score =  339 bits (870), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 175/373 (46%), Positives = 229/373 (61%), Gaps = 9/373 (2%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            L++C SVTP DGGA  +L   L+ +GF      F   +     NLYAR G   P L FA
Sbjct: 16  DLLRCQSVTPADGGAQALLAGVLEGMGFETFHLPFGPADVP-TPNLYARLGKGHPALCFA 74

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSI 130
           GH DVVPPG+   W + PF+A I   ++YGRGI DMKG +ACF+AAVAR + +    GS+
Sbjct: 75  GHTDVVPPGE--GWAHDPFAAVIEGDRLYGRGIADMKGGVACFVAAVARRLEQGPLKGSV 132

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           SLLITGDEEGPA  GTK ++ W+ ++GE  D C++GEPT    +GD IKIGRRGS++  +
Sbjct: 133 SLLITGDEEGPAHFGTKPVIEWLAERGELPDFCVLGEPTNPQALGDVIKIGRRGSMNAVV 192

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
           T+HG QGHVAYPHL +NP+  L+    +LT    D G+  F P+++++T+IDVGN + N+
Sbjct: 193 TVHGTQGHVAYPHLADNPVHRLLAAFSELTARELDAGSEWFDPSSLQVTSIDVGNGATNI 252

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IP       NIRFNDL     L   I   + +   + P+    V  S      FLT    
Sbjct: 253 IPGSAVGRLNIRFNDLHTGAALTAWIEDVVRR---HAPQADVQVSIS---GEAFLTQPGD 306

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDLE 370
             + LS+++ + TG  P L T GGTSDARFI  YC V EFGLVG TMH  +EN  L  LE
Sbjct: 307 AVTCLSEAVRSVTGRTPRLDTGGGTSDARFISQYCEVAEFGLVGATMHKRDENVELGTLE 366

Query: 371 DLTCIYENFLQNW 383
           DLT IY  F++ +
Sbjct: 367 DLTRIYLAFMEGY 379


>gi|58040263|ref|YP_192227.1| succinyl-diaminopimelate desuccinylase [Gluconobacter oxydans 621H]
 gi|58002677|gb|AAW61571.1| Succinyl-diaminopimelate desuccinylase [Gluconobacter oxydans 621H]
          Length = 401

 Score =  339 bits (869), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 175/373 (46%), Positives = 229/373 (61%), Gaps = 9/373 (2%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            L++C SVTP DGGA  +L   L+ +GF      F   +     NLYAR G   P L FA
Sbjct: 36  DLLRCQSVTPADGGAQALLAGVLEGMGFETFHLPFGPADVP-TPNLYARLGKGHPALCFA 94

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSI 130
           GH DVVPPG+   W + PF+A I   ++YGRGI DMKG +ACF+AAVAR + +    GS+
Sbjct: 95  GHTDVVPPGE--GWAHDPFAAVIEGDRLYGRGIADMKGGVACFVAAVARRLEQGPLKGSV 152

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           SLLITGDEEGPA  GTK ++ W+ ++GE  D C++GEPT    +GD IKIGRRGS++  +
Sbjct: 153 SLLITGDEEGPAHFGTKPVIEWLAERGELPDFCVLGEPTNPQALGDVIKIGRRGSMNAVV 212

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
           T+HG QGHVAYPHL +NP+  L+    +LT    D G+  F P+++++T+IDVGN + N+
Sbjct: 213 TVHGTQGHVAYPHLADNPVHRLLAAFSELTARELDAGSEWFDPSSLQVTSIDVGNGATNI 272

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IP       NIRFNDL     L   I   + +   + P+    V  S      FLT    
Sbjct: 273 IPGSAVGRLNIRFNDLHTGAALTAWIEDVVRR---HAPQADVQVSIS---GEAFLTQPGD 326

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDLE 370
             + LS+++ + TG  P L T GGTSDARFI  YC V EFGLVG TMH  +EN  L  LE
Sbjct: 327 AVTCLSEAVRSVTGRTPRLDTGGGTSDARFISQYCEVAEFGLVGATMHKRDENVELGTLE 386

Query: 371 DLTCIYENFLQNW 383
           DLT IY  F++ +
Sbjct: 387 DLTRIYLAFMEGY 399


>gi|154250722|ref|YP_001411546.1| succinyl-diaminopimelate desuccinylase [Parvibaculum
           lavamentivorans DS-1]
 gi|238064767|sp|A7HPQ6|DAPE_PARL1 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|154154672|gb|ABS61889.1| succinyl-diaminopimelate desuccinylase [Parvibaculum
           lavamentivorans DS-1]
          Length = 395

 Score =  338 bits (868), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 177/382 (46%), Positives = 241/382 (63%), Gaps = 5/382 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D L+  ++LI+CPSVTP +GGA  +L   L  LGF  E   F  + T  V NLYAR G+ 
Sbjct: 13  DPLDIAVELIRCPSVTPDEGGALGVLEKWLAPLGFKCERMRFSAEGTPDVDNLYARLGSG 72

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PH  FAGH DVVP G  + W+  PF+A I +G++YGRG  DMK ++A F+AA  R I +
Sbjct: 73  HPHFCFAGHTDVVPVGQADAWSVDPFAADIKDGRLYGRGAADMKSAVASFVAAAER-ISR 131

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               GSISLLITGDEEGP+INGT+KML  +  + E  D CIVGEPT    +GD IK+GRR
Sbjct: 132 EGFQGSISLLITGDEEGPSINGTRKMLEKLAARNETIDHCIVGEPTSVEKLGDMIKVGRR 191

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++G +T+ G QGHVAYPHL +NP+  L+ +L +L     D G   F P+N+E+TT+D+
Sbjct: 192 GSINGWLTVQGTQGHVAYPHLADNPVPRLLEMLRRLDAHVLDEGTDHFQPSNLEVTTVDI 251

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS-P 302
           GN + NVIP   + + NIRFNDL    +L + +R  L        ++  +  F + VS  
Sbjct: 252 GNTATNVIPGSARATVNIRFNDLHTGASLDKWMRGVLDA---VTAEMGGSYSFKTSVSGE 308

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNE 362
            F+T     ++L++++    TG  P LST+GGTSDARFI+ Y PV+E GL   TMH  +E
Sbjct: 309 AFITEPGAFSALIAEAAKEVTGITPELSTTGGTSDARFIRAYAPVVEIGLPNATMHKADE 368

Query: 363 NASLQDLEDLTCIYENFLQNWF 384
           N  + ++  L  IYE  L+ +F
Sbjct: 369 NTGVSEIRQLADIYETVLRGYF 390


>gi|162147915|ref|YP_001602376.1| succinyl-diaminopimelate desuccinylase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|238064788|sp|A9HKR2|DAPE_GLUDA RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|161786492|emb|CAP56074.1| putative succinyl-diaminopimelate desuccinylase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 385

 Score =  338 bits (868), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 181/375 (48%), Positives = 227/375 (60%), Gaps = 13/375 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            LI+ PSVTP DGGA  +L   L+ LGF + +  F  +  +   NL+AR G   PHL FA
Sbjct: 18  DLIRAPSVTPDDGGAIGVLTAALRGLGFDVTDLPFG-EGPARTPNLFARLGRSGPHLCFA 76

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVPPGD   WT  PF A + +G +YGRG  DMKG IA F+ AVAR +   +   GS
Sbjct: 77  GHTDVVPPGD-GGWTSGPFEAALRDGCLYGRGACDMKGGIAAFVGAVARILESGRTLRGS 135

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           +SLLITGDEEGPA  GT K+L W+   G+  D C+VGEPT    +GD IKIGRRGSL+  
Sbjct: 136 VSLLITGDEEGPATFGTVKVLEWMAAHGQVPDFCVVGEPTNPDHLGDVIKIGRRGSLNAR 195

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           I + G QGHVAYPH  +NP+  L+ +L  LT    D G   F P+++++TT+DVGN + N
Sbjct: 196 IVVPGIQGHVAYPHRADNPVHRLLAILSDLTARPLDQGTEWFEPSSLQVTTVDVGNEATN 255

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNV--PKLSHTVHFSSPVSPVFLTH 307
           VIP +     NIRFNDL   + L + IR     G+ +V  P    TV  S      F T 
Sbjct: 256 VIPGRATARLNIRFNDLHTGQGLADWIR-----GVAHVHAPGAEVTVQIS---GEAFRTE 307

Query: 308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQ 367
                 +L+ SI   TG  P L T GGTSDARFI  YCPV EFGLVG +MH ++E+  + 
Sbjct: 308 PTPELDMLAASIQAVTGRAPRLDTGGGTSDARFISRYCPVAEFGLVGASMHKVDEHVPVA 367

Query: 368 DLEDLTCIYENFLQN 382
           DL  LT IY  FL+ 
Sbjct: 368 DLLALTDIYAAFLER 382


>gi|114569000|ref|YP_755680.1| succinyl-diaminopimelate desuccinylase [Maricaulis maris MCS10]
 gi|122316776|sp|Q0ASJ5|DAPE_MARMM RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|114339462|gb|ABI64742.1| succinyldiaminopimelate desuccinylase [Maricaulis maris MCS10]
          Length = 390

 Score =  337 bits (864), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 180/374 (48%), Positives = 235/374 (62%), Gaps = 9/374 (2%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+ PSVTP D GA  ++   L+ LGF+     F       V NLYAR GT +P  +FAG
Sbjct: 20  LIRRPSVTPIDAGALDVMQAALEQLGFTCRRYPFGE-----VDNLYARRGTASPCFLFAG 74

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSIS 131
           H DVVPPGD + W  PPF A   +G ++GRG  DMKG+IA  +A+V RF+   +  GSI+
Sbjct: 75  HTDVVPPGDDDAWRKPPFGAEAEDGVLWGRGAADMKGAIAAMVASVQRFLDTGEPKGSIA 134

Query: 132 LLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEIT 191
            LITGDEEGPAI+GTK +L  +  +GE +D C+VGEPT  +++GDTIK GRRGSL+  +T
Sbjct: 135 FLITGDEEGPAIHGTKAVLEALADEGETFDHCLVGEPTNPNVLGDTIKSGRRGSLNCTLT 194

Query: 192 IHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVI 251
           + G+QGHVAYP   ENPI  L+ LL +L     D G   F P+N+E+T++DVGNP+ NVI
Sbjct: 195 VTGRQGHVAYPERAENPIPALLDLLGRLLARKLDDGVPPFQPSNLEVTSVDVGNPTTNVI 254

Query: 252 PAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           PA     FNIRFN   N   L + IRS + K  +    ++   +H +      FLT    
Sbjct: 255 PAAATARFNIRFNIAHNGDALSDWIRSEVAKIDLDFDGRIEADIHVT---GEAFLTPAGP 311

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDLE 370
            T+LL   +   TG  P L+T GGTSDARFI+ Y PV EFGLVG TMH ++E   + D+E
Sbjct: 312 FTTLLQDCVEAETGRRPALTTGGGTSDARFIQLYAPVAEFGLVGATMHQVDERVPVSDIE 371

Query: 371 DLTCIYENFLQNWF 384
            LT IY   L+ +F
Sbjct: 372 TLTAIYTRILKGYF 385


>gi|254456001|ref|ZP_05069430.1| succinyl-diaminopimelate desuccinylase [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207083003|gb|EDZ60429.1| succinyl-diaminopimelate desuccinylase [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 385

 Score =  336 bits (862), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 184/385 (47%), Positives = 239/385 (62%), Gaps = 5/385 (1%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           T + L+   +LIK P+VTP D G    L   LK LGF  +  +F+ KN+  VKNLYAR G
Sbjct: 3   TINELQLAKELIKFPTVTPIDAGIMKFLEKKLKTLGFKTKILEFKEKNSKPVKNLYARLG 62

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
            + P+  +AGH+DVVP G+   WT  PF  +I +G + GRG  DMK S+A F++AV+ FI
Sbjct: 63  NKGPNFCYAGHLDVVPAGNLKDWTVNPFKPSIKKGFLIGRGANDMKSSVAAFVSAVSNFI 122

Query: 122 PKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
            K + F GSISLLITGDEEG AINGTKK++ ++ KK EK D C+VGEPT  + +G+ IKI
Sbjct: 123 SKERQFNGSISLLITGDEEGVAINGTKKVVKYLRKKKEKIDFCLVGEPTNPNKLGEMIKI 182

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGS++G++TI G QGHVAYP    NP   LI +L +L  I FD G   F PTN+EIT 
Sbjct: 183 GRRGSMTGKLTIIGIQGHVAYPDRANNPSTALIQILKELKEIKFDNGTKDFQPTNLEITK 242

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV 300
           I++ N + NVIP      FNIRFN   N+ +     +       +   K     +    V
Sbjct: 243 INIDNFADNVIPGSANAKFNIRFN---NKHSSNSIKKKIDKIIKRICKKNKSKFNIDYSV 299

Query: 301 S-PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
           S   FLT     T ++   I   T   P LST+GGTSDARFI+   P +EFGLVG+TMH 
Sbjct: 300 SGEAFLTKPNDTTYMIRDEIKKITKIKPKLSTTGGTSDARFIRKIAPCLEFGLVGKTMHK 359

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           ++E  SL DL+ LT IY N L+N+F
Sbjct: 360 VDEAVSLSDLKKLTLIYSNILKNYF 384


>gi|294085064|ref|YP_003551824.1| acetylornithine deacetylase-like protein [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292664639|gb|ADE39740.1| Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase
           and related deacylase [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 392

 Score =  335 bits (859), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 182/385 (47%), Positives = 236/385 (61%), Gaps = 19/385 (4%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG------TEA 64
           +LI+CPSVTP D GA  +LV  L  LGF      F   +  I  NL+A  G      TE 
Sbjct: 13  RLIRCPSVTPADAGALDVLVTELTALGFECTRLAFGDGDARI-DNLFAWLGNKAASGTET 71

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
            H  FAGH DVVP GD + W + PFS T+ +G IYGRG  DMKG IA F+ AVAR + + 
Sbjct: 72  KHFCFAGHTDVVPVGDADAWQFDPFSGTLDQGNIYGRGASDMKGGIAAFVGAVARLLAR- 130

Query: 125 KNFG-----SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
            +F      +ISL+ITGDEEG A+NGT KM+ W+++ G   D C+VGEPT    +GD IK
Sbjct: 131 DSFDPAKGHAISLMITGDEEGDAVNGTVKMVEWVQEHGFVPDFCVVGEPTNPDAVGDVIK 190

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSLS ++T+ G QGHVAYPHL +NP   L+ +L  + +   D GN  F P+   IT
Sbjct: 191 NGRRGSLSCQLTVEGAQGHVAYPHLADNPFARLLDMLAPVNSCELDGGNAFFDPSTANIT 250

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           +ID  NP+ NVIPA+ +  FNIRFN    E T  + +   L +    V  + H   + + 
Sbjct: 251 SIDTNNPAGNVIPARAQARFNIRFN---TEHT-ADSLIGWLEEHFTRVGGIWH-ADWRAS 305

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
             P FLT    LT ++  +I   TG  P LSTSGGTSDARFI   CPV EFGLVGRTMH 
Sbjct: 306 AHP-FLTEPGMLTDIMIAAISKVTGRDPQLSTSGGTSDARFITTLCPVAEFGLVGRTMHK 364

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           ++E+ ++ D++ L+ IYEN L ++F
Sbjct: 365 VDEHTAIADIDVLSAIYENMLASYF 389


>gi|73666727|ref|YP_302743.1| succinyl-diaminopimelate desuccinylase [Ehrlichia canis str. Jake]
 gi|72393868|gb|AAZ68145.1| succinyldiaminopimelate desuccinylase [Ehrlichia canis str. Jake]
          Length = 389

 Score =  335 bits (859), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 180/385 (46%), Positives = 240/385 (62%), Gaps = 9/385 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D ++   +LI  PS+TP D GA   L NTL   GF+     F       V+NLYA+ 
Sbjct: 10  MAIDPIKLSQELISFPSITPTDNGAIDFLSNTLSQYGFTCHVLTFGDDQVQ-VRNLYAQL 68

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G  +P+L FAGH DVVP GD   W + PFS  I +  +YGRG+VDMK +I  F+AAV+R 
Sbjct: 69  GNGSPNLCFAGHTDVVPTGDSEKWKFDPFSGKIEDNILYGRGVVDMKSAICAFVAAVSRI 128

Query: 121 IPKYKNFGSISLLITGDEEGPAIN-GTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
                N GSIS LI+GDEEG     GT  +L W+    +K D C+VGEPT    +GDTIK
Sbjct: 129 DFNQIN-GSISFLISGDEEGNYFKYGTPAVLKWLTDNNKKIDFCLVGEPTSQSSVGDTIK 187

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGS++ +I  +G QGHVAYPHL ENP+  +I +L++++N   D GN  F P+N EIT
Sbjct: 188 IGRRGSINFKIVCNGVQGHVAYPHLAENPVDNMISILYKISNTVLDNGNEYFQPSNCEIT 247

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           ++DVGN + NVIP ++  + NIR+ND+   ++L   I + +   I    +L   V  SS 
Sbjct: 248 SVDVGNTATNVIPDKITANLNIRYNDMHTSESLF-NIINNICAEITEKYELFTAVSGSS- 305

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
               F+TH  K + +LS +I   TG   +LSTSGGTSDARFIKD+CPVIE GL   T H 
Sbjct: 306 ----FITHPGKHSDMLSSAIKKVTGQDAILSTSGGTSDARFIKDFCPVIELGLSNETAHK 361

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           +NE+A + D+  LT IYE F++ +F
Sbjct: 362 INEHAPVDDIYKLTDIYEEFIRQFF 386


>gi|238064833|sp|Q3YT10|DAPE_EHRCJ RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 380

 Score =  335 bits (858), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 180/385 (46%), Positives = 240/385 (62%), Gaps = 9/385 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D ++   +LI  PS+TP D GA   L NTL   GF+     F       V+NLYA+ 
Sbjct: 1   MAIDPIKLSQELISFPSITPTDNGAIDFLSNTLSQYGFTCHVLTFGDDQVQ-VRNLYAQL 59

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G  +P+L FAGH DVVP GD   W + PFS  I +  +YGRG+VDMK +I  F+AAV+R 
Sbjct: 60  GNGSPNLCFAGHTDVVPTGDSEKWKFDPFSGKIEDNILYGRGVVDMKSAICAFVAAVSRI 119

Query: 121 IPKYKNFGSISLLITGDEEGPAIN-GTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
                N GSIS LI+GDEEG     GT  +L W+    +K D C+VGEPT    +GDTIK
Sbjct: 120 DFNQIN-GSISFLISGDEEGNYFKYGTPAVLKWLTDNNKKIDFCLVGEPTSQSSVGDTIK 178

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGS++ +I  +G QGHVAYPHL ENP+  +I +L++++N   D GN  F P+N EIT
Sbjct: 179 IGRRGSINFKIVCNGVQGHVAYPHLAENPVDNMISILYKISNTVLDNGNEYFQPSNCEIT 238

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           ++DVGN + NVIP ++  + NIR+ND+   ++L   I + +   I    +L   V  SS 
Sbjct: 239 SVDVGNTATNVIPDKITANLNIRYNDMHTSESLF-NIINNICAEITEKYELFTAVSGSS- 296

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
               F+TH  K + +LS +I   TG   +LSTSGGTSDARFIKD+CPVIE GL   T H 
Sbjct: 297 ----FITHPGKHSDMLSSAIKKVTGQDAILSTSGGTSDARFIKDFCPVIELGLSNETAHK 352

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           +NE+A + D+  LT IYE F++ +F
Sbjct: 353 INEHAPVDDIYKLTDIYEEFIRQFF 377


>gi|330993397|ref|ZP_08317332.1| Succinyl-diaminopimelate desuccinylase [Gluconacetobacter sp.
           SXCC-1]
 gi|329759427|gb|EGG75936.1| Succinyl-diaminopimelate desuccinylase [Gluconacetobacter sp.
           SXCC-1]
          Length = 385

 Score =  334 bits (857), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 175/373 (46%), Positives = 229/373 (61%), Gaps = 8/373 (2%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            LI+CPSVTP DG A   L   L+ +GFS+    F  + ++   NL+AR GT  PH+ FA
Sbjct: 17  DLIRCPSVTPDDGCAIKTLAAVLERIGFSVTMLPFG-EGSAHTPNLFARLGTAQPHICFA 75

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVP GD   W + PF   I +G ++GRG  DMKG IA F+AAV  ++ K     GS
Sbjct: 76  GHTDVVPVGDAAQWCHDPFGGEIHDGILFGRGACDMKGGIAAFVAAVRLYLHKVGTPPGS 135

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           ISLLITGDEEGPA NGT ++L W+ +  +  D C+VGEPT    +G+ IKIGRRGSL+  
Sbjct: 136 ISLLITGDEEGPATNGTVRVLEWMAEHDQIPDFCVVGEPTNPAGMGEMIKIGRRGSLNAR 195

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           I + G QGHVAYPH  +NP+  L+ LL++LT    D G+  F  +++++T++DVGN + N
Sbjct: 196 IVVPGTQGHVAYPHRADNPVHRLLALLNELTAAPLDGGSDWFEASSLQVTSLDVGNTATN 255

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIPAQ +   NIRFNDL     L   +R+      ++ P+    +  S      FLT   
Sbjct: 256 VIPAQAEARLNIRFNDLHTGADLAGWLRT---VAARHAPRARVDISIS---GESFLTEPG 309

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDL 369
                L  S+   TG++P L T GGTSDARFI  YCPV EFGLVG +MH  +E+ SL DL
Sbjct: 310 VAVEALRASVRAVTGHVPRLDTGGGTSDARFIARYCPVAEFGLVGASMHKTDEHVSLTDL 369

Query: 370 EDLTCIYENFLQN 382
             LT IY  FL+ 
Sbjct: 370 RQLTAIYTGFLEK 382


>gi|329114450|ref|ZP_08243212.1| Succinyl-diaminopimelate desuccinylase [Acetobacter pomorum DM001]
 gi|326696526|gb|EGE48205.1| Succinyl-diaminopimelate desuccinylase [Acetobacter pomorum DM001]
          Length = 391

 Score =  333 bits (855), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 167/371 (45%), Positives = 228/371 (61%), Gaps = 7/371 (1%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+ PSV+P  G +  +L   L+ LGF +    F  +      N +AR GT +PH+ +AG
Sbjct: 25  LIRLPSVSPDPGASQHLLAAMLERLGFEVTHLPF-GEGAERTPNFFARLGTGSPHICYAG 83

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSIS 131
           H DVVPPGD   W+YPP++A I +G +YGRG  DMKG IA F++AVAR +      GSIS
Sbjct: 84  HTDVVPPGDEADWSYPPYAADIVDGVLYGRGACDMKGGIASFVSAVARHVAAGPGKGSIS 143

Query: 132 LLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEIT 191
            LITGDEEGPA  GT K+L W+ +  +  D C+VGEPT   ++G+ +K+GRRGSL+  I 
Sbjct: 144 FLITGDEEGPATYGTVKVLEWMAQHNQIPDYCLVGEPTNPKVLGEMVKVGRRGSLNAHIV 203

Query: 192 IHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVI 251
           + G QGHVAYPH  +NP+  L+ +L  L     D G   F P+++++T++DVGN + NVI
Sbjct: 204 VEGTQGHVAYPHRADNPVHRLLAVLEALRATPLDNGTEYFEPSSLQVTSVDVGNGATNVI 263

Query: 252 PAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKL 311
           PA+ +   NIRFNDL     LK  + +      Q+ P+       S      FLT   + 
Sbjct: 264 PARAEARLNIRFNDLHTGAALKGWVETIC---RQHAPRSRVETKIS---GESFLTSPTQE 317

Query: 312 TSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDLED 371
           T+ L ++I   TG  P L T GGTSDARFI  YC V EFGLVG ++H ++E+  + DLE 
Sbjct: 318 TTALVEAIQQVTGRTPKLDTGGGTSDARFISRYCAVSEFGLVGASIHKVDEHTDIADLEM 377

Query: 372 LTCIYENFLQN 382
           LT IY+ FL+ 
Sbjct: 378 LTRIYQTFLEG 388


>gi|296115063|ref|ZP_06833705.1| succinyl-diaminopimelate desuccinylase [Gluconacetobacter hansenii
           ATCC 23769]
 gi|295978400|gb|EFG85136.1| succinyl-diaminopimelate desuccinylase [Gluconacetobacter hansenii
           ATCC 23769]
          Length = 400

 Score =  333 bits (853), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 172/373 (46%), Positives = 229/373 (61%), Gaps = 10/373 (2%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           L++CPSVTP DG A  +L   L+ +GF++    F  +  +   NL+AR GT  PH+ FAG
Sbjct: 33  LLRCPSVTPDDGCAIDVLATVLRDMGFAVTSLPFG-EGDAYTPNLFARLGTGHPHVCFAG 91

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF--GS 129
           H DVVP GD   W   PF A I +G +YGRG  DMKG IA F+AA+  ++ ++     GS
Sbjct: 92  HTDVVPVGDAA-WRSDPFGAQIHDGLLYGRGACDMKGGIAAFVAAIRCYLARHGGTIPGS 150

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           +SLLITGDEEGPA NGT ++L W+   G+  D C+VGEPT    +G+ IKIGRRGSL+  
Sbjct: 151 VSLLITGDEEGPATNGTVRVLEWMAANGQIPDFCLVGEPTNPQQMGEVIKIGRRGSLNAT 210

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           IT+ G QGHVAYPH  +NP+  L+ LLH+LT    DTG+  F  +++++T++DVGN + N
Sbjct: 211 ITVTGVQGHVAYPHRADNPVHRLLALLHELTVAPLDTGSEWFESSSLQVTSVDVGNTATN 270

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIPA     FNIRFNDL     L   IR+   +   + P     +  S      FLT   
Sbjct: 271 VIPATACARFNIRFNDLHTGADLSGWIRTVCAR---HAPGADVQIRIS---GESFLTQPT 324

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDL 369
                L  ++   TG +P L T GGTSDARFI  YCPV EFGLVG +MH ++E+  + DL
Sbjct: 325 AGVDALRDAVTAVTGQMPRLDTGGGTSDARFISQYCPVAEFGLVGASMHKVDEHVPVADL 384

Query: 370 EDLTCIYENFLQN 382
             L  IY+ F++ 
Sbjct: 385 TQLARIYDRFVER 397


>gi|297182647|gb|ADI18805.1| acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase
           and related deacylases [uncultured SAR11 cluster
           bacterium HF4000_37C10]
          Length = 379

 Score =  332 bits (852), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 181/377 (48%), Positives = 243/377 (64%), Gaps = 12/377 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           +LI+ PSVTP+D GA  IL   L+ LGF  +  +F       +KNLYA+ GT +P+  FA
Sbjct: 11  ELIRRPSVTPRDAGAINILTKNLRSLGFKCQMMNFNN-----IKNLYAKLGTSSPNFCFA 65

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIP-KYKNFGS 129
           GH DVVP GD   W+  PFS T+   K+ GRG  DMKGSIACFIAA+++F   K K  GS
Sbjct: 66  GHTDVVPVGDLKSWSVNPFSGTVKNNKLIGRGASDMKGSIACFIAALSQFKKIKLKFKGS 125

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           ISLLITGDEE  AINGTKK++  ++K+ EK + C+VGEPT    +G  +KIGRRGS++G 
Sbjct: 126 ISLLITGDEEAIAINGTKKVVEKLKKRKEKINFCLVGEPTNLTKLGQMMKIGRRGSITGY 185

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +T++G QGHVAYPH   NP   +  +L+Q+ N+  D G   F P+N+E+  I++ N + N
Sbjct: 186 LTVYGTQGHVAYPHQANNPAPVITKILNQIENMKLDRGTKNFQPSNLEVVNINIENTADN 245

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSH-TVHFSSPVS-PVFLTH 307
           VIPA+   +FNIRFN+  +  +LK+    +L K   NV + S  +   S  VS   FLT 
Sbjct: 246 VIPAEATATFNIRFNNKHSSGSLKK----KLNKVFSNVCRRSGCSFKISYMVSGEAFLTT 301

Query: 308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQ 367
             K T ++ K I   T   P LST+GGTSDARFI+   P +EFGLVG+T H ++E  S+ 
Sbjct: 302 PNKTTYMIQKIIKKITKVKPKLSTAGGTSDARFIRKISPCVEFGLVGKTAHKVDEMVSVA 361

Query: 368 DLEDLTCIYENFLQNWF 384
           D++ L  IY N LQN+F
Sbjct: 362 DMKKLKKIYLNILQNYF 378


>gi|67459768|ref|YP_247392.1| succinyl-diaminopimelate desuccinylase [Rickettsia felis URRWXCal2]
 gi|75535842|sp|Q4UJR2|DAPE_RICFE RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|67005301|gb|AAY62227.1| Succinyl-diaminopimelate desuccinylase [Rickettsia felis URRWXCal2]
          Length = 381

 Score =  332 bits (850), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 177/377 (46%), Positives = 233/377 (61%), Gaps = 4/377 (1%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           + +L  LI   SVTP+  GA   + + LK  GF  E K F    +    NLYA FG+  P
Sbjct: 3   INYLKDLIGFKSVTPESDGAIEYIDDLLKQHGFKTEIKIFGDSKSEQATNLYAVFGSNEP 62

Query: 66  HLMFAGHIDVVPPGDFNHW-TYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           ++ F GH+DVVP G+   W    PF A+  +GKIYGRG VDMKG+IACF+AA   FI   
Sbjct: 63  NICFVGHVDVVPAGNHELWHNASPFKASHQDGKIYGRGAVDMKGAIACFLAASLDFIKNN 122

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
             F GSIS L+T DEEG A +GTK+ML +I  +G K D  IVGEPTC   IGDTIKIGRR
Sbjct: 123 TGFKGSISFLLTSDEEGKAKHGTKEMLQYIYDQGHKMDFAIVGEPTCEKEIGDTIKIGRR 182

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++ ++ I G  GHVAYPH   NP+  LI +L++LTNI  D G   F  +N+E+T IDV
Sbjct: 183 GSVNFKLNIEGLSGHVAYPHKANNPLPCLIKILNELTNIRLDKGTEFFQSSNLEVTNIDV 242

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GN + NVIPA  + SFNIRFN+L + +TL +++   +IK      K+ + + +SS     
Sbjct: 243 GNNTSNVIPASTEASFNIRFNNLHSAETLAKQVE-EIIKRYCKEYKVDYKLEYSSSADSF 301

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
               + K+    +  +       P  STSGGTSDARF+KDYCP++EFGL+  T H +NE 
Sbjct: 302 IQNPNDKIKD-FADIVERVLKIKPEFSTSGGTSDARFVKDYCPLVEFGLLSETAHKINEY 360

Query: 364 ASLQDLEDLTCIYENFL 380
             + DL+ L  +Y NFL
Sbjct: 361 TKISDLQKLYDVYYNFL 377


>gi|258541766|ref|YP_003187199.1| succinyl-diaminopimelate desuccinylase [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256632844|dbj|BAH98819.1| acetylornithine deacetylase [Acetobacter pasteurianus IFO 3283-01]
 gi|256635901|dbj|BAI01870.1| acetylornithine deacetylase [Acetobacter pasteurianus IFO 3283-03]
 gi|256638956|dbj|BAI04918.1| acetylornithine deacetylase [Acetobacter pasteurianus IFO 3283-07]
 gi|256642010|dbj|BAI07965.1| acetylornithine deacetylase [Acetobacter pasteurianus IFO 3283-22]
 gi|256645065|dbj|BAI11013.1| acetylornithine deacetylase [Acetobacter pasteurianus IFO 3283-26]
 gi|256648120|dbj|BAI14061.1| acetylornithine deacetylase [Acetobacter pasteurianus IFO 3283-32]
 gi|256651173|dbj|BAI17107.1| acetylornithine deacetylase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654164|dbj|BAI20091.1| acetylornithine deacetylase [Acetobacter pasteurianus IFO 3283-12]
          Length = 391

 Score =  331 bits (849), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 165/371 (44%), Positives = 230/371 (61%), Gaps = 7/371 (1%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+ PSV+P  G + ++L   L+ LGF +    F  +      N +AR GT +PH+ +AG
Sbjct: 25  LIRLPSVSPDPGASQYLLAAMLERLGFEVIHLPF-GEGAERTPNFFARLGTGSPHICYAG 83

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSIS 131
           H DVVPPG+   W++PP++A I +G +YGRG  DMKG IA F++AVAR +      GSIS
Sbjct: 84  HTDVVPPGNEADWSHPPYAADIVDGVLYGRGACDMKGGIAAFVSAVARHVAAGPGKGSIS 143

Query: 132 LLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEIT 191
            LITGDEEGPA  GT K+L W+ +  +  D C+VGEPT   ++G+ +K+GRRGSL+  I 
Sbjct: 144 FLITGDEEGPATYGTVKVLEWMAQHNQIPDYCLVGEPTNPKVLGEMVKVGRRGSLNAHIV 203

Query: 192 IHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVI 251
           + G QGHVAYPH  +NP+  L+ +L  L     D G   F P+++++T++DVGN + NVI
Sbjct: 204 VEGTQGHVAYPHRADNPVHRLLAVLEALRATPLDNGTEYFEPSSLQVTSVDVGNGATNVI 263

Query: 252 PAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKL 311
           PA+ +   NIRFNDL     LK  + +      Q+ P+    +  S      FLT   + 
Sbjct: 264 PARAEARLNIRFNDLHTGAALKGWVETVC---RQHAPRSRVEIKIS---GESFLTSPTQE 317

Query: 312 TSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDLED 371
           T+ L ++I   TG  P L T GGTSDARFI  YC V EFGLVG ++H ++E+  + DLE 
Sbjct: 318 TTALVEAIKQVTGRTPKLDTGGGTSDARFISRYCAVSEFGLVGASIHKVDEHTDVADLEM 377

Query: 372 LTCIYENFLQN 382
           LT IY+ FL+ 
Sbjct: 378 LTRIYQTFLEG 388


>gi|238064821|sp|A8GQ98|DAPE_RICAH RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 381

 Score =  330 bits (846), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 179/377 (47%), Positives = 237/377 (62%), Gaps = 4/377 (1%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           + +L  LI   SVTP++ GA   + + LK  GF  E K F    +  V NLYA FG   P
Sbjct: 3   IHYLKDLIGFKSVTPENDGAIEYIDDLLKQHGFKTEIKIFGDFKSEQVTNLYAIFGRNEP 62

Query: 66  HLMFAGHIDVVPPGDFNHW-TYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           ++ F GH+DVVP  +   W    PF A+  +GKIYGRG VDMKG+IACF+AA   FI   
Sbjct: 63  NICFVGHVDVVPVDNHALWHNSSPFKASKQDGKIYGRGAVDMKGAIACFLAASLDFIKNN 122

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
             F GSIS L+T DEEG A +GTK+ML +I  +G K D  IVGEPTC   IGDTIKIGRR
Sbjct: 123 AGFKGSISFLLTSDEEGKAKHGTKEMLQYIYDQGYKVDFAIVGEPTCEKEIGDTIKIGRR 182

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++ ++ I G  GHVAYPH   NP+  LI +LH+LTNI  D G   F  +N+E+T IDV
Sbjct: 183 GSVNFKLNIDGLAGHVAYPHKANNPLPCLIKILHELTNIRLDEGTEFFQNSNLEVTNIDV 242

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GN + NVIPA  + SFNIRFN+L + +TL +++   +IK      K+ + + +SS  +  
Sbjct: 243 GNETSNVIPASTEASFNIRFNNLHSAETLAKQVE-EIIKRYCKEYKVDYKLEYSS-FAGS 300

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           F+ +        +K + +T    P  STSGGTSDARF+K+YCP++EFGL+  T H +NE 
Sbjct: 301 FIQNPSAKIKEFAKVVEHTLKIKPKFSTSGGTSDARFVKNYCPLVEFGLLSETAHKINEY 360

Query: 364 ASLQDLEDLTCIYENFL 380
             + DL+ L  +Y NFL
Sbjct: 361 TKISDLQKLYDVYYNFL 377


>gi|88658597|ref|YP_506972.1| succinyl-diaminopimelate desuccinylase [Ehrlichia chaffeensis str.
           Arkansas]
 gi|123493886|sp|Q2GHW1|DAPE_EHRCR RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|88600054|gb|ABD45523.1| succinyl-diaminopimelate desuccinylase [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 381

 Score =  330 bits (845), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 174/375 (46%), Positives = 228/375 (60%), Gaps = 9/375 (2%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           +LI  PS+TP D GA   L NTL   GF+     F      +  NLYA+ G   P+L FA
Sbjct: 11  ELISFPSITPTDNGAIDFLSNTLSQYGFTCNVLTFGNDEVQVC-NLYAQLGNGHPNLCFA 69

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSI 130
           GH DVVP GD   W + PFS  I +  +YGRG VDMK +I  FIAAV+R      N G+I
Sbjct: 70  GHTDVVPTGDLEKWKFDPFSGHIEDNILYGRGAVDMKSAICAFIAAVSRIDFNQVN-GAI 128

Query: 131 SLLITGDEEGPAIN-GTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           SL+I+GDEEG     GT  +L W+    +K D C+VGEPT    +GDTIKIGRRGS++ +
Sbjct: 129 SLMISGDEEGNHFKYGTPAILKWLTDNNKKIDYCLVGEPTSKSSVGDTIKIGRRGSINFK 188

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           I  +G QGHVAYPHL +NPI  +I +LH++ N   D GN  F P+N EIT++DVGN + N
Sbjct: 189 IVCNGVQGHVAYPHLAQNPINDMINILHKINNTVLDEGNEYFQPSNCEITSVDVGNTANN 248

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP  V    NIR+N++   ++L   I +   +  Q          F+S     F+ +  
Sbjct: 249 VIPGTVTAHLNIRYNNIHTSESLFNIINNICAETTQKYQI------FTSLSGDPFINYPD 302

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDL 369
           K + +LS +I  TTG   ++STSGGTSDARFIKD+CPVIE GL   T H +NEN S+ D+
Sbjct: 303 KYSDMLSAAIKKTTGETAVISTSGGTSDARFIKDFCPVIELGLKNDTAHKINENTSVDDI 362

Query: 370 EDLTCIYENFLQNWF 384
             L  IYE F++ +F
Sbjct: 363 NKLANIYEEFIKQFF 377


>gi|296535608|ref|ZP_06897788.1| succinyl-diaminopimelate desuccinylase [Roseomonas cervicalis ATCC
           49957]
 gi|296264063|gb|EFH10508.1| succinyl-diaminopimelate desuccinylase [Roseomonas cervicalis ATCC
           49957]
          Length = 376

 Score =  329 bits (843), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 171/384 (44%), Positives = 231/384 (60%), Gaps = 10/384 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D L  L  LI+CPSVTP +GGA  +L   L+ LGF+     F       V+NL+AR G+ 
Sbjct: 2   DPLPLLQDLIRCPSVTPAEGGALGVLEAALRPLGFTCTRLVFGPPGQE-VENLFARRGSG 60

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
           APHL FAGH DVVPPGD   W+  PF A + +G + GRG  DMKG IA ++AA+A     
Sbjct: 61  APHLCFAGHTDVVPPGDPALWSTDPFGAELRDGLVMGRGATDMKGGIAAWVAAIASLPAD 120

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               GS+SLLITGDEEGPA +GT K+L W+ + G   D C+VGEPT   ++GDTIKIGRR
Sbjct: 121 LP--GSLSLLITGDEEGPAEHGTVKVLEWMAEHGHTPDLCVVGEPTSKAVLGDTIKIGRR 178

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL+  IT+ G QGH AYP   +NP+  L+ +LH+LT    D+G+  F P+ +++T+ DV
Sbjct: 179 GSLNAAITVQGVQGHAAYPQRADNPVHRLVRVLHRLTAQPLDSGSEWFEPSTLQVTSFDV 238

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GNP+ NVIP   +   NIRFNDL +  +L   + + L        +  +T+  S      
Sbjct: 239 GNPATNVIPGTARAQLNIRFNDLHSSASLTAMLHAAL-----RAEEARYTLETSC-SGES 292

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           FLT      + L +++    G  P L T GGTSDARFI  +CPV E G VG TMH  +E 
Sbjct: 293 FLTQPGPFVAALRRAVAEAAGVEPRLDTGGGTSDARFITRHCPVAELGAVGATMHKADEC 352

Query: 364 ASLQDLEDLTCIYENFLQNWFITP 387
             +++L  L+ +Y   ++   +TP
Sbjct: 353 TPVEELRALSRLYAAVIRQ-LLTP 375


>gi|167648517|ref|YP_001686180.1| succinyl-diaminopimelate desuccinylase [Caulobacter sp. K31]
 gi|167350947|gb|ABZ73682.1| succinyl-diaminopimelate desuccinylase [Caulobacter sp. K31]
          Length = 388

 Score =  329 bits (843), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 174/377 (46%), Positives = 230/377 (61%), Gaps = 17/377 (4%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+ PSVTP D GA  +L   L+ LGF+     F       ++NLYAR GTE P+L FAG
Sbjct: 21  LIRRPSVTPADEGAMDVLQRQLEALGFNCRRMKFGE-----IENLYARRGTERPNLCFAG 75

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA---RFIPKYKNFG 128
           H DVVP GD   WT  PF A I +G +YGRG VDMK +IA F+AAV+   R +P     G
Sbjct: 76  HTDVVPVGDSAAWTQGPFEAEIQDGMLYGRGAVDMKSAIAAFVAAVSNLPRDLP-----G 130

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           S+S LITGDEEG A +GT +++  +  +GE  D CIVGEPT  +++GD +KIGRRGS++ 
Sbjct: 131 SLSFLITGDEEGVAEDGTVRVVQALAAEGEVIDHCIVGEPTSANLLGDMVKIGRRGSINA 190

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
            I + G+QGHVAYP    NPI  ++ +L +L +   D G   F P+N+E+TTIDVGN + 
Sbjct: 191 WIAVDGRQGHVAYPQRAANPIPVMVDILSRLQSRVLDEGYEGFQPSNLEVTTIDVGNTAT 250

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV-SPVFLTH 307
           NVIPA  K   NIRFN     K L+  I              S  V     +    FLT 
Sbjct: 251 NVIPASAKARINIRFNPAHQGKDLRAWIEQECRDAADG---FSGRVEALCKIGGEAFLTQ 307

Query: 308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQ 367
               T ++  ++ + TG +P LST+GGTSDARFI+  CPV+EFGLVG TMHA++E   +Q
Sbjct: 308 PGAFTDVIVAAVGDATGRVPELSTTGGTSDARFIRSLCPVVEFGLVGATMHAVDERVPVQ 367

Query: 368 DLEDLTCIYENFLQNWF 384
           ++ DL  IY+  +  +F
Sbjct: 368 EIRDLANIYQALIGRYF 384


>gi|238064721|sp|B0T134|DAPE_CAUSK RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 387

 Score =  329 bits (843), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 174/377 (46%), Positives = 230/377 (61%), Gaps = 17/377 (4%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+ PSVTP D GA  +L   L+ LGF+     F       ++NLYAR GTE P+L FAG
Sbjct: 20  LIRRPSVTPADEGAMDVLQRQLEALGFNCRRMKFGE-----IENLYARRGTERPNLCFAG 74

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA---RFIPKYKNFG 128
           H DVVP GD   WT  PF A I +G +YGRG VDMK +IA F+AAV+   R +P     G
Sbjct: 75  HTDVVPVGDSAAWTQGPFEAEIQDGMLYGRGAVDMKSAIAAFVAAVSNLPRDLP-----G 129

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           S+S LITGDEEG A +GT +++  +  +GE  D CIVGEPT  +++GD +KIGRRGS++ 
Sbjct: 130 SLSFLITGDEEGVAEDGTVRVVQALAAEGEVIDHCIVGEPTSANLLGDMVKIGRRGSINA 189

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
            I + G+QGHVAYP    NPI  ++ +L +L +   D G   F P+N+E+TTIDVGN + 
Sbjct: 190 WIAVDGRQGHVAYPQRAANPIPVMVDILSRLQSRVLDEGYEGFQPSNLEVTTIDVGNTAT 249

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV-SPVFLTH 307
           NVIPA  K   NIRFN     K L+  I              S  V     +    FLT 
Sbjct: 250 NVIPASAKARINIRFNPAHQGKDLRAWIEQECRDAADG---FSGRVEALCKIGGEAFLTQ 306

Query: 308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQ 367
               T ++  ++ + TG +P LST+GGTSDARFI+  CPV+EFGLVG TMHA++E   +Q
Sbjct: 307 PGAFTDVIVAAVGDATGRVPELSTTGGTSDARFIRSLCPVVEFGLVGATMHAVDERVPVQ 366

Query: 368 DLEDLTCIYENFLQNWF 384
           ++ DL  IY+  +  +F
Sbjct: 367 EIRDLANIYQALIGRYF 383


>gi|157826361|ref|YP_001494081.1| succinyl-diaminopimelate desuccinylase [Rickettsia akari str.
           Hartford]
 gi|157800319|gb|ABV75573.1| succinyl-diaminopimelate desuccinylase [Rickettsia akari str.
           Hartford]
          Length = 373

 Score =  327 bits (839), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 177/371 (47%), Positives = 234/371 (63%), Gaps = 4/371 (1%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           +I   SVTP++ GA   + + LK  GF  E K F    +  V NLYA FG   P++ F G
Sbjct: 1   MIGFKSVTPENDGAIEYIDDLLKQHGFKTEIKIFGDFKSEQVTNLYAIFGRNEPNICFVG 60

Query: 72  HIDVVPPGDFNHW-TYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           H+DVVP  +   W    PF A+  +GKIYGRG VDMKG+IACF+AA   FI     F GS
Sbjct: 61  HVDVVPVDNHALWHNSSPFKASKQDGKIYGRGAVDMKGAIACFLAASLDFIKNNAGFKGS 120

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           IS L+T DEEG A +GTK+ML +I  +G K D  IVGEPTC   IGDTIKIGRRGS++ +
Sbjct: 121 ISFLLTSDEEGKAKHGTKEMLQYIYDQGYKVDFAIVGEPTCEKEIGDTIKIGRRGSVNFK 180

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           + I G  GHVAYPH   NP+  LI +LH+LTNI  D G   F  +N+E+T IDVGN + N
Sbjct: 181 LNIDGLAGHVAYPHKANNPLPCLIKILHELTNIRLDEGTEFFQNSNLEVTNIDVGNETSN 240

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIPA  + SFNIRFN+L + +TL +++   +IK      K+ + + +SS  +  F+ +  
Sbjct: 241 VIPASTEASFNIRFNNLHSAETLAKQVE-EIIKRYCKEYKVDYKLEYSS-FAGSFIQNPS 298

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDL 369
                 +K + +T    P  STSGGTSDARF+K+YCP++EFGL+  T H +NE   + DL
Sbjct: 299 AKIKEFAKVVEHTLKIKPKFSTSGGTSDARFVKNYCPLVEFGLLSETAHKINEYTKISDL 358

Query: 370 EDLTCIYENFL 380
           + L  +Y NFL
Sbjct: 359 QKLYDVYYNFL 369


>gi|68171518|ref|ZP_00544899.1| Proteobacterial succinyl-diaminopimelate desuccinylase [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|67999065|gb|EAM85735.1| Proteobacterial succinyl-diaminopimelate desuccinylase [Ehrlichia
           chaffeensis str. Sapulpa]
          Length = 381

 Score =  327 bits (838), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 174/375 (46%), Positives = 228/375 (60%), Gaps = 9/375 (2%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           +LI  PS+TP D GA   L NTL   GF+     F      +  NLYA+ G   P+L FA
Sbjct: 11  ELISFPSITPTDNGAIDFLSNTLSQYGFTCNVLTFGNDEVQVC-NLYAQLGNGHPNLCFA 69

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSI 130
           GH DVVP GD   W + PFS  I +  +YGRG VDMK +I  FIAAV+R      N G+I
Sbjct: 70  GHTDVVPTGDLEKWKFDPFSGHIEDNILYGRGAVDMKSAICAFIAAVSRIDFNQVN-GAI 128

Query: 131 SLLITGDEEGPAIN-GTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           SL+I+GDEEG     GT  +L W+    +K D C+VGEPT    +GDTIKIGRRGS++ +
Sbjct: 129 SLMISGDEEGNHFKYGTPAILKWLTDNNKKIDYCLVGEPTSKSSVGDTIKIGRRGSINFK 188

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           I  +G QGHVAYPHL +NPI  +I +LH++ N   D GN  F P+N EIT++DVGN + N
Sbjct: 189 IVCNGVQGHVAYPHLAQNPINDMINILHKINNTVLDEGNEYFQPSNCEITSVDVGNTANN 248

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP  V    NIR+N++   ++L   I +   +  Q       T+    P    F+ +  
Sbjct: 249 VIPGTVTAHLNIRYNNIHTSESLFNIINNICAETTQKYQIF--TLLSGDP----FINYPD 302

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDL 369
           K + +LS +I  TTG   ++STSGGTSDARFIKD+CPVIE GL   T H +NEN S+ D+
Sbjct: 303 KYSDMLSAAIKKTTGETAVISTSGGTSDARFIKDFCPVIELGLKNDTAHKINENTSVDDI 362

Query: 370 EDLTCIYENFLQNWF 384
             L  IYE F++ +F
Sbjct: 363 NKLANIYEEFIKQFF 377


>gi|40062658|gb|AAR37579.1| succinyl-diaminopimelate desuccinylase [uncultured marine bacterium
           313]
          Length = 379

 Score =  326 bits (836), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 172/380 (45%), Positives = 243/380 (63%), Gaps = 18/380 (4%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           +LI+ PSVTP+D GA  +L   L+ LGF  +  +F+      +KNLYAR G  +P+  FA
Sbjct: 11  ELIRRPSVTPKDAGAINLLAKNLRTLGFKCQMMNFKN-----IKNLYARLGKSSPNFCFA 65

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI---PKYKNF 127
           GH DVVP GD   W+  PF   +   K+ GRG  DMKGSIACF+AA+++F    PK++  
Sbjct: 66  GHTDVVPVGDLKSWSVNPFLGVVKNNKLIGRGASDMKGSIACFVAALSQFKKIKPKFE-- 123

Query: 128 GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLS 187
           GSISLLITGDEE  AINGTKK++  ++K+ EK + C+VGEPT    +G  +KIGRRGS++
Sbjct: 124 GSISLLITGDEEAIAINGTKKVVEKLKKRKEKINYCLVGEPTNLTKLGQMMKIGRRGSMT 183

Query: 188 GEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPS 247
           G +T++G QGHVAYPH   NP   +  +L+++  +  D G   F P+N+E+  I++ N +
Sbjct: 184 GYLTVYGTQGHVAYPHQANNPAPVITKILNKIKGMKLDRGTKNFQPSNLEVVNINIENTA 243

Query: 248 KNVIPAQVKMSFNIRFNDLWNEKTLKEEIR---SRLIKGIQNVPKLSHTVHFSSPVSPVF 304
            NVIPA+ K +FNIRFN+  +  +LK+++    S + K  +   K+S+ V         F
Sbjct: 244 DNVIPAEAKATFNIRFNNKHSSNSLKKKLNKVFSNICKKSKCYFKISYMVS-----GEAF 298

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENA 364
           LT   K T ++ K I   T   P LST+GGTSDARF++   P +EFGLVG+T H ++E  
Sbjct: 299 LTIPNKTTYMIQKIIKKITKVKPKLSTAGGTSDARFLRKISPCVEFGLVGKTAHKIDEMV 358

Query: 365 SLQDLEDLTCIYENFLQNWF 384
           S+ D++ L  IY N LQN+F
Sbjct: 359 SVADMKKLKKIYLNILQNYF 378


>gi|190571095|ref|YP_001975453.1| succinyl-diaminopimelate desuccinylase [Wolbachia endosymbiont of
           Culex quinquefasciatus Pel]
 gi|213019615|ref|ZP_03335421.1| succinyl-diaminopimelate desuccinylase [Wolbachia endosymbiont of
           Culex quinquefasciatus JHB]
 gi|238055301|sp|B3CLN1|DAPE_WOLPP RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|190357367|emb|CAQ54799.1| succinyl-diaminopimelate desuccinylase [Wolbachia endosymbiont of
           Culex quinquefasciatus Pel]
 gi|212995037|gb|EEB55679.1| succinyl-diaminopimelate desuccinylase [Wolbachia endosymbiont of
           Culex quinquefasciatus JHB]
          Length = 398

 Score =  325 bits (832), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 176/385 (45%), Positives = 239/385 (62%), Gaps = 11/385 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D +E   +LI   S+TP+D GA   +   LK  GF  E  +F  K    VKNLYA++
Sbjct: 1   MKIDPVELTKKLISFKSITPKDDGAIEHIAAILKKSGFECEILEFGDK----VKNLYAKY 56

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
               P+L FAGH+DVVPPG+   W   PF   I +G +YGRG  DMK  IA FIAA+   
Sbjct: 57  INGVPNLCFAGHVDVVPPGELKDWISDPFKPEIRDGMLYGRGAADMKSGIAAFIAAIVDS 116

Query: 121 IP-KYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  K++  GSIS LIT  EE    +GTK +L W++ K +K D CIVGEPT +  +GDTIK
Sbjct: 117 VAGKFRFSGSISALITSAEESTEEHGTKAVLEWMKSKQKKIDFCIVGEPTSSEKLGDTIK 176

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGS + ++  HGKQGHVAYP L +NPI  +I +L ++ +  FDTGN  F P++ EIT
Sbjct: 177 IGRRGSATFKLICHGKQGHVAYPELADNPIYKMISILSKIKDTTFDTGNKYFQPSHCEIT 236

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           TIDVGN + N+IP+ +   FNIR+N++     L + I   +   + N  KLS     +  
Sbjct: 237 TIDVGNNTNNLIPSSIAAGFNIRYNNIQTLDGLYKLI-DEICSSVTNDYKLSMQSSRN-- 293

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
              VFL+   + T ++  +I   TG   +LST+GGTSDA FIKD CPVIEFG++ +T H 
Sbjct: 294 ---VFLSIPDRNTDIMLDAINKITGIDAVLSTNGGTSDAAFIKDICPVIEFGMINKTAHQ 350

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           +NE  S+ D+  LT IY+ F++N+F
Sbjct: 351 VNECVSIDDIHKLTAIYKEFIKNYF 375


>gi|42520627|ref|NP_966542.1| succinyl-diaminopimelate desuccinylase [Wolbachia endosymbiont of
           Drosophila melanogaster]
 gi|99036071|ref|ZP_01315106.1| hypothetical protein Wendoof_01000052 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
 gi|81652435|sp|Q73GZ0|DAPE_WOLPM RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|42410366|gb|AAS14476.1| succinyl-diaminopimelate desuccinylase [Wolbachia endosymbiont of
           Drosophila melanogaster]
          Length = 398

 Score =  323 bits (827), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 175/385 (45%), Positives = 235/385 (61%), Gaps = 11/385 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D +E   +LI   S+TP+D GA   +    K  GF  E  +F  K    VKNLYA++
Sbjct: 1   MKIDPVELTRKLISFESITPEDSGAIEYIATIFKKSGFDCEILEFGDK----VKNLYAKY 56

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
               P+L FAGH+DVVPPG    W + PF   + +G +YGRG  DMK  +A FIAA+   
Sbjct: 57  INGVPNLCFAGHVDVVPPGQLKDWAFGPFKPEVRDGMLYGRGAADMKSGVAAFIAAMVNL 116

Query: 121 IP-KYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           I  K++  GSIS LIT  EE     GTK +L W++ K +K D C+VGEPT +  +GDTIK
Sbjct: 117 IAEKFQFNGSISALITSAEESMEEYGTKAVLEWMKNKQKKIDFCVVGEPTSSEKLGDTIK 176

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGS++ E+  HGKQGHVAYP L +NPI  +I +L ++ N  FD GN  F P++ E+T
Sbjct: 177 IGRRGSVTFELICHGKQGHVAYPDLADNPIYKVISILSKVKNTTFDHGNKYFQPSHCEVT 236

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           TIDVGN + N+IP      FNIR+N+      L + I   +   + N  KLS  +H S  
Sbjct: 237 TIDVGNNTSNLIPGSATTRFNIRYNNEQTPGGLYKLI-DEICSSVTNDYKLS--MHSS-- 291

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
              VFL+   + T ++  +I   T    +LSTSGGTSDA FIKD CPVIEFG++ +T H 
Sbjct: 292 -RDVFLSTPDRNTDIMLDAISKVTNIDAILSTSGGTSDAAFIKDVCPVIEFGIINKTAHQ 350

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           +NE  S+ D+  LT IY+ F++N+F
Sbjct: 351 INECVSVNDIHKLTAIYKEFIENYF 375


>gi|302381744|ref|YP_003817567.1| succinyl-diaminopimelate desuccinylase [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302192372|gb|ADK99943.1| succinyl-diaminopimelate desuccinylase [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 395

 Score =  322 bits (826), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 174/388 (44%), Positives = 231/388 (59%), Gaps = 16/388 (4%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQ----TKNTSIVKNLYAR 59
           D +E    LI+ PSVTP D GA   L   L  LGF+     F+        + ++NLYAR
Sbjct: 10  DPVELTRDLIRRPSVTPVDAGAMDTLERVLTGLGFTCRRMAFEGSTGAATDARIENLYAR 69

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT +P+L FAGH DVVP G+   W+  PF A +  G +YGRG VDMKG IA ++AAV++
Sbjct: 70  RGTASPNLCFAGHTDVVPTGEAAAWSSDPFEAEVRNGLLYGRGAVDMKGGIAAWVAAVSQ 129

Query: 120 FIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
            +   +  GS+S LITGDEEGPA++GTKK++  +  +GE  DAC+VGEP+    +GD IK
Sbjct: 130 ILADGEPAGSLSFLITGDEEGPALHGTKKVVEALMAEGEVIDACVVGEPSSQTQLGDMIK 189

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGSL+  IT+HGKQGHVAYP    NP   L+ LL  L     D G   F P+N+EIT
Sbjct: 190 IGRRGSLNTWITVHGKQGHVAYPARAANPAPVLVRLLAALDAHVLDEGYEAFQPSNLEIT 249

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTL-----KEEIRSRLIKGIQNVPKLSHTV 294
           TID+GNP+ NVIPA+ +   NIRFN       L     +E  R +   G+Q    L H  
Sbjct: 250 TIDIGNPATNVIPAEARARLNIRFNPAQTGDGLIDWLNREAGRVQAETGLQIT--LEHMC 307

Query: 295 HFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVG 354
              +     FLT      + +  ++  +TG  P  ST+GGTSDARFI+  CPV+E GLVG
Sbjct: 308 SGEA-----FLTPHGPFVTAVQDAVEASTGVRPEASTTGGTSDARFIRAMCPVLELGLVG 362

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQN 382
           +TMH ++E   + +L  LT  Y   ++ 
Sbjct: 363 QTMHQVDERVPVAELVALTAAYRRVIET 390


>gi|91206235|ref|YP_538590.1| succinyl-diaminopimelate desuccinylase [Rickettsia bellii RML369-C]
 gi|122425108|sp|Q1RGL3|DAPE_RICBR RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|91069779|gb|ABE05501.1| Succinyl-diaminopimelate desuccinylase [Rickettsia bellii RML369-C]
          Length = 391

 Score =  322 bits (824), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 180/376 (47%), Positives = 233/376 (61%), Gaps = 8/376 (2%)

Query: 8   HLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHL 67
           +L  LI   S+TPQ  GA   + + LK  GF  E K F    T  V NLYA +G   P++
Sbjct: 5   YLKNLIGFESLTPQSNGAIEYIDDLLKEHGFKTEVKIF--GETEQVTNLYAVYGNSKPNI 62

Query: 68  MFAGHIDVVPPGDFNHW-TYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKN 126
            F GH+DVVP GD N W    PF A   EGKIYGRG VDMKGSIACF+AA   FI    +
Sbjct: 63  CFVGHVDVVPAGDPNLWHNSNPFKAHEQEGKIYGRGTVDMKGSIACFLAASLDFIKNNTD 122

Query: 127 F-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGS 185
           F GSIS L+T DEEG A +GTK+ML +I  +G + D  IVGEPTC   IGDTIKIGRRGS
Sbjct: 123 FVGSISFLLTSDEEGKAKHGTKEMLQYIYNQGHEIDFAIVGEPTCEKEIGDTIKIGRRGS 182

Query: 186 LSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGN 245
           ++ ++ + G  GHVAYP    NP+  LI +L++LTNI  D G   F  +N+E+T IDV N
Sbjct: 183 INFKLAVKGLGGHVAYPQKANNPLPCLIRILNELTNIKLDKGTEFFQNSNLEVTNIDVDN 242

Query: 246 PSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFL 305
            + NVIP    + FNIRFN+L + +TL +++   +IK      KL +T+ ++S       
Sbjct: 243 NTTNVIPETATVHFNIRFNNLHSAETLAKQVE-EIIKQHCQKHKLDYTLEYNSSADSFIQ 301

Query: 306 THDRKLTSLLSKSIYNTTGNI-PLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENA 364
             + K+      +I   T NI P  STSGGTSDARF+K+YCP++EFGL+  T H +NE  
Sbjct: 302 NPNDKIKEF--ATIVEKTLNIKPKFSTSGGTSDARFVKNYCPLVEFGLLSDTAHKINEYT 359

Query: 365 SLQDLEDLTCIYENFL 380
            + DL+ L  +Y NFL
Sbjct: 360 KISDLQKLYDVYYNFL 375


>gi|157827851|ref|YP_001496915.1| succinyl-diaminopimelate desuccinylase [Rickettsia bellii OSU
           85-389]
 gi|238064806|sp|A8GYC8|DAPE_RICB8 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|157803155|gb|ABV79878.1| Succinyl-diaminopimelate desuccinylase [Rickettsia bellii OSU
           85-389]
          Length = 391

 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 180/376 (47%), Positives = 233/376 (61%), Gaps = 8/376 (2%)

Query: 8   HLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHL 67
           +L  LI   S+TPQ  GA   + + LK  GF  E K F    T  V NLYA +G   P++
Sbjct: 5   YLKNLIGFESLTPQSNGAIEYIDDLLKEHGFKTEVKIF--GETEQVTNLYAVYGNSKPNI 62

Query: 68  MFAGHIDVVPPGDFNHW-TYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKN 126
            F GH+DVVP GD N W    PF A   EGKIYGRG VDMKGSIACF+AA   FI    +
Sbjct: 63  CFVGHVDVVPAGDPNLWHNSNPFKAHEQEGKIYGRGTVDMKGSIACFLAASLDFIKNNTD 122

Query: 127 F-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGS 185
           F GSIS L+T DEEG A +GTK+ML +I  +G + D  IVGEPTC   IGDTIKIGRRGS
Sbjct: 123 FVGSISFLLTSDEEGKAKHGTKEMLQYIYNQGHEIDFAIVGEPTCEKEIGDTIKIGRRGS 182

Query: 186 LSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGN 245
           ++ ++ + G  GHVAYP    NP+  LI +L++LTNI  D G   F  +N+E+T IDV N
Sbjct: 183 INFKLAVKGLGGHVAYPQKANNPLPCLIRILNELTNIKLDKGTEFFQNSNLEVTNIDVDN 242

Query: 246 PSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFL 305
            + NVIP    + FNIRFN+L + +TL +++   +IK      KL +T+ ++S       
Sbjct: 243 NTTNVIPETATVHFNIRFNNLHSAETLAKQVE-EIIKQHCQKHKLDYTLEYNSSADSFIQ 301

Query: 306 THDRKLTSLLSKSIYNTTGNI-PLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENA 364
             + K+      +I   T NI P  STSGGTSDARF+K+YCP++EFGL+  T H +NE  
Sbjct: 302 NPNDKIKEF--ATIVEKTLNIKPNFSTSGGTSDARFVKNYCPLVEFGLLSDTAHKINEYT 359

Query: 365 SLQDLEDLTCIYENFL 380
            + DL+ L  +Y NFL
Sbjct: 360 KISDLQKLYDVYYNFL 375


>gi|165933912|ref|YP_001650701.1| succinyl-diaminopimelate desuccinylase [Rickettsia rickettsii str.
           Iowa]
 gi|165908999|gb|ABY73295.1| succinyl-diaminopimelate desuccinylase [Rickettsia rickettsii str.
           Iowa]
          Length = 382

 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 173/377 (45%), Positives = 234/377 (62%), Gaps = 4/377 (1%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           + +L  LI   SVTP+  GA   + + LK  GF  E K F    +  V NLYA FG+  P
Sbjct: 4   INYLKDLISFKSVTPKSDGAIEYINDLLKQHGFKTEIKIFGDSKSEQVTNLYAVFGSNEP 63

Query: 66  HLMFAGHIDVVPPGDFNHW-TYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           ++ F GH+DVV  G+   W    PF  +  +GKIYGRG VDMKG+IACF+AA   FI   
Sbjct: 64  NICFVGHVDVVLEGNHELWHNASPFKVSQQDGKIYGRGAVDMKGAIACFLAASLDFIKNN 123

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
            +F GSIS L+T DEEG A +GTK+ML +I  +G K +  IVGEPTC   IGD IKIGRR
Sbjct: 124 TDFKGSISFLLTSDEEGKAKHGTKEMLQYIYDQGYKINFAIVGEPTCEKEIGDAIKIGRR 183

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++ ++ I G  GHVAYPH   NP+  LI +L++LTNI  D G   F  +N+E+T I+V
Sbjct: 184 GSVNFKLNIEGLSGHVAYPHKANNPLPCLIIILNELTNIKLDEGTEFFQRSNLEVTNIEV 243

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
            N + NVIPA  + SFNIRFN+L + +TL +++   +IK      K+ + + +SS     
Sbjct: 244 SNNTSNVIPASTEASFNIRFNNLHSAETLAKQVE-EIIKQHCKEYKVDYKLEYSSSAES- 301

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           F+ +        +K + +T    P  STSGGTSDARF+K+YCP++EFGL+  T H +NE 
Sbjct: 302 FIQNPSDKIKEFAKVVEHTLKIKPEFSTSGGTSDARFVKNYCPLVEFGLLSETAHKINEY 361

Query: 364 ASLQDLEDLTCIYENFL 380
             + DL+ L  +Y NFL
Sbjct: 362 TKISDLQKLYDVYYNFL 378


>gi|157829185|ref|YP_001495427.1| succinyl-diaminopimelate desuccinylase [Rickettsia rickettsii str.
           'Sheila Smith']
 gi|238064813|sp|A8GU44|DAPE_RICRS RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064817|sp|B0BVN5|DAPE_RICRO RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|157801666|gb|ABV76919.1| succinyl-diaminopimelate desuccinylase [Rickettsia rickettsii str.
           'Sheila Smith']
          Length = 381

 Score =  321 bits (822), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 173/377 (45%), Positives = 234/377 (62%), Gaps = 4/377 (1%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           + +L  LI   SVTP+  GA   + + LK  GF  E K F    +  V NLYA FG+  P
Sbjct: 3   INYLKDLISFKSVTPKSDGAIEYINDLLKQHGFKTEIKIFGDSKSEQVTNLYAVFGSNEP 62

Query: 66  HLMFAGHIDVVPPGDFNHW-TYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           ++ F GH+DVV  G+   W    PF  +  +GKIYGRG VDMKG+IACF+AA   FI   
Sbjct: 63  NICFVGHVDVVLEGNHELWHNASPFKVSQQDGKIYGRGAVDMKGAIACFLAASLDFIKNN 122

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
            +F GSIS L+T DEEG A +GTK+ML +I  +G K +  IVGEPTC   IGD IKIGRR
Sbjct: 123 TDFKGSISFLLTSDEEGKAKHGTKEMLQYIYDQGYKINFAIVGEPTCEKEIGDAIKIGRR 182

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++ ++ I G  GHVAYPH   NP+  LI +L++LTNI  D G   F  +N+E+T I+V
Sbjct: 183 GSVNFKLNIEGLSGHVAYPHKANNPLPCLIIILNELTNIKLDEGTEFFQRSNLEVTNIEV 242

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
            N + NVIPA  + SFNIRFN+L + +TL +++   +IK      K+ + + +SS     
Sbjct: 243 SNNTSNVIPASTEASFNIRFNNLHSAETLAKQVE-EIIKQHCKEYKVDYKLEYSSSAES- 300

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           F+ +        +K + +T    P  STSGGTSDARF+K+YCP++EFGL+  T H +NE 
Sbjct: 301 FIQNPSDKIKEFAKVVEHTLKIKPEFSTSGGTSDARFVKNYCPLVEFGLLSETAHKINEY 360

Query: 364 ASLQDLEDLTCIYENFL 380
             + DL+ L  +Y NFL
Sbjct: 361 TKISDLQKLYDVYYNFL 377


>gi|225677185|ref|ZP_03788181.1| succinyl-diaminopimelate desuccinylase [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|225590772|gb|EEH12003.1| succinyl-diaminopimelate desuccinylase [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
          Length = 398

 Score =  320 bits (821), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 173/385 (44%), Positives = 232/385 (60%), Gaps = 11/385 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D +E   +LI   S+TP+D GA   +    K  GF  E  +F  K    VKNLYA++
Sbjct: 1   MKIDPVELTRKLISFESITPEDSGAIEYIAAIFKKSGFDCEILEFGDK----VKNLYAKY 56

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
               P+L FAGH+DVVPPG    W + PF+  + +G +YGRG  DMK  +A FIAA+   
Sbjct: 57  INGVPNLCFAGHVDVVPPGQLKDWAFGPFNPEVRDGMLYGRGAADMKSGVAAFIAAMVNL 116

Query: 121 IP-KYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           I  K++  GSIS LIT  EE     GTK +L W++ K +K D C+VGEPT +  +GDTIK
Sbjct: 117 IAEKFQFNGSISALITSAEESMEEYGTKAVLEWMKNKQKKIDFCVVGEPTSSKKLGDTIK 176

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGS++ E+  HGKQGHVAYP L +NPI  +I +L ++ N  FD GN  F P++ E+T
Sbjct: 177 IGRRGSVTFELICHGKQGHVAYPDLADNPIYKVISILSKVKNTTFDHGNKYFQPSHCEVT 236

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           TIDVGN + N+IP      FNIR+N+      L + I   +   + N  KL     F   
Sbjct: 237 TIDVGNNTSNLIPGSATTRFNIRYNNEQTPGGLYKLI-DEICSSVTNDYKL-----FMHS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
              VFL+   + T ++  +I   T     LSTSGGTSDA FIKD CPVIEFG++ +T H 
Sbjct: 291 SRDVFLSTPDRNTDIMLDAINKVTSIDAALSTSGGTSDAAFIKDVCPVIEFGIINKTAHQ 350

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           +NE  S+ D+  LT IY+ F++N+F
Sbjct: 351 INECVSVNDIHKLTAIYKEFIENYF 375


>gi|229587244|ref|YP_002845745.1| succinyl-diaminopimelate desuccinylase [Rickettsia africae ESF-5]
 gi|238651119|ref|YP_002916977.1| succinyl-diaminopimelate desuccinylase [Rickettsia peacockii str.
           Rustic]
 gi|238064820|sp|Q92FY0|DAPE_RICCN RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|259595045|sp|C3PM12|DAPE_RICAE RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|259595046|sp|C4K2X8|DAPE_RICPU RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|228022294|gb|ACP54002.1| Succinyl-diaminopimelate desuccinylase [Rickettsia africae ESF-5]
 gi|238625217|gb|ACR47923.1| succinyl-diaminopimelate desuccinylase [Rickettsia peacockii str.
           Rustic]
          Length = 381

 Score =  320 bits (821), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 173/377 (45%), Positives = 234/377 (62%), Gaps = 4/377 (1%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           + +L  LI   SVTP+  GA   + + LK  GF  E K F    +  V NLYA FG+  P
Sbjct: 3   INYLKDLIGFKSVTPKSDGAIEYINDLLKQHGFKTEIKIFGDSKSEQVTNLYAVFGSNEP 62

Query: 66  HLMFAGHIDVVPPGDFNHW-TYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           ++ F GH+DVV  G+   W    PF  +  +GKIYGRG VDMKG+IACF+AA   FI   
Sbjct: 63  NICFVGHVDVVLAGNHELWHNASPFKVSQQDGKIYGRGAVDMKGAIACFLAASLDFIKNN 122

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
            +F GSIS L+T DEEG A +GTK+ML +I  +G K +  IVGEPTC   IGD IKIGRR
Sbjct: 123 TDFKGSISFLLTSDEEGKAKHGTKEMLQYIYDQGYKINFAIVGEPTCEKEIGDAIKIGRR 182

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++ ++ I G  GHVAYPH   NP+  LI +L++LTNI  D G   F  +N+E+T I+V
Sbjct: 183 GSVNFKLNIEGLSGHVAYPHKANNPLPCLIIILNELTNIKLDEGTEFFQRSNLEVTNIEV 242

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
            N + NVIPA  + SFNIRFN+L + +TL +++   +IK      K+ + + +SS     
Sbjct: 243 SNNTSNVIPASTEASFNIRFNNLHSAETLAKQVE-EIIKQHCKEYKVDYKLEYSSSAES- 300

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           F+ +        +K + +T    P  STSGGTSDARF+K+YCP++EFGL+  T H +NE 
Sbjct: 301 FIQNPSDKIKEFAKVVEHTLKIKPEFSTSGGTSDARFVKNYCPLVEFGLLSETAHKINEY 360

Query: 364 ASLQDLEDLTCIYENFL 380
             + DL+ L  +Y NFL
Sbjct: 361 TKISDLQKLYDVYYNFL 377


>gi|15893270|ref|NP_360984.1| succinyl-diaminopimelate desuccinylase [Rickettsia conorii str.
           Malish 7]
 gi|15620491|gb|AAL03885.1| succinyl-diaminopimelate desuccinylase [Rickettsia conorii str.
           Malish 7]
          Length = 382

 Score =  320 bits (821), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 173/377 (45%), Positives = 234/377 (62%), Gaps = 4/377 (1%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           + +L  LI   SVTP+  GA   + + LK  GF  E K F    +  V NLYA FG+  P
Sbjct: 4   INYLKDLIGFKSVTPKSDGAIEYINDLLKQHGFKTEIKIFGDSKSEQVTNLYAVFGSNEP 63

Query: 66  HLMFAGHIDVVPPGDFNHW-TYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           ++ F GH+DVV  G+   W    PF  +  +GKIYGRG VDMKG+IACF+AA   FI   
Sbjct: 64  NICFVGHVDVVLAGNHELWHNASPFKVSQQDGKIYGRGAVDMKGAIACFLAASLDFIKNN 123

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
            +F GSIS L+T DEEG A +GTK+ML +I  +G K +  IVGEPTC   IGD IKIGRR
Sbjct: 124 TDFKGSISFLLTSDEEGKAKHGTKEMLQYIYDQGYKINFAIVGEPTCEKEIGDAIKIGRR 183

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++ ++ I G  GHVAYPH   NP+  LI +L++LTNI  D G   F  +N+E+T I+V
Sbjct: 184 GSVNFKLNIEGLSGHVAYPHKANNPLPCLIIILNELTNIKLDEGTEFFQRSNLEVTNIEV 243

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
            N + NVIPA  + SFNIRFN+L + +TL +++   +IK      K+ + + +SS     
Sbjct: 244 SNNTSNVIPASTEASFNIRFNNLHSAETLAKQVE-EIIKQHCKEYKVDYKLEYSSSAES- 301

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           F+ +        +K + +T    P  STSGGTSDARF+K+YCP++EFGL+  T H +NE 
Sbjct: 302 FIQNPSDKIKEFAKVVEHTLKIKPEFSTSGGTSDARFVKNYCPLVEFGLLSETAHKINEY 361

Query: 364 ASLQDLEDLTCIYENFL 380
             + DL+ L  +Y NFL
Sbjct: 362 TKISDLQKLYDVYYNFL 378


>gi|254418255|ref|ZP_05031979.1| succinyl-diaminopimelate desuccinylase [Brevundimonas sp. BAL3]
 gi|196184432|gb|EDX79408.1| succinyl-diaminopimelate desuccinylase [Brevundimonas sp. BAL3]
          Length = 388

 Score =  320 bits (820), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 170/386 (44%), Positives = 235/386 (60%), Gaps = 8/386 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNT----SIVKNLYAR 59
           D +E    LI+ PSVTP D GA  +L   L  LGF      F+        + ++NLYAR
Sbjct: 3   DPVELTRDLIRIPSVTPADEGAMDVLERHLTALGFHCRRLAFEGPGGEGVHARIENLYAR 62

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT +P+L FAGH DVVP G  + W+  PF+A + +G +YGRG VDMKG IA ++AAV++
Sbjct: 63  RGTASPNLCFAGHTDVVPTGPSDQWSAQPFNAEVRDGLLYGRGAVDMKGGIAAWVAAVSQ 122

Query: 120 FIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
            + + +  GS+S LITGDEEGPA++GTK+++  +  +GE  DACIVGEP+ +  +GD IK
Sbjct: 123 VLAEGEPAGSLSFLITGDEEGPALHGTKRVVETLAAEGEVIDACIVGEPSSSQHLGDMIK 182

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           +GRRGSL+  IT+ GKQGHVAYP    NP   +  L+ +L +   D G   F P+N+EIT
Sbjct: 183 VGRRGSLNTWITVTGKQGHVAYPERAANPAPVIARLMSRLNDHVLDEGYEGFPPSNLEIT 242

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTV-HFSS 298
           TID+GNP+ N+IPA+ K   NIRFN       L + + +R    +Q    L   + H  S
Sbjct: 243 TIDIGNPATNIIPAEAKARLNIRFNPSHTGDGLIDWL-NREAGAVQAETGLQIRLDHLCS 301

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
                FLT      + +  ++    G  P  ST+GGTSDARFI+  CPV+E GLVG+TMH
Sbjct: 302 --GEAFLTEPGVFVAAVQDAVEAVAGRRPEASTTGGTSDARFIRALCPVLELGLVGQTMH 359

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E     +LE LT +Y   ++  F
Sbjct: 360 QIDERVPTAELETLTAVYRRVIETVF 385


>gi|34581063|ref|ZP_00142543.1| succinyl-diaminopimelate desuccinylase [Rickettsia sibirica 246]
 gi|28262448|gb|EAA25952.1| succinyl-diaminopimelate desuccinylase [Rickettsia sibirica 246]
          Length = 381

 Score =  319 bits (818), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 173/377 (45%), Positives = 233/377 (61%), Gaps = 4/377 (1%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           + +L  LI   SVTP+  GA   + + LK  GF  E K F    +  V NLYA FG+  P
Sbjct: 3   INYLKDLIGFKSVTPKSDGAIEYINDLLKQHGFKTEIKIFGDSKSEQVTNLYAVFGSNEP 62

Query: 66  HLMFAGHIDVVPPGDFNHW-TYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           ++ F GH+DVV  G+   W    PF  +  +GKIYGRG VDMKG+IACF+AA   FI   
Sbjct: 63  NICFVGHVDVVLAGNHELWHNASPFKVSQQDGKIYGRGAVDMKGAIACFLAASLDFIKNN 122

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
            +F GSIS L+T DEEG A  GTK+ML +I  +G K +  IVGEPTC   IGD IKIGRR
Sbjct: 123 TDFKGSISFLLTSDEEGKAKYGTKEMLQYIYDQGYKINFAIVGEPTCEKEIGDAIKIGRR 182

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++ ++ I G  GHVAYPH   NP+  LI +L++LTNI  D G   F  +N+E+T I+V
Sbjct: 183 GSVNFKLNIEGLSGHVAYPHKANNPLPCLIIILNELTNIKLDEGTEFFQRSNLEVTNIEV 242

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
            N + NVIPA  + SFNIRFN+L + +TL +++   +IK      K+ + + +SS     
Sbjct: 243 SNNTSNVIPASTEASFNIRFNNLHSAETLAKQVE-EIIKQHCKEYKVDYKLEYSSSAES- 300

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           F+ +        +K + +T    P  STSGGTSDARF+K+YCP++EFGL+  T H +NE 
Sbjct: 301 FIQNPSDKIKEFAKVVEHTLKIKPEFSTSGGTSDARFVKNYCPLVEFGLLSETAHKINEY 360

Query: 364 ASLQDLEDLTCIYENFL 380
             + DL+ L  +Y NFL
Sbjct: 361 TKISDLQKLYDVYYNFL 377


>gi|238064832|sp|A0L3N2|DAPE_MAGSM RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 380

 Score =  319 bits (818), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 164/377 (43%), Positives = 231/377 (61%), Gaps = 15/377 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+ PSVTP D G   +L+  L+ LGF++    F       V+N YAR G++  +  FAG
Sbjct: 11  LIQAPSVTPMDHGCQDLLIRHLEDLGFTVHRLRF-----GHVENFYARLGSKGRNFTFAG 65

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI---PKYKNFG 128
           H DVV  GD + W+  PF+AT+ EG I GRG VDMKG +AC +AA ARF+   P +    
Sbjct: 66  HTDVVGAGDTSRWSSDPFAATLEEGYITGRGAVDMKGGLACMVAATARFLAARPHFAQQH 125

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           S+S LITGDEEG A++GT K+L W+E + EK D C+VGEPT    +GD IK GRRGS++G
Sbjct: 126 SLSFLITGDEEGDALDGTLKVLQWLESQQEKMDYCLVGEPTSAAQLGDCIKNGRRGSVNG 185

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
            +TI G QGHVAYPHL +NPI    P+L  ++++ FD G+  F PT+++ T +  G  + 
Sbjct: 186 RLTIRGVQGHVAYPHLVDNPIHRAAPVLAAISSMTFDQGDRFFQPTSLQFTAVQSGGSAT 245

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHD 308
           NV+P ++   FNIRF+ +   ++L+  IR  L     +  ++ + +   +   P F+T  
Sbjct: 246 NVVPGELTAGFNIRFSAMHTPESLEARIRQVL-----DGAEVDYDLQMMTSGLP-FITEG 299

Query: 309 RKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNENASLQ 367
             L   +  ++   TG  P LST GGTSDARFI  +C   +EFGLVG TMH ++E   + 
Sbjct: 300 GPLVEAVKATVAQVTGLEPQLSTGGGTSDARFISRHCVQTVEFGLVGSTMHKVDERVPVA 359

Query: 368 DLEDLTCIYENFLQNWF 384
           DLE LT +Y   L+  +
Sbjct: 360 DLEVLTEVYRRLLERLY 376


>gi|117923364|ref|YP_863981.1| succinyl-diaminopimelate desuccinylase [Magnetococcus sp. MC-1]
 gi|117607120|gb|ABK42575.1| succinyldiaminopimelate desuccinylase [Magnetococcus sp. MC-1]
          Length = 387

 Score =  319 bits (818), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 164/377 (43%), Positives = 231/377 (61%), Gaps = 15/377 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+ PSVTP D G   +L+  L+ LGF++    F       V+N YAR G++  +  FAG
Sbjct: 18  LIQAPSVTPMDHGCQDLLIRHLEDLGFTVHRLRF-----GHVENFYARLGSKGRNFTFAG 72

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI---PKYKNFG 128
           H DVV  GD + W+  PF+AT+ EG I GRG VDMKG +AC +AA ARF+   P +    
Sbjct: 73  HTDVVGAGDTSRWSSDPFAATLEEGYITGRGAVDMKGGLACMVAATARFLAARPHFAQQH 132

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           S+S LITGDEEG A++GT K+L W+E + EK D C+VGEPT    +GD IK GRRGS++G
Sbjct: 133 SLSFLITGDEEGDALDGTLKVLQWLESQQEKMDYCLVGEPTSAAQLGDCIKNGRRGSVNG 192

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
            +TI G QGHVAYPHL +NPI    P+L  ++++ FD G+  F PT+++ T +  G  + 
Sbjct: 193 RLTIRGVQGHVAYPHLVDNPIHRAAPVLAAISSMTFDQGDRFFQPTSLQFTAVQSGGSAT 252

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHD 308
           NV+P ++   FNIRF+ +   ++L+  IR  L     +  ++ + +   +   P F+T  
Sbjct: 253 NVVPGELTAGFNIRFSAMHTPESLEARIRQVL-----DGAEVDYDLQMMTSGLP-FITEG 306

Query: 309 RKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNENASLQ 367
             L   +  ++   TG  P LST GGTSDARFI  +C   +EFGLVG TMH ++E   + 
Sbjct: 307 GPLVEAVKATVAQVTGLEPQLSTGGGTSDARFISRHCVQTVEFGLVGSTMHKVDERVPVA 366

Query: 368 DLEDLTCIYENFLQNWF 384
           DLE LT +Y   L+  +
Sbjct: 367 DLEVLTEVYRRLLERLY 383


>gi|238064818|sp|A8F303|DAPE_RICM5 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 381

 Score =  318 bits (816), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 173/377 (45%), Positives = 234/377 (62%), Gaps = 4/377 (1%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           + +L  LI   SVTP+  GA   + + LK  GF  E K F    +  V NLYA FG+  P
Sbjct: 3   INYLKDLIGFKSVTPKSDGAIEYIDDLLKQHGFKTEIKIFGDSKSEQVTNLYAVFGSNEP 62

Query: 66  HLMFAGHIDVVPPGDFNHW-TYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           ++ F GH+DVV  G+   W    PF A+  + KIYGRG VDMKG+IACF+AA   FI   
Sbjct: 63  NICFVGHVDVVLAGNHELWHNASPFKASQQDDKIYGRGAVDMKGAIACFLAASLDFIKNN 122

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
            +F GSIS L+T DEEG A +GTK+ML +I  +G K +  IVGEPTC   IGD IKIGRR
Sbjct: 123 TDFKGSISFLLTSDEEGKAKHGTKEMLQYIYDQGYKINFAIVGEPTCEKEIGDAIKIGRR 182

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++ ++ I G  GHVAYPH   NP+  LI +L++LTNI  D G   F  +N+E+T I+V
Sbjct: 183 GSVNFKLNIEGLSGHVAYPHKANNPLPCLIIILNELTNIKLDEGIEFFQRSNLEVTNIEV 242

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
            N + NVIPA  + SFNIRFN+L + +TL +++   +IK      K+ + + +SS     
Sbjct: 243 SNNTSNVIPASTEASFNIRFNNLHSAETLAKQVE-EIIKQHCKEYKVDYKLEYSSSAES- 300

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           F+ +        +K + +T    P  STSGGTSDARF+K+YCP++EFGL+  T H +NE 
Sbjct: 301 FIQNPSDKIKEFAKVVEHTLKIKPEFSTSGGTSDARFVKNYCPLVEFGLLSETAHKINEY 360

Query: 364 ASLQDLEDLTCIYENFL 380
             + DL+ L  +Y NFL
Sbjct: 361 TKISDLQKLYDVYYNFL 377


>gi|329890985|ref|ZP_08269328.1| succinyl-diaminopimelate desuccinylase [Brevundimonas diminuta ATCC
           11568]
 gi|328846286|gb|EGF95850.1| succinyl-diaminopimelate desuccinylase [Brevundimonas diminuta ATCC
           11568]
          Length = 397

 Score =  318 bits (816), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 173/382 (45%), Positives = 230/382 (60%), Gaps = 8/382 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQ----TKNTSIVKNLYAR 59
           D +E    LI+ PSVTP D GA  +L   L  LGF+     F+      + + ++NLYAR
Sbjct: 10  DPVELTRDLIRIPSVTPADEGAMDVLERALTGLGFACRRMVFEGPSGVGHDARIENLYAR 69

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT +P+L FAGH DVVP GD   W+  PF     +G +YGRG VDMKG IA ++AAV+R
Sbjct: 70  RGTASPNLCFAGHTDVVPIGDLKAWSAGPFEGETRDGVLYGRGAVDMKGGIAAWVAAVSR 129

Query: 120 FIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
            + + +  GS+S LITGDEEGPA++GTK+++  +  +GE  DAC+VGEP+  H +GD IK
Sbjct: 130 VLARDEIEGSLSFLITGDEEGPALHGTKRVVQTLAAEGEVIDACVVGEPSSAHHLGDMIK 189

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           +GRRGSL+  IT+ GKQGHVAYP    NP   +  LL +L     D G   F P+N+EIT
Sbjct: 190 VGRRGSLNTWITVFGKQGHVAYPDRAANPTPVIARLLARLDAHVLDEGYPEFPPSNLEIT 249

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTV-HFSS 298
           TIDVGNP+ N+IPA+ K   NIRFN       L + + +R    +Q    L   + H  S
Sbjct: 250 TIDVGNPASNIIPAEAKARLNIRFNPTHTGDGLIDWL-NREAGALQAETGLRIELEHMCS 308

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
                FLT      S +  ++    G  P  ST+GGTSDARFI+  CPV+E GLVG+TMH
Sbjct: 309 --GEAFLTEPGVFVSAVQDAVEAVLGRRPEASTTGGTSDARFIRSLCPVLELGLVGQTMH 366

Query: 359 ALNENASLQDLEDLTCIYENFL 380
            ++E     +L  LT  YE  +
Sbjct: 367 QVDERVPEAELRALTDAYERVI 388


>gi|157965012|ref|YP_001499836.1| succinyl-diaminopimelate desuccinylase [Rickettsia massiliae MTU5]
 gi|157844788|gb|ABV85289.1| Succinyl-diaminopimelate desuccinylase [Rickettsia massiliae MTU5]
          Length = 382

 Score =  318 bits (816), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 173/377 (45%), Positives = 234/377 (62%), Gaps = 4/377 (1%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           + +L  LI   SVTP+  GA   + + LK  GF  E K F    +  V NLYA FG+  P
Sbjct: 4   INYLKDLIGFKSVTPKSDGAIEYIDDLLKQHGFKTEIKIFGDSKSEQVTNLYAVFGSNEP 63

Query: 66  HLMFAGHIDVVPPGDFNHW-TYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           ++ F GH+DVV  G+   W    PF A+  + KIYGRG VDMKG+IACF+AA   FI   
Sbjct: 64  NICFVGHVDVVLAGNHELWHNASPFKASQQDDKIYGRGAVDMKGAIACFLAASLDFIKNN 123

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
            +F GSIS L+T DEEG A +GTK+ML +I  +G K +  IVGEPTC   IGD IKIGRR
Sbjct: 124 TDFKGSISFLLTSDEEGKAKHGTKEMLQYIYDQGYKINFAIVGEPTCEKEIGDAIKIGRR 183

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++ ++ I G  GHVAYPH   NP+  LI +L++LTNI  D G   F  +N+E+T I+V
Sbjct: 184 GSVNFKLNIEGLSGHVAYPHKANNPLPCLIIILNELTNIKLDEGIEFFQRSNLEVTNIEV 243

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
            N + NVIPA  + SFNIRFN+L + +TL +++   +IK      K+ + + +SS     
Sbjct: 244 SNNTSNVIPASTEASFNIRFNNLHSAETLAKQVE-EIIKQHCKEYKVDYKLEYSSSAES- 301

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           F+ +        +K + +T    P  STSGGTSDARF+K+YCP++EFGL+  T H +NE 
Sbjct: 302 FIQNPSDKIKEFAKVVEHTLKIKPEFSTSGGTSDARFVKNYCPLVEFGLLSETAHKINEY 361

Query: 364 ASLQDLEDLTCIYENFL 380
             + DL+ L  +Y NFL
Sbjct: 362 TKISDLQKLYDVYYNFL 378


>gi|157804264|ref|YP_001492813.1| succinyl-diaminopimelate desuccinylase [Rickettsia canadensis str.
           McKiel]
 gi|238064807|sp|A8F095|DAPE_RICCK RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|157785527|gb|ABV74028.1| succinyl-diaminopimelate desuccinylase [Rickettsia canadensis str.
           McKiel]
          Length = 384

 Score =  318 bits (815), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 173/378 (45%), Positives = 231/378 (61%), Gaps = 6/378 (1%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           + +L  LI   SVTP+   A   + + LK  GF  E K F    +  V NLYA +G   P
Sbjct: 3   INYLKDLIGFKSVTPESNLAIEYIDDLLKKHGFKTEIKIFGDSKSEQVTNLYAVYGNGKP 62

Query: 66  HLMFAGHIDVVPPGDFNHW-TYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           ++ F GH+DVVP GD++ W    PF A   +GKIYGRG+VDMKG+IACF+ A    I   
Sbjct: 63  NICFVGHVDVVPAGDYHLWHNSAPFKANEQDGKIYGRGVVDMKGAIACFLTAALDLIKNN 122

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
            +F GSIS L+T DEEG A +GTK+ML +I  +  K D  +VGEPTC   IGDTIKIGRR
Sbjct: 123 PDFKGSISFLLTSDEEGKAKHGTKEMLQYIYDQEYKIDFAVVGEPTCETEIGDTIKIGRR 182

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++ ++ I G  GHVAYPH   NP+  LI +L++L NI FD G   F  +N+E+T IDV
Sbjct: 183 GSVNFKLNIEGLVGHVAYPHKANNPLSCLIKILNELINIKFDEGTEFFQSSNLEVTNIDV 242

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GN + NVIPA V+  FNIRFN+L N +TL + I  +++K      K+ + + + S     
Sbjct: 243 GNNTSNVIPASVEAYFNIRFNNLHNAETLGQLIE-QIVKRYCKEYKVDYKLEYISAAESF 301

Query: 304 FLTHDRKLTSLLSKSIYNTTGNI-PLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNE 362
               + K+       I  +T  I P  STSGGTSDARF+K+YC ++EFGL+    H +NE
Sbjct: 302 IQNPNDKIKDF--ADIVESTLKIKPKFSTSGGTSDARFVKNYCSLVEFGLLSEMAHKINE 359

Query: 363 NASLQDLEDLTCIYENFL 380
              + DL+ L  +Y NFL
Sbjct: 360 YTKISDLQKLYDVYYNFL 377


>gi|83855368|ref|ZP_00948898.1| succinyl-diaminopimelate desuccinylase [Sulfitobacter sp. NAS-14.1]
 gi|83843211|gb|EAP82378.1| succinyl-diaminopimelate desuccinylase [Sulfitobacter sp. NAS-14.1]
          Length = 381

 Score =  317 bits (813), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 167/389 (42%), Positives = 234/389 (60%), Gaps = 21/389 (5%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D ++   +L++CPSVTP DGGA  +L + L   GF     D    +   +KNL+AR+G  
Sbjct: 5   DPVDLTAKLVRCPSVTPADGGAQEVLFDLLTEAGF-----DCAWADRGGIKNLFARWGNR 59

Query: 64  A--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
                  F GH DVVP G+   WT PPF A I +G +YGRG  DMK  +A F AA   F+
Sbjct: 60  GNTRSFGFNGHTDVVPIGNEADWTMPPFGAEIKDGIMYGRGTTDMKSGVAAFTAAAIDFV 119

Query: 122 PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
                 GSI L ITGDEE   I+GT+ +L ++++ GE+ D C+VGEPTC + +G+ IKIG
Sbjct: 120 RDTPPDGSIVLAITGDEEAEGIDGTRALLDYMQEAGERMDVCLVGEPTCPNKMGEMIKIG 179

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSL+    + GKQGH AYPH   NP+  ++ L+ QL +   D G   F P+ + I T+
Sbjct: 180 RRGSLNAHFRVIGKQGHAAYPHRANNPMPAMMRLMDQLASHQLDEGTDHFDPSTLAIVTV 239

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKE--EIRSRLIK---GIQNVPKLSHTVHF 296
           D GNP+ NVIPA+ + + NIRFND  +  +L    E ++  I+   G+Q        V  
Sbjct: 240 DTGNPATNVIPAETRATVNIRFNDKHSGASLTTWLEEQAAAIRDSFGVQ--------VEL 291

Query: 297 SSPVS-PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGR 355
              +S   F+T   +L+ L+SK++   TG  P LSTSGGTSDARF+K +CPV+EFGLVG+
Sbjct: 292 KVKISGESFITPPGELSDLVSKAVQAETGVTPELSTSGGTSDARFMKHHCPVVEFGLVGQ 351

Query: 356 TMHALNENASLQDLEDLTCIYENFLQNWF 384
           +MH ++EN  +  +  L  IY   L+++F
Sbjct: 352 SMHEVDENVEVAQIHQLKSIYTRILKDYF 380


>gi|58698595|ref|ZP_00373493.1| succinyl-diaminopimelate desuccinylase [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|58534891|gb|EAL58992.1| succinyl-diaminopimelate desuccinylase [Wolbachia endosymbiont of
           Drosophila ananassae]
          Length = 382

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 174/385 (45%), Positives = 233/385 (60%), Gaps = 11/385 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D +E   +LI   S+TP+DGGA   +    K  GF  E  +F  K    VKNLYA++
Sbjct: 1   MKIDPVELTKKLISFESITPRDGGAIEYIATIFKKSGFDCEILEFGDK----VKNLYAKY 56

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
               P+L FAGH+DVVPPG    W + PF+  + +G +YGRG  DMK  +A FIAA+   
Sbjct: 57  INGVPNLCFAGHVDVVPPGQLKDWAFGPFNPEVRDGILYGRGAADMKSGVAAFIAAMVNL 116

Query: 121 IP-KYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           I  K++  GSIS LIT  EE     GTK +L W++ K +K D C+V EPT +  +GDTIK
Sbjct: 117 IAEKFQFNGSISALITSAEESTEEYGTKAVLEWMKSKQKKVDFCVVAEPTSSEKLGDTIK 176

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGS++ E+  HGKQGHVAYP L +NPI  +I +L ++ N  FD GN  F P++ E+T
Sbjct: 177 IGRRGSVTFELICHGKQGHVAYPDLADNPIYKVISILSKVKNTTFDHGNKYFQPSHCEVT 236

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           TIDVGN + N+IP      FNIR+N+      L + I   +   + N  KLS  VH S  
Sbjct: 237 TIDVGNNTSNLIPGLATTRFNIRYNNEQTPGGLYKLI-DEICSSVTNDYKLS--VHSS-- 291

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
              VFL+   + T ++  +I   T     LSTSGGTSDA FIKD CPVIEFG++ +T H 
Sbjct: 292 -RDVFLSTPDRNTDIMLDAINKVTSIDAALSTSGGTSDAAFIKDVCPVIEFGIINKTAHQ 350

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           +NE   + D+  LT IY+ F++N+ 
Sbjct: 351 INECVLVNDIHKLTAIYKEFIENYL 375


>gi|238022142|ref|ZP_04602568.1| hypothetical protein GCWU000324_02048 [Kingella oralis ATCC 51147]
 gi|237866756|gb|EEP67798.1| hypothetical protein GCWU000324_02048 [Kingella oralis ATCC 51147]
          Length = 373

 Score =  317 bits (811), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 167/376 (44%), Positives = 225/376 (59%), Gaps = 13/376 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           QL+  PS+TP D G   I+   L  LGF IE       N    KNLYAR G+++P L FA
Sbjct: 8   QLLSQPSITPNDHGCQDIIATRLVALGFKIE-----WHNHGNTKNLYARIGSQSPVLCFA 62

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVP GD   WT+PPF  T   GK+Y RG  DMK +IACF+ A  R++  +  F GS
Sbjct: 63  GHTDVVPTGDTAQWTFPPFEPTEHNGKLYARGAADMKTAIACFVVAAERYLTAHPQFSGS 122

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           ++LLIT DEEG   +GT +++  +  +GE +D CIVGEPT  H +GD +K GRRGSLSG 
Sbjct: 123 LALLITSDEEGDGKDGTTRVVETLRARGETFDYCIVGEPTAQHQLGDMLKNGRRGSLSGS 182

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           + IHGKQGH+AYPHL ENPI    P L +L N  +D GN  F  T+ +I+ I  G  + N
Sbjct: 183 LKIHGKQGHIAYPHLAENPIHRAAPALAELINTQWDNGNAYFPATSFQISNIHSGTGATN 242

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIPA + + FN RF+    E +LK ++       I +  +L + + +    +P FLT   
Sbjct: 243 VIPADIAVQFNFRFSTEQTEGSLKSQVHQ-----ILDAHQLRYDLDWQLSGNP-FLTKAG 296

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNENASLQD 368
            LT +  ++  +  G  P LST+GGTSD RFIK     +IE G V  T+H ++E+ +L D
Sbjct: 297 TLTQIAQRACQHICGITPELSTTGGTSDGRFIKAISRELIELGFVNATIHQIDEHIALDD 356

Query: 369 LEDLTCIYENFLQNWF 384
           +  LT IY+  +Q  F
Sbjct: 357 IPKLTAIYQTIMQELF 372


>gi|148284323|ref|YP_001248413.1| succinyl-diaminopimelate desuccinylase [Orientia tsutsugamushi str.
           Boryong]
 gi|238064764|sp|A5CCZ1|DAPE_ORITB RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|146739762|emb|CAM79621.1| succinyl-diaminopimelate desuccinylase [Orientia tsutsugamushi str.
           Boryong]
          Length = 388

 Score =  316 bits (810), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 173/387 (44%), Positives = 232/387 (59%), Gaps = 13/387 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           +E L QLI   SVTP D GA   + N L   GF +  K+F  +    VKNLY  FG   P
Sbjct: 8   IELLKQLISFKSVTPNDNGAIDFITNLLVKQGFKVYVKEFGQEYK--VKNLYGYFGNGQP 65

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
           ++ FAGHIDVVP G    W YPPF AT  + KIYGRG+VDMKG+I+  +++V  FI    
Sbjct: 66  NICFAGHIDVVPAGFIEQWKYPPFCATQYKDKIYGRGVVDMKGAISAMLSSVFCFIDNNH 125

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +F G+IS LIT DEEG A+ GTKKML WI ++G K D  I+GEPTC   IGDTIKIGRRG
Sbjct: 126 DFNGTISFLITADEEGEALFGTKKMLEWIYRQGHKIDFTILGEPTCTDKIGDTIKIGRRG 185

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           S++ ++ + GKQGHVAYPHL  NP   ++ +L++L     D GN  F+P+N+EI +ID  
Sbjct: 186 SINFDLKVFGKQGHVAYPHLAINPNHLIVKILNRLIAYKIDEGNEFFAPSNLEIVSIDTN 245

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLS--HTVHFSSPVSP 302
           N   N+IP   K  FNIRFND+   + L E ++  + +   N    S   +  F + +SP
Sbjct: 246 NNITNIIPEIAKSKFNIRFNDIHTNERLLEIVKKTIEQFTTNYDLQSSCRSRPFLAKMSP 305

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNE 362
              +          + ++  T   P  STSGGTSDA F KDY P++EFGL+    H +NE
Sbjct: 306 YIFS--------FKELVHKVTKIKPEFSTSGGTSDAYFFKDYSPIVEFGLLNTMAHKINE 357

Query: 363 NASLQDLEDLTCIYENFLQNWFITPSQ 389
              + DL+ L  +Y N L  + ++ S+
Sbjct: 358 YCLINDLQTLCRVYYNALCLFLMSNSK 384


>gi|16124530|ref|NP_419094.1| succinyl-diaminopimelate desuccinylase [Caulobacter crescentus
           CB15]
 gi|221233216|ref|YP_002515652.1| succinyl-diaminopimelate desuccinylase [Caulobacter crescentus
           NA1000]
 gi|81536207|sp|Q9ABF3|DAPE_CAUCR RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064717|sp|B8GYE7|DAPE_CAUCN RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|13421412|gb|AAK22262.1| succinyl-diaminopimelate desuccinylase [Caulobacter crescentus
           CB15]
 gi|220962388|gb|ACL93744.1| succinyl-diaminopimelate desuccinylase [Caulobacter crescentus
           NA1000]
          Length = 386

 Score =  316 bits (809), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 174/381 (45%), Positives = 223/381 (58%), Gaps = 10/381 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +E    LI+ PSVTP D GA   L   L+ LGF+     F       ++NLYAR GT 
Sbjct: 12  DPVELAQALIRRPSVTPADAGAMDTLQRQLEALGFACRRMKFGE-----IENLYARRGTA 66

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            P+L FAGH DVVP GD   WT  PF A I EG +YGRG VDMK S      A    +P 
Sbjct: 67  RPNLCFAGHTDVVPVGDDAAWTAGPFEAEIKEGVLYGRGAVDMK-SAIAAFVAAVANVPD 125

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
           +   GSIS LITGDEEG A +GT K++  +  +GE  D CIVGEPT  +++GD +KIGRR
Sbjct: 126 HP--GSISFLITGDEEGVAEDGTVKVVEALAAEGEIIDHCIVGEPTSANLLGDMVKIGRR 183

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++  IT+ G+QGHVAYPH   NP+  L+ +L  L     D G T F P+N+EITTIDV
Sbjct: 184 GSINAWITVEGRQGHVAYPHRAANPVPVLVDILSALKARVLDDGYTGFQPSNLEITTIDV 243

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GN + NVIPA  K   NIRFN     K L   I     K  +     +  +   S     
Sbjct: 244 GNTATNVIPAAAKARVNIRFNPAHKGKDLAAWIEGECAKAAEGFDGAATALCKIS--GEA 301

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           FLT     T ++  ++ + TG  P LST+GGTSDARFI+  CPV+EFGLVG TMH ++E 
Sbjct: 302 FLTEPGDFTDVIVAAVTDATGRAPELSTTGGTSDARFIRALCPVVEFGLVGSTMHQVDER 361

Query: 364 ASLQDLEDLTCIYENFLQNWF 384
             ++++  L   YE  ++ +F
Sbjct: 362 VPVEEVRQLAGAYEALIRRYF 382


>gi|83941891|ref|ZP_00954353.1| succinyl-diaminopimelate desuccinylase [Sulfitobacter sp. EE-36]
 gi|83847711|gb|EAP85586.1| succinyl-diaminopimelate desuccinylase [Sulfitobacter sp. EE-36]
          Length = 381

 Score =  316 bits (809), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 166/389 (42%), Positives = 234/389 (60%), Gaps = 21/389 (5%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D ++   +L++CPSVTP DGGA  +L + L   GF     D    +   +KN +AR+G +
Sbjct: 5   DPVDLTAKLVRCPSVTPADGGAQDVLFDLLTEAGF-----DCAWADRGGIKNFFARWGNK 59

Query: 64  A--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
                  F GH DVVP G+   WT PPF A I +G +YGRG  DMK  +A F AA   F+
Sbjct: 60  GNTRSFGFNGHTDVVPIGNEADWTMPPFGAEIKDGIMYGRGTTDMKSGVAAFTAAAIDFV 119

Query: 122 PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
                 GSI L ITGDEE   I+GT+ +L ++++ GE+ D C+VGEPTC + +G+ IKIG
Sbjct: 120 RDTPPDGSIVLAITGDEEAEGIDGTRALLDYMQEAGERMDVCLVGEPTCPNKMGEMIKIG 179

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSL+    + GKQGH AYPH   NP+  ++ L+ QL +   D G   F P+ + I T+
Sbjct: 180 RRGSLNAHFRVIGKQGHAAYPHRANNPMPAMMRLMDQLASHQLDEGTDHFDPSTLAIVTV 239

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKE--EIRSRLIK---GIQNVPKLSHTVHF 296
           D GNP+ NVIPA+ + + NIRFND  +  +L    E ++  I+   G+Q        V  
Sbjct: 240 DTGNPATNVIPAETRATVNIRFNDKHSGASLTTWLEEQAAAIRDSFGVQ--------VEL 291

Query: 297 SSPVS-PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGR 355
              +S   F+T   +L+ L+SK++   TG  P LSTSGGTSDARF+K +CPV+EFGLVG+
Sbjct: 292 KVKISGESFITPPGELSDLVSKAVQAETGVTPELSTSGGTSDARFMKHHCPVVEFGLVGQ 351

Query: 356 TMHALNENASLQDLEDLTCIYENFLQNWF 384
           +MH ++EN  +  +  L  IY   L+++F
Sbjct: 352 SMHEVDENVEVAQIHQLKSIYTRILKDYF 380


>gi|189183699|ref|YP_001937484.1| succinyl-diaminopimelate desuccinylase [Orientia tsutsugamushi str.
           Ikeda]
 gi|238064765|sp|B3CRZ3|DAPE_ORITI RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|189180470|dbj|BAG40250.1| succinyl-diaminopimelate desuccinylase [Orientia tsutsugamushi str.
           Ikeda]
          Length = 388

 Score =  315 bits (807), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 173/386 (44%), Positives = 229/386 (59%), Gaps = 11/386 (2%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           +E L QLI   SVTP D GA   + N L   GF +  K+F  +    VKNLY  FG   P
Sbjct: 8   IELLKQLISFKSVTPNDNGAIDFITNLLVKQGFKVYVKEFGQEYK--VKNLYGYFGNGQP 65

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
           ++ FAGHIDVVP G    W YPPF AT  + KIYGRG+VDMKG+I+  ++AV  FI    
Sbjct: 66  NICFAGHIDVVPAGFIEQWKYPPFCATQYKDKIYGRGVVDMKGAISAMLSAVFCFIDNNN 125

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +F G+IS LIT DEEG A+ GTKKML WI K+G K D  I+GEPTC   IGDTIKIGRRG
Sbjct: 126 DFNGTISFLITADEEGEALFGTKKMLEWINKQGHKIDFTILGEPTCTDKIGDTIKIGRRG 185

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           S++ ++ + GKQGHVAYPHL  NP   ++ +L+       D GN  F+P+N+E+ +ID  
Sbjct: 186 SINFDLKVFGKQGHVAYPHLAINPNHLIVKILNSFIGSKIDEGNEFFAPSNLEVVSIDTN 245

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHF-SSPVSPV 303
           N   N+IP   +  FNIRFND+   + L E ++       +N+ + +      SS  S  
Sbjct: 246 NNITNIIPEIAQSKFNIRFNDIHTNEQLLEIVK-------KNIEQFTTNYDLQSSCRSRP 298

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           FL           + ++  T   P  STSGGTSDA F KDY P++EFGL+    H +NE 
Sbjct: 299 FLAKMSPYIFSFKELVHKVTKIKPEFSTSGGTSDAYFFKDYSPIVEFGLLNTMAHKINEY 358

Query: 364 ASLQDLEDLTCIYENFLQNWFITPSQ 389
             + DL+ L  +Y N L  + ++ S+
Sbjct: 359 CLINDLQTLCRVYYNALCLFLMSNSK 384


>gi|126738609|ref|ZP_01754314.1| succinyl-diaminopimelate desuccinylase [Roseobacter sp. SK209-2-6]
 gi|126720408|gb|EBA17114.1| succinyl-diaminopimelate desuccinylase [Roseobacter sp. SK209-2-6]
          Length = 381

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 163/384 (42%), Positives = 231/384 (60%), Gaps = 11/384 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D ++    LI+CPSVTP++GGA  +L N L   GF+    D        + NL+AR+G +
Sbjct: 5   DPIQLTADLIRCPSVTPEEGGALVLLENLLSEAGFACTRVD-----RGGICNLFARWGNK 59

Query: 64  A--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
                  F GH DVVP GD + W+ PPF A + +G +YGRG  DMK  +A F+AA   F 
Sbjct: 60  GHPRSFGFNGHTDVVPLGDESAWSMPPFGAEVKDGIMYGRGATDMKSGVAAFVAAAIDFT 119

Query: 122 PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
                 GS+ L ITGDEE  A++GT  +L +I +  E+ D C+VGEPTC + +G+ IKIG
Sbjct: 120 RNTPPDGSVILTITGDEEADALDGTTALLDYISEAKEQMDVCLVGEPTCPNEMGEMIKIG 179

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGS++   T+ GKQGH AYPH   NP+  +  L+ +L +   D G   F  + + + TI
Sbjct: 180 RRGSMTAWFTVTGKQGHSAYPHRANNPLNAMARLMDRLASHELDKGTEHFDASTLAVVTI 239

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
           D GNP+ NVIPAQ   + NIRFND      L E ++S   + IQ+  +   +V     +S
Sbjct: 240 DTGNPATNVIPAQCTSTVNIRFNDAHTGAGLTEWLQSEAER-IQD--EFGASVAMKIKIS 296

Query: 302 -PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL 360
              F+T    L+ L++ ++   TG  P LST+GGTSDARF+K +CPV+EFGLVG+TMH +
Sbjct: 297 GESFITPPGTLSDLVANAVEAETGRRPELSTTGGTSDARFVKHHCPVVEFGLVGKTMHQV 356

Query: 361 NENASLQDLEDLTCIYENFLQNWF 384
           +EN  ++ +E L  IY   L+++F
Sbjct: 357 DENVPVEQIEQLKAIYTRILKDYF 380


>gi|83949862|ref|ZP_00958595.1| succinyl-diaminopimelate desuccinylase [Roseovarius nubinhibens
           ISM]
 gi|83837761|gb|EAP77057.1| succinyl-diaminopimelate desuccinylase [Roseovarius nubinhibens
           ISM]
          Length = 381

 Score =  313 bits (801), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 159/388 (40%), Positives = 230/388 (59%), Gaps = 19/388 (4%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D ++   +L++C SVTP++GGA  +L   L+  GF+    D        V NL+AR+G +
Sbjct: 5   DPVDLTAKLVRCASVTPEEGGALVLLQGLLEEAGFACTRID-----RGGVSNLFARWGDK 59

Query: 64  AP--HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
                  F GH DVVP GD   W+  PF A I +GK++GRG  DMK  +A F+AA    +
Sbjct: 60  GATKSFGFNGHTDVVPVGDAVAWSVDPFGAEIRDGKLWGRGSTDMKSGVAAFVAAAIDLV 119

Query: 122 PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
                 G++ + +TGDEEG A++GT  +L W+E  GE+ D C+VGEPTC   +G+ IKIG
Sbjct: 120 RDAPPEGAVIITVTGDEEGDAVDGTTAILDWMEDAGERMDVCLVGEPTCPETMGEMIKIG 179

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSLS   TI G QGH AYPH   NPI  +  L+ +L++   D G   F P+ + + +I
Sbjct: 180 RRGSLSAWFTITGTQGHAAYPHRANNPIPAMARLVDRLSSRELDQGTEHFDPSTLAVVSI 239

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-----GIQNVPKLSHTVHF 296
           D GNP+ NVIPAQ     NIRFND  +  +L   +   L +     G++   K+  +   
Sbjct: 240 DTGNPASNVIPAQTSGIVNIRFNDSHSGASLSAWLHEELARVAEEFGVETEIKIKIS--- 296

Query: 297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRT 356
                  F+T    L+ L+++S+   TG  P+LST+GGTSDARF+K +CPV+EFGLVG+T
Sbjct: 297 ----GESFITPPGALSELVARSVEAETGVKPVLSTTGGTSDARFVKSHCPVVEFGLVGQT 352

Query: 357 MHALNENASLQDLEDLTCIYENFLQNWF 384
           MH ++E+  +  +E L  +Y   L+++F
Sbjct: 353 MHQVDEHVVVDHIEQLKGVYSRILRDYF 380


>gi|119385567|ref|YP_916622.1| succinyl-diaminopimelate desuccinylase [Paracoccus denitrificans
           PD1222]
 gi|238064766|sp|A1B5Y2|DAPE_PARDP RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|119376162|gb|ABL70926.1| succinyldiaminopimelate desuccinylase [Paracoccus denitrificans
           PD1222]
          Length = 382

 Score =  311 bits (798), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 171/387 (44%), Positives = 228/387 (58%), Gaps = 15/387 (3%)

Query: 3   PDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT 62
           PD  +   +LI+C SVTP +GGA  +L + L   GF     D +      V NL+AR+G 
Sbjct: 5   PDPAQLTARLIRCASVTPDEGGALVLLADVLGAAGFECHRVDREG-----VPNLFARWGA 59

Query: 63  EAPHLM-FAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
           +      F GH DVVPPGD   WT+PPFS   AEG I+GRG  DMK  +A F AA   F+
Sbjct: 60  QGARTFGFNGHTDVVPPGDPASWTHPPFSGHEAEGWIWGRGATDMKSGVAAFAAAAIGFV 119

Query: 122 PKYKN-FGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
            +     G++ L ITGDEEGP  +GT+ +L W+  +GE+ D CIVGEP+    +G+ IKI
Sbjct: 120 TQTPPPDGAVILAITGDEEGPGKHGTRALLDWMAARGERMDVCIVGEPSNPDRMGEMIKI 179

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGS++ +I  HG QGH AYPH   NPI  L+ LLH+LT+   D G   F P+ +++TT
Sbjct: 180 GRRGSMTLQIEAHGIQGHAAYPHRARNPIHALLRLLHELTDAPLDEGTEHFDPSGLQVTT 239

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHF--SS 298
           +D GNP+ NVIP + +   NIRFND    ++L      R+I+           V F  S+
Sbjct: 240 VDCGNPASNVIPERARAVINIRFNDAHTAESL-----DRMIRARAAAISAETKVDFAIST 294

Query: 299 PVS-PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTM 357
            VS   FLT       L++  +   TG  P+LSTSGGTSDARF+KD+CPV+EFGLVG  M
Sbjct: 295 DVSGESFLTAPGPFVDLVAGVVREETGLDPVLSTSGGTSDARFVKDHCPVLEFGLVGHFM 354

Query: 358 HALNENASLQDLEDLTCIYENFLQNWF 384
           H ++E      +  L  IY   L+ +F
Sbjct: 355 HQVDERVPADQVRQLARIYRRILERYF 381


>gi|295691227|ref|YP_003594920.1| succinyl-diaminopimelate desuccinylase [Caulobacter segnis ATCC
           21756]
 gi|295433130|gb|ADG12302.1| succinyl-diaminopimelate desuccinylase [Caulobacter segnis ATCC
           21756]
          Length = 386

 Score =  311 bits (798), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 171/382 (44%), Positives = 225/382 (58%), Gaps = 12/382 (3%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +E    LI+ PSVTP D GA   L   L+ LGF+     F       ++NLYAR GT 
Sbjct: 12  DPVELAQALIRRPSVTPADAGAMDTLQRQLEALGFACRRMTFGE-----IENLYARRGTA 66

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            P+L FAGH DVVP GD   WT  PF A I +G ++GRG VDMK S      A    +P 
Sbjct: 67  RPNLCFAGHTDVVPVGDDAAWTAGPFEAEIKDGILFGRGAVDMK-SAIAAFVAAVANVPD 125

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
           +   GSIS LITGDEEG A +GT K++  +  +GE  D CIVGEPT  +++GD +KIGRR
Sbjct: 126 HA--GSISFLITGDEEGVAEDGTVKVVEALAAEGEIIDHCIVGEPTSANVLGDMVKIGRR 183

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++  I + GKQGHVAYPH   NPI  ++ +L +L +   D G T F P+N+E+TT+DV
Sbjct: 184 GSINAWIAVDGKQGHVAYPHRAANPIPVMVDILSRLQSRVLDEGYTGFQPSNLEVTTVDV 243

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS-P 302
           GN + NVIPA  K   NIRFN     K L   I     +  +     S  V     +S  
Sbjct: 244 GNTATNVIPASAKARVNIRFNPAHKGKDLAAWIERECREAAEG---FSGRVEALCKISGE 300

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNE 362
            FLT     T ++  ++ + TG +P LST+GGTSDARFI+  CPV+EFGLVG TMH ++E
Sbjct: 301 AFLTEPGAFTDVIVAAVGDATGRVPELSTTGGTSDARFIRALCPVVEFGLVGSTMHQVDE 360

Query: 363 NASLQDLEDLTCIYENFLQNWF 384
              ++++  L   YE  +  +F
Sbjct: 361 RVPVEEVRQLAGAYEALINRYF 382


>gi|78485635|ref|YP_391560.1| succinyl-diaminopimelate desuccinylase [Thiomicrospira crunogena
           XCL-2]
 gi|123555413|sp|Q31G37|DAPE_THICR RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|78363921|gb|ABB41886.1| succinyldiaminopimelate desuccinylase [Thiomicrospira crunogena
           XCL-2]
          Length = 378

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 172/379 (45%), Positives = 232/379 (61%), Gaps = 13/379 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           +LI+  SVTP D G   ++ + LK LGF IE   F       V+NL+AR G + P ++FA
Sbjct: 10  KLIQTESVTPNDNGCQTLIADYLKPLGFDIEPMPFGE-----VENLWARAGKDGPVIVFA 64

Query: 71  GHIDVVPPGDFNHWTYPPFSATI-AEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-G 128
           GH DVVP G    WT+PPFSA I A+G +YGRG  DMK SIACF+ A  +FI +Y +F G
Sbjct: 65  GHTDVVPTGPEEKWTHPPFSAHIDADGIMYGRGTADMKSSIACFMVATKQFIKQYPDFKG 124

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           SI+ LIT DEEGPA+NGT K++  +E + EK++ C+VGEP+ ++ +GD+IK GRRGSLSG
Sbjct: 125 SIAFLITSDEEGPAVNGTVKVIEALEARNEKFEYCLVGEPSSSNTLGDSIKNGRRGSLSG 184

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
            +TI G QGH+AYP L ENPI  L P L  + N  +D GN  F PT+ +++ I  G  + 
Sbjct: 185 HLTIKGIQGHIAYPQLAENPIHTLSPALSDMVNKVWDKGNDYFPPTSFQVSNIHSGTGAT 244

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHD 308
           NVIP    + FN RF+     ++LK  I       I +  +L++ + ++    P     D
Sbjct: 245 NVIPGDCVVDFNFRFSTEQTPESLKAGIHQ-----ILDSHQLNYDLDWNLSGLPFITPAD 299

Query: 309 RKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQ 367
            +L   +SK+I    G  P LST GGTSD RFI      VIE G +  T+H ++E  S+ 
Sbjct: 300 GELIQAVSKAIEQEMGTTPELSTGGGTSDGRFIAQTGAQVIELGPLNDTIHKIDERVSVS 359

Query: 368 DLEDLTCIYENFLQNWFIT 386
           DLE LT IY N L N  +T
Sbjct: 360 DLEKLTQIYRNTLINLLVT 378


>gi|315497923|ref|YP_004086727.1| succinyl-diaminopimelate desuccinylase [Asticcacaulis excentricus
           CB 48]
 gi|315415935|gb|ADU12576.1| succinyl-diaminopimelate desuccinylase [Asticcacaulis excentricus
           CB 48]
          Length = 384

 Score =  311 bits (796), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 174/389 (44%), Positives = 233/389 (59%), Gaps = 22/389 (5%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           T D +E    LI  PSVTP D GA   +  TL+ LGF+ E   F+      ++NLYAR G
Sbjct: 8   TLDPVELTKALINHPSVTPVDAGAMDRVQQTLESLGFACERLKFRE-----IENLYARRG 62

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF- 120
           T +P+L FAGH DVVP G  + W   PF+ATI  G + GRG VDMKG IA +IAAV+RF 
Sbjct: 63  TASPNLCFAGHTDVVPEGALDGWRSDPFAATIENGVLTGRGAVDMKGGIAAWIAAVSRFD 122

Query: 121 -IPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
            +P     GS+S LITGDEEG A++GTKK++  + + GE  D CIVGEPT + ++GD IK
Sbjct: 123 NVP-----GSLSFLITGDEEGEALDGTKKVVEHLRQTGEVIDHCIVGEPTSSAVLGDMIK 177

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           +GRRGS++  IT+ GKQGHVAYP    NPI  L+ ++ +L     D G   F P+N+EIT
Sbjct: 178 VGRRGSINATITVTGKQGHVAYPQRALNPIPVLVAVMAELDGRVLDEGYERFLPSNLEIT 237

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLK---EEIRSRLIKGIQNVPKLSHTVHF 296
           T DV N + N+IP       NIRFN   +  +L+   EE+ +R      +  +    +  
Sbjct: 238 TFDVANKTTNLIPQTASGRINIRFNPTHSGASLQAWIEEVCAR------HAERSGAVIEV 291

Query: 297 SSPVS-PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGR 355
            + +S   FLT       ++  +I +        ST+GGTSDARFI+  CPV+EFGLVG+
Sbjct: 292 KAAISGEAFLTEAGPFVDVIQNAILDVLKVEADPSTTGGTSDARFIRALCPVVEFGLVGQ 351

Query: 356 TMHALNENASLQDLEDLTCIYENFLQNWF 384
           TMH +NE   +QDL  LT  Y   +  +F
Sbjct: 352 TMHQVNEATPVQDLYALTEAYTALISKYF 380


>gi|259417952|ref|ZP_05741871.1| succinyl-diaminopimelate desuccinylase [Silicibacter sp. TrichCH4B]
 gi|259346858|gb|EEW58672.1| succinyl-diaminopimelate desuccinylase [Silicibacter sp. TrichCH4B]
          Length = 381

 Score =  310 bits (794), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 166/384 (43%), Positives = 232/384 (60%), Gaps = 11/384 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D ++    L++CPSVTP +GGA  +L   L   GF+    D        V NL+AR+G +
Sbjct: 5   DPVQLTADLVRCPSVTPTEGGALVLLERLLSGAGFACTRVD-----RGEVSNLFARWGDK 59

Query: 64  --APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
             A    F GH DVVP GD   WT+ PF A + EG +YGRG  DMK  +A F AA   F+
Sbjct: 60  GHARTFGFNGHTDVVPVGDAAAWTHDPFGAEVVEGVMYGRGTTDMKSGVAAFAAAAIDFV 119

Query: 122 PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
            +    G++ L ITGDEEG A++GT  +L ++++ GEK   C+VGEPTC + +G+ IKIG
Sbjct: 120 RETPPDGAVVLTITGDEEGDAVDGTTALLDYMDQTGEKMSVCLVGEPTCPNHMGEMIKIG 179

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGS++   T+ G QGH AYPH   NP+ GL  L+ +L +   D G+  F  + + I TI
Sbjct: 180 RRGSMTAWFTVTGVQGHSAYPHRANNPLNGLSRLMDRLGSHQLDEGSEHFDASTLAIVTI 239

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVP-KLSHTVHFSSPV 300
           D GNP+ NVIPAQ + + NIRFNDL +  +L + ++S   K  +    K+   V  S   
Sbjct: 240 DTGNPATNVIPAQGRAAVNIRFNDLHSGASLTDWLQSEADKIAEEFGLKVEMKVQIS--- 296

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL 360
              F+T    L+ L+SK++   T  +P LST+GGTSDARF+K +CPV+EFGLVG+TMH +
Sbjct: 297 GESFITPPGDLSELVSKAVQTETNQVPELSTTGGTSDARFVKAHCPVVEFGLVGKTMHQV 356

Query: 361 NENASLQDLEDLTCIYENFLQNWF 384
           +EN  +  +  L  IY   L ++F
Sbjct: 357 DENVEVAQIHQLKSIYTRILTDYF 380


>gi|51474042|ref|YP_067799.1| succinyl-diaminopimelate desuccinylase [Rickettsia typhi str.
           Wilmington]
 gi|81389899|sp|Q68VN9|DAPE_RICTY RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|51460354|gb|AAU04317.1| succinyl-diaminopimelate desuccinylase [Rickettsia typhi str.
           Wilmington]
          Length = 383

 Score =  309 bits (792), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 175/380 (46%), Positives = 223/380 (58%), Gaps = 4/380 (1%)

Query: 8   HLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHL 67
           +L  LI   SVTP   GA   +   LK  GF  E K F       V NLY  FG+  P++
Sbjct: 5   YLKNLISFESVTPNSAGAVEYIDGLLKQHGFKTEIKIFGDSKNERVTNLYGVFGSNEPNI 64

Query: 68  MFAGHIDVVPPGDFNHW-TYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKN 126
            F GH+DVVP G+   W    PF     +GKIYGRG VDMKG+IACF+AA   FI    +
Sbjct: 65  CFVGHVDVVPAGNHEFWHNSNPFKFHEQDGKIYGRGAVDMKGAIACFLAASLNFIKNNMD 124

Query: 127 F-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGS 185
           F GSIS LIT DEEG + +GTK+ML +I  +  K D  +VGEPTC   IGDTIKIGRRGS
Sbjct: 125 FKGSISFLITSDEEGKSTHGTKEMLQYIYDQRYKIDFAVVGEPTCEKEIGDTIKIGRRGS 184

Query: 186 LSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGN 245
           ++ ++ I G  GHVAYPH   NP+  LI +L++LTNI  D G   F  +N+E+T IDVGN
Sbjct: 185 VNFKLNIVGLAGHVAYPHKANNPLPCLIKILNELTNIRLDEGTEFFQNSNLEVTNIDVGN 244

Query: 246 PSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV-SPVF 304
              N IPA  +  FNIRFN L + +TL + I  ++IK      K+ + + +SS   S V 
Sbjct: 245 DILNTIPASAEACFNIRFNSLHSVETLSQLIE-QIIKQYCKEYKVDYKLEYSSSAESFVQ 303

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENA 364
             +D       +  I  T       STSGGTSDARF+KDYC ++EFGL+    H +NE  
Sbjct: 304 NPNDNDKIKEFADVIERTLKIKSEFSTSGGTSDARFVKDYCSLVEFGLLSEMAHKINEYT 363

Query: 365 SLQDLEDLTCIYENFLQNWF 384
            + DL+ L  +Y NFL   F
Sbjct: 364 KISDLQKLYDVYYNFLMEIF 383


>gi|294678819|ref|YP_003579434.1| succinyl-diaminopimelate desuccinylase [Rhodobacter capsulatus SB
           1003]
 gi|294477639|gb|ADE87027.1| succinyl-diaminopimelate desuccinylase [Rhodobacter capsulatus SB
           1003]
          Length = 379

 Score =  309 bits (792), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 169/386 (43%), Positives = 236/386 (61%), Gaps = 10/386 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT D ++    LI+CPSVTP +GGA  +L   L   GF+    D   +N +   NL+AR+
Sbjct: 1   MTLDPVQLTADLIRCPSVTPVEGGALVLLERVLSAAGFACTRVD---RNGT--PNLFARW 55

Query: 61  GTE-APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
           G + A    F GH DVVP GD   WT  PFS  + EG ++GRG  DMK  +A F+AA   
Sbjct: 56  GAKGAKTFGFNGHTDVVPVGDAAAWTQEPFSGAVIEGVLWGRGATDMKSGVAAFVAAAVD 115

Query: 120 FIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           F+      G+I L ITGDEEGP  +G   +L W++ +GE    C+VGEPTC   +GD +K
Sbjct: 116 FVTTTPPEGAIILTITGDEEGPGKDGALALLDWMKAEGEAMSVCLVGEPTCPETLGDMMK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGS++  + + G QGH AYPH  +NP+  L+ LL ++T    D G   F P+ ++IT
Sbjct: 176 IGRRGSMTFYLEVEGVQGHSAYPHRAKNPLHALVELLGRMTAEPLDRGTEHFEPSTLQIT 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           TID GNP+ NVIPA+ + + NIRFND  +   +++  R  LI  I+   +    V   + 
Sbjct: 236 TIDCGNPANNVIPAKARATVNIRFNDAHSSAKIEDWARG-LIAEIEA--ETGTRVSLCTE 292

Query: 300 VS-PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
           VS   FLT       L+S+++ + TG +P+LSTSGGTSDARF+KD+CPV+EFGLVG+TMH
Sbjct: 293 VSGESFLTPPGDFVELVSRAVVSETGVVPVLSTSGGTSDARFVKDHCPVLEFGLVGKTMH 352

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E   +  +  L  IY   L+++F
Sbjct: 353 QVDERIEVAQITRLKAIYARCLRDFF 378


>gi|15604703|ref|NP_221221.1| succinyl-diaminopimelate desuccinylase [Rickettsia prowazekii str.
           Madrid E]
 gi|81554753|sp|Q9ZC93|DAPE_RICPR RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|3861398|emb|CAA15297.1| SUCCINYL-DIAMINOPIMELATE DESUCCINYLASE (dapE) [Rickettsia
           prowazekii]
 gi|292572539|gb|ADE30454.1| Succinyl-diaminopimelate desuccinylase [Rickettsia prowazekii Rp22]
          Length = 383

 Score =  308 bits (790), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 170/376 (45%), Positives = 220/376 (58%), Gaps = 4/376 (1%)

Query: 8   HLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHL 67
           +L  L+   SVTP   GA   + + LK   F  E K F       V NLYA FG   P++
Sbjct: 5   YLKNLVSFKSVTPNSAGAIEYIDDLLKQHSFKTEIKIFGDSKKEQVTNLYAIFGGNEPNI 64

Query: 68  MFAGHIDVVPPGDFNHW-TYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKN 126
            F GH+DVVP G++  W    PF     +GKIYGRG VDMKG+IACF+AA   FI    +
Sbjct: 65  CFVGHVDVVPAGNYEFWHNSNPFKFHEQDGKIYGRGTVDMKGAIACFLAASLNFIKNNTD 124

Query: 127 F-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGS 185
           F GSIS LIT DEEG + +GTK+ML +I  +  K D  +VGEPTC   IGDTIKIGRRGS
Sbjct: 125 FKGSISFLITSDEEGKSKHGTKEMLQYIYDQRYKIDFAVVGEPTCEKEIGDTIKIGRRGS 184

Query: 186 LSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGN 245
           ++ ++ I G  GHVAYPH   NP+  LI +L++L NI  D G   F  +N+E+T IDV N
Sbjct: 185 VNFKLNIVGLAGHVAYPHKANNPLPCLIKILNELINIKLDEGTEFFQNSNLEVTNIDVDN 244

Query: 246 PSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFL 305
            + N IPA     FNIRFN L N +TL++ I  ++IK      K+ + + +SS       
Sbjct: 245 DTSNTIPASAAAHFNIRFNSLHNVETLRQLIE-QIIKQYCKEYKVDYKLEYSSSAESFIQ 303

Query: 306 T-HDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENA 364
             +D       +  I  T       STSGGTSDARF+KDYC ++EFGL+    H +NE  
Sbjct: 304 NPNDNDKIKKFANVIERTLKIKSKFSTSGGTSDARFVKDYCSLVEFGLLSDMAHKINEYT 363

Query: 365 SLQDLEDLTCIYENFL 380
            + DL+ L  +Y NFL
Sbjct: 364 KISDLQKLYNVYYNFL 379


>gi|58584825|ref|YP_198398.1| succinyl-diaminopimelate desuccinylase [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
 gi|75497750|sp|Q5GS68|DAPE_WOLTR RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|58419141|gb|AAW71156.1| Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase
           [Wolbachia endosymbiont strain TRS of Brugia malayi]
          Length = 401

 Score =  308 bits (790), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 233/385 (60%), Gaps = 8/385 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D +E   +LI   S+TP+D GA   +   L+  GF  E  +F   N + VKNLYA++
Sbjct: 1   MKIDPVELTKKLISFKSITPRDDGAIEHIAAILEKSGFDCEILEFG-DNKTKVKNLYAKY 59

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
                +L FAGH+DVVPPG    W   PFS  + +G +YGRG  DMK  IA FI A+   
Sbjct: 60  INGVQNLCFAGHVDVVPPGQLKDWISDPFSPEVRDGLLYGRGATDMKSGIAAFITAMVDL 119

Query: 121 IP-KYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  K++  GSIS LIT  EE     GTK +L W+E K +K D C+V EPT +  +GDTIK
Sbjct: 120 VAEKFRFNGSISALITSAEESTEEYGTKAVLKWMESKHKKIDYCVVAEPTSSEKLGDTIK 179

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGS + E+  HGKQGHVAYP L +NPI  +I +L+++ +  FD GN  F P+N EIT
Sbjct: 180 IGRRGSATFELICHGKQGHVAYPDLADNPIYKMISILNRIKDTTFDGGNKYFQPSNCEIT 239

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           TIDVGN + NVI   +   FNIR+N++     L + I   +   + N  KLS  +H S  
Sbjct: 240 TIDVGNSTDNVILDSITAGFNIRYNNMQTPDGLYKLI-DEICFSVTNDYKLS--MHSS-- 294

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
               FL+   + T ++  +I   T    +L+TSGGTSDA FIKD CPVIEFG++ +T H 
Sbjct: 295 -RGAFLSTPDRNTDVMFDAINKVTNIDAVLATSGGTSDAAFIKDVCPVIEFGMINKTSHQ 353

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           +NE   + D+  LT IY+ F++++F
Sbjct: 354 VNECVLVNDIHKLTAIYKEFIKSYF 378


>gi|325265666|ref|ZP_08132355.1| succinyl-diaminopimelate desuccinylase [Kingella denitrificans ATCC
           33394]
 gi|324982797|gb|EGC18420.1| succinyl-diaminopimelate desuccinylase [Kingella denitrificans ATCC
           33394]
          Length = 375

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 170/373 (45%), Positives = 225/373 (60%), Gaps = 15/373 (4%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           QL+   S+TP D     IL + L+ +GF IEE  F   NT   KN YAR G+ AP L FA
Sbjct: 10  QLLSEASITPDDKNCQQILADRLRAIGFQIEEMHF--GNT---KNFYARLGSAAPLLCFA 64

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVP GD   WT+ PF+ T  +GK+Y RG  DMK +IACF+ A  RF   +  F GS
Sbjct: 65  GHTDVVPAGDVRQWTFDPFTPTEHDGKLYARGAADMKTAIACFVTACERFTAAHPQFNGS 124

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           ++LLIT DEEG A +GT K++  ++ +GE  D CIVGEPT    +GDT+K GRRGSLSG 
Sbjct: 125 LALLITSDEEGDAHDGTTKVVDALKARGEHIDYCIVGEPTAVARLGDTLKNGRRGSLSGT 184

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +TIHGKQGH+AYPHL ENPI    P+L +LT + +D GN  F  T  +I+ I  G  + N
Sbjct: 185 LTIHGKQGHIAYPHLAENPIHAAAPVLAELTAVQWDKGNAYFPATGFQISNIRGGTGATN 244

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPVFLTHD 308
           VIP  V++ FN RF+    + +L+  +   L K G+    K     H S   +P FLT  
Sbjct: 245 VIPGSVQVQFNFRFSTEQTQSSLQTRVHEILDKHGV----KYDLAWHLSG--NP-FLTEA 297

Query: 309 RKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNENASLQ 367
             LT     ++ +  G    LST+GGTSD RFIK     +IE G V  T+H ++E+  L 
Sbjct: 298 GVLTQAAQNAVRDICGISAELSTTGGTSDGRFIKAVARELIELGFVNATIHQIDEHIELA 357

Query: 368 DLEDLTCIYENFL 380
           D++ L+ IYE+ +
Sbjct: 358 DIDKLSAIYEHMM 370


>gi|238064829|sp|Q0BUB7|DAPE_GRABC RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 383

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 175/393 (44%), Positives = 231/393 (58%), Gaps = 29/393 (7%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYA-RFGT 62
           D L     L++CPSVTP D GA  +L   L   GF++ +  F       + N YA R G 
Sbjct: 3   DPLALAQALLRCPSVTPLDAGAQSVLAEALTAQGFTVTQLPFGD-----IANFYAKRVGP 57

Query: 63  EA-PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
            + PHL FAGH DVVPPGD   W+   F+  + +G + GRG  DMKG+IA F+AA A   
Sbjct: 58  RSGPHLCFAGHTDVVPPGDAP-WSVDAFAGEVHDGVLIGRGACDMKGAIASFVAACA--- 113

Query: 122 PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
            +  + G+ISLLITGDEEG A +GT ++L W+ + GE  D C+VGEPT    +G+ IKIG
Sbjct: 114 ARPDHPGTISLLITGDEEGVATDGTVRVLDWMRQAGEIPDFCVVGEPTNPGRLGEVIKIG 173

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSL+  +T+ G+QGHVAYPH  +NP+  L+  LH LT    D G   F P+++++TT+
Sbjct: 174 RRGSLNATLTVRGRQGHVAYPHRADNPLPRLVAALHALTTTRLDDGMEGFEPSSLQLTTV 233

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGI--QNVPKLSHTVHFSSP 299
           DVGNP+ NVIP Q +   NIRFN L     L     +R ++GI   + P     +  S  
Sbjct: 234 DVGNPATNVIPEQAQARLNIRFNPLHRGDDL-----ARWLRGIVQDHAPDAVIDIAIS-- 286

Query: 300 VSPVFLTH-DRKLT-------SLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFG 351
               F+T  DR          + L  +I   TG  P L T GGTSDARFI   CPV+EFG
Sbjct: 287 -GEAFVTDPDRDPRPGASHGIAALRMAIQRITGLSPRLDTGGGTSDARFITHLCPVVEFG 345

Query: 352 LVGRTMHALNENASLQDLEDLTCIYENFLQNWF 384
           LVG TMH  +E  +++DL+DLT IYE  L  + 
Sbjct: 346 LVGATMHQRDEAVAVRDLQDLTGIYEALLDFYL 378


>gi|197103845|ref|YP_002129222.1| succinyl-diaminopimelate desuccinylase [Phenylobacterium zucineum
           HLK1]
 gi|238064768|sp|B4RDU4|DAPE_PHEZH RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|196477265|gb|ACG76793.1| succinyl-diaminopimelate desuccinylase [Phenylobacterium zucineum
           HLK1]
          Length = 380

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 170/382 (44%), Positives = 226/382 (59%), Gaps = 9/382 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +E   +LI+ PSVTP D GA  ++  TL  LGF+     F       ++NLYAR+GT 
Sbjct: 6   DAVELSRELIRKPSVTPADEGAMDVVERTLAGLGFACRRMRFGE-----IENLYARYGTA 60

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            P+L FAGH DVVP GD   W+   F+A + +G + GRG VDMK +IA F AA A  I  
Sbjct: 61  RPNLCFAGHTDVVPVGDAAAWSKDAFAADVVDGVLIGRGAVDMKSAIAAFAAAAAEAIAA 120

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
            +  GS+S LITGDEEG A +GTKK++  +  +GE  D C+VGEPT     GD +K+GRR
Sbjct: 121 GRVTGSVSFLITGDEEGVATHGTKKVVEALLAEGEAIDHCVVGEPTSAESFGDMVKVGRR 180

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++ EI + G QGHVAYPH   NP+  L+ LL  L +   D G   F P+N+E+T IDV
Sbjct: 181 GSINAEILVEGIQGHVAYPHRAANPVPVLVRLLAALQDRALDEGYPEFQPSNLEVTMIDV 240

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVP-KLSHTVHFSSPVSP 302
            N + NVIP   K   NIRFN     + L + I +   K       K++ T   S     
Sbjct: 241 PNTATNVIPGTAKARLNIRFNPNHTGQALADWIAAEARKAADGFKGKVTVTPQIS---GE 297

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNE 362
            FLT     T L++ ++ + TG  P LSTSGGTSDARFI+  CPV+E GLVGRTMH ++E
Sbjct: 298 AFLTERGPFTELVAAAVKDVTGAEPELSTSGGTSDARFIRALCPVVEVGLVGRTMHQVDE 357

Query: 363 NASLQDLEDLTCIYENFLQNWF 384
            A + ++  L  +Y   +  +F
Sbjct: 358 RAPVDEIRRLQAVYAAIIARYF 379


>gi|84514593|ref|ZP_01001957.1| succinyl-diaminopimelate desuccinylase [Loktanella vestfoldensis
           SKA53]
 gi|84511644|gb|EAQ08097.1| succinyl-diaminopimelate desuccinylase [Loktanella vestfoldensis
           SKA53]
          Length = 379

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 163/379 (43%), Positives = 223/379 (58%), Gaps = 15/379 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            L++CPSVTP +GGA  +L + L   GF+    D        V NL+AR+G +  +  F 
Sbjct: 10  DLVRCPSVTPVEGGALVLLEDLLTKGGFTCTRVD-----RGGVSNLFARWGRQGANRTFG 64

Query: 71  --GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFG 128
             GH DVVP GD   WT PPF A I +G +YGRG  DMK  +A F AA   F+      G
Sbjct: 65  FNGHTDVVPLGDEAAWTMPPFGAVIKDGYLYGRGSTDMKSGVAAFAAAALDFVTDTPPDG 124

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           ++ L ITGDEEG A++GT  +L W+   GE    C+VGEPTC  ++G+ +KIGRRGSL+ 
Sbjct: 125 AVILAITGDEEGDALDGTTALLDWMATNGEAMSVCLVGEPTCPDVMGEAMKIGRRGSLNA 184

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
             T+ G QGH AYPH  +NP+  +  L+  L +   D G   F P+ + + TID GNP+ 
Sbjct: 185 TFTVTGVQGHSAYPHRAKNPLPAVARLVDILASHALDQGTAHFDPSTLAVVTIDTGNPAT 244

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV---SPVFL 305
           NVIPAQ K   NIRFNDL +  +L E      ++GI +       V  +  V      F+
Sbjct: 245 NVIPAQTKAGVNIRFNDLHSGASLTE-----WMQGIADQVAADFGVRIAMQVKVSGESFI 299

Query: 306 THDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENAS 365
           T    L+ L+ K++   TG  P+LSTSGGTSDARF++ +CPV+EFGLVG+TMH ++E  +
Sbjct: 300 TPPGPLSDLVGKAVKAETGRDPVLSTSGGTSDARFVQHHCPVVEFGLVGKTMHQVDERVA 359

Query: 366 LQDLEDLTCIYENFLQNWF 384
           +  +  L  IY   L ++F
Sbjct: 360 VDQIVQLKAIYGRILADYF 378


>gi|114327351|ref|YP_744508.1| succinyl-diaminopimelate desuccinylase [Granulibacter bethesdensis
           CGDNIH1]
 gi|114315525|gb|ABI61585.1| succinyl-diaminopimelate desuccinylase [Granulibacter bethesdensis
           CGDNIH1]
          Length = 412

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 175/393 (44%), Positives = 231/393 (58%), Gaps = 29/393 (7%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYA-RFGT 62
           D L     L++CPSVTP D GA  +L   L   GF++ +  F       + N YA R G 
Sbjct: 32  DPLALAQALLRCPSVTPLDAGAQSVLAEALTAQGFTVTQLPFGD-----IANFYAKRVGP 86

Query: 63  EA-PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
            + PHL FAGH DVVPPGD   W+   F+  + +G + GRG  DMKG+IA F+AA A   
Sbjct: 87  RSGPHLCFAGHTDVVPPGDAP-WSVDAFAGEVHDGVLIGRGACDMKGAIASFVAACA--- 142

Query: 122 PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
            +  + G+ISLLITGDEEG A +GT ++L W+ + GE  D C+VGEPT    +G+ IKIG
Sbjct: 143 ARPDHPGTISLLITGDEEGVATDGTVRVLDWMRQAGEIPDFCVVGEPTNPGRLGEVIKIG 202

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSL+  +T+ G+QGHVAYPH  +NP+  L+  LH LT    D G   F P+++++TT+
Sbjct: 203 RRGSLNATLTVRGRQGHVAYPHRADNPLPRLVAALHALTTTRLDDGMEGFEPSSLQLTTV 262

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGI--QNVPKLSHTVHFSSP 299
           DVGNP+ NVIP Q +   NIRFN L     L     +R ++GI   + P     +  S  
Sbjct: 263 DVGNPATNVIPEQAQARLNIRFNPLHRGDDL-----ARWLRGIVQDHAPDAVIDIAIS-- 315

Query: 300 VSPVFLTH-DRKLT-------SLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFG 351
               F+T  DR          + L  +I   TG  P L T GGTSDARFI   CPV+EFG
Sbjct: 316 -GEAFVTDPDRDPRPGASHGIAALRMAIQRITGLSPRLDTGGGTSDARFITHLCPVVEFG 374

Query: 352 LVGRTMHALNENASLQDLEDLTCIYENFLQNWF 384
           LVG TMH  +E  +++DL+DLT IYE  L  + 
Sbjct: 375 LVGATMHQRDEAVAVRDLQDLTGIYEALLDFYL 407


>gi|163738124|ref|ZP_02145540.1| succinyl-diaminopimelate desuccinylase [Phaeobacter gallaeciensis
           BS107]
 gi|161388740|gb|EDQ13093.1| succinyl-diaminopimelate desuccinylase [Phaeobacter gallaeciensis
           BS107]
          Length = 385

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 160/376 (42%), Positives = 222/376 (59%), Gaps = 11/376 (2%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA-PHLM-F 69
           LI+C SVTP++GGA  +L   L   GF+    D        V NL AR+G +  P  M F
Sbjct: 15  LIRCASVTPEEGGALVLLDKVLSAAGFTCTRVD-----RGEVSNLIARWGDKGHPRTMGF 69

Query: 70  AGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGS 129
            GH DVVP GD N WT  PF A   +G +YGRG  DMK  +A F+AA    +      G+
Sbjct: 70  NGHTDVVPVGDTNAWTVDPFGAEEKDGFLYGRGATDMKSGVAAFVAAAIDLVQTTPPDGA 129

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I L ITGDEEG AI+GT  +L  ++++GE+   C+VGEPTC   +G+ IKIGRRGSLS  
Sbjct: 130 ILLTITGDEEGDAIDGTTALLDHMDREGEQMAVCLVGEPTCPDKMGEMIKIGRRGSLSAW 189

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
            T+ G QGH AYPH  +NP+  ++ L+ +L +   D G   F  + + + TID GNP+ N
Sbjct: 190 FTVTGVQGHSAYPHRAKNPLNAMVRLMDRLASHELDQGTEHFDASTLAVVTIDTGNPATN 249

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS-PVFLTHD 308
           VIPAQ + + NIRFND      L + +R+   +  ++       +     VS   F+T  
Sbjct: 250 VIPAQTRSTVNIRFNDAHTGAELSDWLRAEAARAAKD---FGVDIAVEIKVSGESFITPP 306

Query: 309 RKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQD 368
             L+ L+S ++   TG  P LST+GGTSDARF+K++CPV+E GLVG+TMH ++E   +  
Sbjct: 307 GPLSDLVSAAVETETGRKPQLSTTGGTSDARFVKNHCPVVEVGLVGKTMHQVDERVEIAQ 366

Query: 369 LEDLTCIYENFLQNWF 384
           +  L  IY   L+++F
Sbjct: 367 IHQLKSIYGRILRDYF 382


>gi|126724390|ref|ZP_01740233.1| succinyl-diaminopimelate desuccinylase [Rhodobacterales bacterium
           HTCC2150]
 gi|126705554|gb|EBA04644.1| succinyl-diaminopimelate desuccinylase [Rhodobacterales bacterium
           HTCC2150]
          Length = 431

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 167/387 (43%), Positives = 230/387 (59%), Gaps = 11/387 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D ++    L+KC SVTP +GGA   L   L   GF     D    +     NLYAR+
Sbjct: 52  MASDPVKITETLVKCASVTPTEGGALVYLAELLGAAGFECTRVDRGETS-----NLYARW 106

Query: 61  GTE--APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
           G +  A    F GH DVVP GD + WT+PPFSA I +G +YGRG  DMK  +A F AA  
Sbjct: 107 GAKGHARSFGFNGHTDVVPVGDEDAWTHPPFSANIVDGWLYGRGSTDMKSGVAAFAAAAI 166

Query: 119 RFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
            F+      G++ L ITGDEEG AI+GT  +L W++ + E   AC+VGEPTC   +G+ +
Sbjct: 167 DFVTDTSPDGAVILAITGDEEGVAIDGTVALLDWMDNQNEAMTACLVGEPTCPDTMGEMM 226

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGS++   T+HG QGH AYPH   NP+  +  L+ +L +   DTG   F  + + +
Sbjct: 227 KIGRRGSMTAYFTVHGIQGHSAYPHRALNPLPPMARLMDRLASHTLDTGTDHFDASTLAV 286

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           TTID GNP+ NVIPA  K + NIRFND      L   ++S++    +        +   +
Sbjct: 287 TTIDTGNPANNVIPAACKATVNIRFNDAHTSTDLIAWLQSQV---DETTTADGVKIEMKT 343

Query: 299 PVS-PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTM 357
            VS   FLT   +L++L+S+S+ + TG  P+ ST+GGTSDARF+K++CPV+EFGLVG+TM
Sbjct: 344 QVSGESFLTPPGELSALISRSVKDVTGVEPVPSTTGGTSDARFVKNHCPVVEFGLVGKTM 403

Query: 358 HALNENASLQDLEDLTCIYENFLQNWF 384
           H ++E   +  +E L  IY   L  +F
Sbjct: 404 HQVDERVEVAHIEQLKEIYSKILAGYF 430


>gi|163742483|ref|ZP_02149869.1| succinyl-diaminopimelate desuccinylase [Phaeobacter gallaeciensis
           2.10]
 gi|161384068|gb|EDQ08451.1| succinyl-diaminopimelate desuccinylase [Phaeobacter gallaeciensis
           2.10]
          Length = 385

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 160/376 (42%), Positives = 222/376 (59%), Gaps = 11/376 (2%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA-PHLM-F 69
           LI+C SVTP++GGA  +L   L   GF+    D        V NL AR+G +  P  M F
Sbjct: 15  LIRCASVTPEEGGALVLLDKVLSAAGFTCTRVD-----RGEVSNLIARWGDKGHPRTMGF 69

Query: 70  AGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGS 129
            GH DVVP GD N WT  PF A   +G +YGRG  DMK  +A F+AA    +      G+
Sbjct: 70  NGHTDVVPVGDTNAWTVDPFGAEEKDGFLYGRGATDMKSGVAAFVAAAIDLVQTTPPDGA 129

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I L ITGDEEG AI+GT  +L  ++++GE+   C+VGEPTC   +G+ IKIGRRGSLS  
Sbjct: 130 ILLTITGDEEGDAIDGTTALLDHMDREGEQMAVCLVGEPTCPDEMGEMIKIGRRGSLSAW 189

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
            T+ G QGH AYPH  +NP+  ++ L+ +L +   D G   F  + + + TID GNP+ N
Sbjct: 190 FTVTGVQGHSAYPHRAKNPLNAMVRLMDRLASHELDQGTEHFDASTLAVVTIDTGNPATN 249

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS-PVFLTHD 308
           VIPAQ + + NIRFND      L + +R+   +  ++       +     VS   F+T  
Sbjct: 250 VIPAQTRSTVNIRFNDAHTGAELSDWLRAEAARAAKD---FGVDIAVEIKVSGESFITPP 306

Query: 309 RKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQD 368
             L+ L+S ++   TG  P LST+GGTSDARF+K++CPV+E GLVG+TMH ++E   +  
Sbjct: 307 GPLSDLVSAAVETETGRKPQLSTTGGTSDARFVKNHCPVVEVGLVGKTMHQVDERVEIAQ 366

Query: 369 LEDLTCIYENFLQNWF 384
           +  L  IY   L+++F
Sbjct: 367 IHQLKSIYGRILRDYF 382


>gi|99082836|ref|YP_614990.1| succinyl-diaminopimelate desuccinylase [Ruegeria sp. TM1040]
 gi|123378559|sp|Q1GC88|DAPE1_SILST RecName: Full=Succinyl-diaminopimelate desuccinylase 1; Short=SDAP
           desuccinylase 1; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase 1
 gi|99039116|gb|ABF65728.1| succinyldiaminopimelate desuccinylase [Ruegeria sp. TM1040]
          Length = 381

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 166/386 (43%), Positives = 230/386 (59%), Gaps = 11/386 (2%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           T D ++    L++CPSVTP +GGA  +L   L   GFS    D        V NL+AR+G
Sbjct: 3   TTDPVQLTADLVRCPSVTPTEGGALVLLERLLTDAGFSCTRVD-----RGEVCNLFARWG 57

Query: 62  TEAPHLMFA--GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            +A    F   GH DVVP GD   WT+ PF A I EG +YGRG  DMK  +A F AA   
Sbjct: 58  DKAHARTFGFNGHTDVVPIGDEAAWTHDPFGAEIVEGVMYGRGTTDMKSGVAAFAAAAID 117

Query: 120 FIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           F+      G++ L ITGDEEG A++GT  +L +++  GEK   C+VGEPTC + +G+ IK
Sbjct: 118 FVQDTPPDGAVVLTITGDEEGDAVDGTTALLDYMDAAGEKMSVCLVGEPTCPNHMGEMIK 177

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGS++   T+ G QGH AYPH   NP+ GL  L+ +L +   D G+  F  + + I 
Sbjct: 178 IGRRGSMTAWFTVTGVQGHSAYPHRANNPMNGLARLMDRLGSHQLDEGSEHFDASTLAIV 237

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVP-KLSHTVHFSS 298
           TID GNP+ NVIPAQ + + NIRFNDL +  +L + ++    K  +    ++   V  S 
Sbjct: 238 TIDTGNPATNVIPAQGRAAVNIRFNDLHSGASLTDWLQGEADKVAKEFGLEVDMKVQIS- 296

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
                F+T    L+ L+S+++   T   P LST+GGTSDARF+K +CPV+EFGLVG+TMH
Sbjct: 297 --GESFITPPGDLSDLVSRAVQTETNQAPELSTTGGTSDARFVKSHCPVVEFGLVGKTMH 354

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++EN  +  +  L  IY   L+++F
Sbjct: 355 QVDENVDVAHIHQLKSIYSRILKDYF 380


>gi|332186248|ref|ZP_08387993.1| succinyl-diaminopimelate desuccinylase [Sphingomonas sp. S17]
 gi|332013616|gb|EGI55676.1| succinyl-diaminopimelate desuccinylase [Sphingomonas sp. S17]
          Length = 371

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 164/379 (43%), Positives = 226/379 (59%), Gaps = 13/379 (3%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D L     LI+  SVTP  GG F +L   L  LGF+I+           V+NL A     
Sbjct: 3   DALSLAQALIRADSVTPAHGGVFDVLEAALTPLGFTIDRFVVGEAPDGPVENLLATRAGR 62

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
             HL FAGH+DVVP G+   W   PFS  + +G ++GRG VDMKG++A F+AA    IP 
Sbjct: 63  GTHLAFAGHVDVVPAGE--GWQGSPFSGEVRDGLLFGRGAVDMKGAVAAFVAA----IPA 116

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
                 +SL+ITGDEEGPAI GT+ ++  I ++G   D C+VGEPT  H +GD +KIGRR
Sbjct: 117 EPGI-PLSLIITGDEEGPAIYGTRALIDRIAERGVAPDLCLVGEPTSAHRLGDMMKIGRR 175

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++  IT+ G+QGHVAYPHL +NPI  LI +L ++  +  DTGN  F P+N+EIT + V
Sbjct: 176 GSVNIWITVPGRQGHVAYPHLADNPITPLIAILAEIEGVTLDTGNAWFQPSNIEITDLHV 235

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GNP+ NVIP   +   +IRFND      L E I +R+ +      +++  V   +     
Sbjct: 236 GNPAHNVIPGSAQARLSIRFNDEQRGDALIERI-TRIAQAHAPAAQVTGRVSGEA----- 289

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           FLT     +++++ +I   TG  P LST+GGTSDARF+   CP +EFGL+  TMH ++E 
Sbjct: 290 FLTQPGAFSAMIADAIRAETGIAPELSTTGGTSDARFLSKLCPTVEFGLLNATMHKVDEA 349

Query: 364 ASLQDLEDLTCIYENFLQN 382
            +++DL  LT IY   +  
Sbjct: 350 VAVEDLYALTRIYAGIIAR 368


>gi|260574126|ref|ZP_05842131.1| succinyl-diaminopimelate desuccinylase [Rhodobacter sp. SW2]
 gi|259023592|gb|EEW26883.1| succinyl-diaminopimelate desuccinylase [Rhodobacter sp. SW2]
          Length = 381

 Score =  306 bits (785), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 160/375 (42%), Positives = 225/375 (60%), Gaps = 9/375 (2%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA- 70
           LI+CPSVTP +GGA  +L   L+  GF     D    +   + NLYAR+G +  +  F  
Sbjct: 13  LIRCPSVTPAEGGALGVLQAVLQGAGF-----DCTRVDRGGIANLYARWGRKGANKAFGF 67

Query: 71  -GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGS 129
            GH DVVP GD   WT  PF A + +G +YGRG  DMK  +A F+AA   F+      G+
Sbjct: 68  NGHTDVVPVGDAAAWTQDPFGAAVVDGWMYGRGATDMKSGVAAFVAAAVDFVTDTPPDGA 127

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           + L ITGDEEG +++GT+ +L W+   GE    C+VGEPTC  ++G+ +KIGRRGSL+  
Sbjct: 128 VILAITGDEEGESVDGTRALLDWMAANGEAMSHCLVGEPTCPEVMGEMMKIGRRGSLTAY 187

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
            T  G QGH AYPH  +NP+  ++ L+ QL     D G   F  + + ITTID GNP+ N
Sbjct: 188 FTARGVQGHSAYPHRAKNPVTAMVALMAQLEAQPLDAGTAHFDASTLAITTIDTGNPATN 247

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIPA  + + NIRFND  +  +L + +R+     +Q    +   V  S      FLT   
Sbjct: 248 VIPAVCRGTVNIRFNDAHSGASLSDWLRAE-AAAVQAQTGVEIAVAVSIS-GESFLTPPG 305

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDL 369
           + ++L++ S+   TG +P+ STSGGTSDARF+KD+CPV+EFGLVG+TMH ++E   +  +
Sbjct: 306 EFSALVAASVQAETGRLPVASTSGGTSDARFVKDHCPVVEFGLVGKTMHQVDERVEVAQI 365

Query: 370 EDLTCIYENFLQNWF 384
             L  IY   L+++F
Sbjct: 366 LALKAIYGRILRDYF 380


>gi|114762093|ref|ZP_01441561.1| succinyl-diaminopimelate desuccinylase [Pelagibaca bermudensis
           HTCC2601]
 gi|114545117|gb|EAU48120.1| succinyl-diaminopimelate desuccinylase [Roseovarius sp. HTCC2601]
          Length = 381

 Score =  306 bits (784), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 168/387 (43%), Positives = 226/387 (58%), Gaps = 11/387 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT D +     LI+CPSVTP +GGA  +L   L+  GF+    D   +N +   NLYAR+
Sbjct: 1   MTTDPVALTADLIRCPSVTPDEGGALVLLQGLLEEAGFACTRVD---RNGT--SNLYARW 55

Query: 61  GTE--APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
           G +  A    F GH DVVP GD   W+  PF A I +G ++GRG  DMK  +A F AA  
Sbjct: 56  GEKGHARSFGFNGHTDVVPVGDAAAWSCDPFGAEIRDGVMFGRGATDMKSGVAAFAAAAM 115

Query: 119 RFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
            F+      G+I L ITGDEEG A +GT  +L W+ ++ E+   C+VGEPTC   +GD +
Sbjct: 116 DFVTDTPPDGAIVLAITGDEEGDATDGTVALLDWMAEQDERMSVCLVGEPTCPSEMGDMM 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGSLS   T+ G QGH AYPH   NP+  +  L+ +L +   DTG   F  + + +
Sbjct: 176 KIGRRGSLSAWFTVTGTQGHAAYPHRALNPMPAMARLMDRLASHELDTGTDHFDASTLAV 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
            TID GNP+ NVIPAQ + + NIRFND+     L + +R    K          T     
Sbjct: 236 VTIDTGNPATNVIPAQSRGTVNIRFNDIHTGAALSDWLREEAAK---VDAAFGTTTEVKI 292

Query: 299 PVS-PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTM 357
            +S   FLT    L+ L++ ++   TG  P LSTSGGTSDARF+KD+CPV+EFGLVG+TM
Sbjct: 293 KISGESFLTPPGPLSDLVAAAVEAETGRTPELSTSGGTSDARFVKDHCPVVEFGLVGKTM 352

Query: 358 HALNENASLQDLEDLTCIYENFLQNWF 384
           H ++EN  +  +  L  IY   L+++F
Sbjct: 353 HQVDENVPVDQIARLKEIYTRILRDYF 379


>gi|148260531|ref|YP_001234658.1| succinyl-diaminopimelate desuccinylase [Acidiphilium cryptum JF-5]
 gi|326403724|ref|YP_004283806.1| succinyl-diaminopimelate desuccinylase [Acidiphilium multivorum
           AIU301]
 gi|238055192|sp|A5FYQ7|DAPE_ACICJ RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|146402212|gb|ABQ30739.1| succinyldiaminopimelate desuccinylase [Acidiphilium cryptum JF-5]
 gi|325050586|dbj|BAJ80924.1| succinyl-diaminopimelate desuccinylase [Acidiphilium multivorum
           AIU301]
          Length = 371

 Score =  306 bits (784), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 172/374 (45%), Positives = 226/374 (60%), Gaps = 15/374 (4%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            L++  SVTP+D GA  +L   L  LGFSIE   F       V NL AR G+ +PH  FA
Sbjct: 12  DLLRSRSVTPEDDGAQTVLARALDALGFSIEWLRFGE-----VSNLVARRGSGSPHFGFA 66

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSI 130
           GH DVVPPG+   W + PF+A I +G ++GRG VDMKG+IA F+AA+A     +   G+I
Sbjct: 67  GHTDVVPPGE--GWRHDPFAAVIEDGLLFGRGAVDMKGAIAAFVAALAARPANHA--GTI 122

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           SLLITGDEEG A++GT+++L  +   G   + C+VGEPTC   +GDTIKIGRRGS+S  +
Sbjct: 123 SLLITGDEEGDAVDGTRRILDHLAASGALPEFCLVGEPTCRARLGDTIKIGRRGSISAHV 182

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
           T+ G QGHVAYPHL +NP+  LIP L  L     D G   F P++++IT++D GN + NV
Sbjct: 183 TVRGVQGHVAYPHLADNPLHRLIPALEALRATTLDEGTAWFEPSSLQITSVDTGNKAGNV 242

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IPA      NIRFND      L   IR  + +   + P  +  +  S      FLT    
Sbjct: 243 IPASASARLNIRFNDRHTGPDLAAWIRDTVAR---HAPGAACDIGIS---GEAFLTEPGP 296

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDLE 370
           +T+L S+++   TG  P L T GGTSDARFI  +CPV EFGLVG +MH ++E   + +L 
Sbjct: 297 VTTLFSEAVAAVTGITPKLDTGGGTSDARFIAAHCPVAEFGLVGTSMHRVDEAVPVSELR 356

Query: 371 DLTCIYENFLQNWF 384
            L  IY   L   F
Sbjct: 357 ALAEIYGRILDRVF 370


>gi|126732709|ref|ZP_01748505.1| succinyl-diaminopimelate desuccinylase [Sagittula stellata E-37]
 gi|126706839|gb|EBA05909.1| succinyl-diaminopimelate desuccinylase [Sagittula stellata E-37]
          Length = 379

 Score =  306 bits (783), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 162/384 (42%), Positives = 227/384 (59%), Gaps = 11/384 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D ++   +L++CPSVTP++GGA  +L + L   GF     D        + NL+AR+G +
Sbjct: 3   DPVDLTARLVRCPSVTPEEGGALVLLQDMLSDAGFECTRVD-----RGGISNLFARWGAK 57

Query: 64  --APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
             A    F GH DVVP G    W + PF A I  G +YGRG  DMK  +A F AA   F+
Sbjct: 58  GAAKTFGFNGHTDVVPIGRREDWQHDPFGAEIDGGMMYGRGTTDMKSGVAAFAAAAMDFV 117

Query: 122 PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
                 G++ L ITGDEEG +++GT  +L W+E +GEK   C+VGEPTC   +G  IKIG
Sbjct: 118 TATPPDGAVVLAITGDEEGDSVDGTTALLDWMEAEGEKMSVCLVGEPTCPDHMGQMIKIG 177

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGS+S   T+ GKQGH AYPH   NP+  +  L+ +L +   D+G   F P+ + + TI
Sbjct: 178 RRGSMSAWFTVEGKQGHSAYPHRALNPLPAMARLMDRLASHELDSGTDHFDPSTLAVVTI 237

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
           D GNP+ NVIPA+     NIRFND  +  +L E +R+   +  +       T      +S
Sbjct: 238 DTGNPATNVIPAKCSACVNIRFNDAHSGASLSEWLRA---QAAEVDAAFGTTTDLKIKIS 294

Query: 302 -PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL 360
              FLT    L+ L++ ++   TG  P  ST+GGTSDARF+K++CPV+EFGLVG+TMHA+
Sbjct: 295 GESFLTPPGYLSDLVANAVEAETGVKPEYSTTGGTSDARFVKNHCPVVEFGLVGQTMHAV 354

Query: 361 NENASLQDLEDLTCIYENFLQNWF 384
           +E  S++ +  L  IY   LQ++F
Sbjct: 355 DERVSVEQIGQLKAIYTRILQDYF 378


>gi|57238825|ref|YP_179961.1| succinyl-diaminopimelate desuccinylase [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58578755|ref|YP_196967.1| succinyl-diaminopimelate desuccinylase [Ehrlichia ruminantium str.
           Welgevonden]
 gi|81353073|sp|Q5HC82|DAPE_EHRRW RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|57160904|emb|CAH57809.1| putative succinyl-diaminopimelate desuccinylase [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58417381|emb|CAI26585.1| Succinyl-diaminopimelate desuccinylase [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 383

 Score =  305 bits (781), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 168/380 (44%), Positives = 224/380 (58%), Gaps = 18/380 (4%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE-APHLMF 69
           +LI  PS+TP D GA   L + L   GF+    DF   +T  V+NLYA  GTE  P+L F
Sbjct: 11  ELISFPSITPTDNGAISFLSDILSQYGFTCHILDFG-DDTVTVRNLYAYRGTEEGPNLCF 69

Query: 70  AGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-- 127
           AGH DVV  GD   W + PFS  I +  +YGRG VDMK +I  FIAAV+R      NF  
Sbjct: 70  AGHTDVVKTGDLTKWKFDPFSGHIEDDILYGRGAVDMKSAICAFIAAVSRI-----NFNE 124

Query: 128 --GSISLLITGDEEGPAIN-GTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
             GSIS LI+GDEEG     GT  +L W+ +   K D CI+GEPT    +GDTIK+GRRG
Sbjct: 125 VPGSISFLISGDEEGDHFQYGTPSVLKWLNENNHKIDYCIIGEPTSKSFLGDTIKVGRRG 184

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           S+  +I  +G QGHVAYPH  ENPI  ++ +L+++ N  FDTGN  F P+N EI ++D G
Sbjct: 185 SVHFKIICNGIQGHVAYPHFAENPIDNMVSILYKICNTTFDTGNEYFQPSNCEIVSVDTG 244

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
           N SKNVIP  +    NIR+N++   ++L + I +      Q  PK        S     F
Sbjct: 245 NTSKNVIPDTIVAHINIRYNNIHTAESLFDIINNIC---AQVTPKYQ---LLQSVSGEPF 298

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENA 364
                + + +LS +I   TG   + STSGG SD+RFIK+ CPVIEFGL   T H ++E+ 
Sbjct: 299 FNQPNQYSDMLSSAIKKVTGQDAIASTSGGVSDSRFIKNVCPVIEFGLKNETAHKIDEHV 358

Query: 365 SLQDLEDLTCIYENFLQNWF 384
            ++++  L  IY  F++ +F
Sbjct: 359 PVKEIYQLADIYTEFIKQFF 378


>gi|319639253|ref|ZP_07994004.1| succinyl-diaminopimelate desuccinylase [Neisseria mucosa C102]
 gi|317399437|gb|EFV80107.1| succinyl-diaminopimelate desuccinylase [Neisseria mucosa C102]
          Length = 377

 Score =  305 bits (781), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 169/380 (44%), Positives = 229/380 (60%), Gaps = 15/380 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE    LI  PSVTP D     +L   L+ +GF++EE  F        KN++ R GT+AP
Sbjct: 7   LELAKALISRPSVTPDDQNCQQLLAERLQKIGFAVEELHF-----GDTKNVWLRRGTQAP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
              FAGH DVVP G    W  PPF  T  EG++YGRG  DMK SIACF+ A  RF+ ++ 
Sbjct: 62  VFCFAGHTDVVPTGPVEKWDSPPFEPTEREGRLYGRGAADMKTSIACFVTACERFVAEHP 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GD +K GRRG
Sbjct: 122 DHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVDKLGDMLKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 182 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E+ LK+ + + L K G+Q      + + +S    P 
Sbjct: 242 TGATNVIPGELNVKFNFRFSTESTEEGLKQRVHTILDKHGVQ------YDLQWSCSGQP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLTH  KLT +  ++I    G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 295 FLTHAGKLTDVAREAIAEICGVEAELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINE 354

Query: 363 NASLQDLEDLTCIYENFLQN 382
           N  L+D+  L+ +YE  L+ 
Sbjct: 355 NVRLEDIPKLSAVYEGMLKR 374


>gi|58616814|ref|YP_196013.1| succinyl-diaminopimelate desuccinylase [Ehrlichia ruminantium str.
           Gardel]
 gi|75356582|sp|Q5FFA0|DAPE_EHRRG RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|58416426|emb|CAI27539.1| Succinyl-diaminopimelate desuccinylase [Ehrlichia ruminantium str.
           Gardel]
          Length = 383

 Score =  305 bits (781), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 166/380 (43%), Positives = 227/380 (59%), Gaps = 18/380 (4%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE-APHLMF 69
           +LI  PS+TP D GA   L + L   GF+    DF   +T  V+NLYA  GTE  P+L F
Sbjct: 11  ELISFPSITPTDNGAISFLSDILSQYGFTCHILDFG-DDTVTVRNLYAYRGTEEGPNLCF 69

Query: 70  AGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-- 127
           AGH DVV  GD   W + PFS  I +  +YGRG VDMK +I  FIAAV+R      NF  
Sbjct: 70  AGHTDVVKTGDLTKWKFDPFSGHIEDDILYGRGAVDMKSAICAFIAAVSRI-----NFNE 124

Query: 128 --GSISLLITGDEEGPAIN-GTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
             GSIS LI+GDEEG     GT  +L W+ +   K D CI+GEPT    +GDTIK+GRRG
Sbjct: 125 VPGSISFLISGDEEGDHFQYGTPSVLKWLNENNHKIDYCIIGEPTSKSFLGDTIKVGRRG 184

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           S+  +I  +G QGHVAYPH  ENPI  ++ +L+++ N  FDTGN  F P+N EI ++D G
Sbjct: 185 SVHFKIICNGIQGHVAYPHFAENPIDNMVSILYKICNTTFDTGNEYFQPSNCEIVSVDTG 244

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
           N S+NVIP  +    NIR+N++   ++L  +I + +   +    +L H+V         F
Sbjct: 245 NTSRNVIPDTIVAHINIRYNNIHTAESLF-DIINNICAQVTPKYQLLHSVS-----GEPF 298

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENA 364
                + + +LS +I   TG   + STSGG SD+RFIK+ CPVIEFGL   T H ++E+ 
Sbjct: 299 FNQPNQYSDMLSSAIKKVTGQDAIASTSGGVSDSRFIKNVCPVIEFGLKNETAHKIDEHV 358

Query: 365 SLQDLEDLTCIYENFLQNWF 384
            ++++  L  IY  F++ +F
Sbjct: 359 PVKEIYQLADIYTEFIKQFF 378


>gi|90409194|ref|ZP_01217307.1| succinyl-diaminopimelate desuccinylase [Psychromonas sp. CNPT3]
 gi|90309700|gb|EAS37872.1| succinyl-diaminopimelate desuccinylase [Psychromonas sp. CNPT3]
          Length = 377

 Score =  305 bits (780), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 164/375 (43%), Positives = 236/375 (62%), Gaps = 13/375 (3%)

Query: 9   LIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLM 68
           L  L+  PSVTP D G   +L+  L+ LGF+ E   F+        NL+AR GT++P   
Sbjct: 10  LKNLVNRPSVTPNDAGCQTLLIERLEKLGFTCEVMHFED-----TLNLWARRGTQSPLFC 64

Query: 69  FAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF- 127
           FAGH DVVP G  + W +PPF AT ++GK+YGRG  DMKG IA F+ AV +FI ++++  
Sbjct: 65  FAGHTDVVPTGPEHLWKFPPFQATESDGKLYGRGTADMKGGIAAFMIAVEQFIAQHQDHQ 124

Query: 128 GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLS 187
           GSI++LIT DEEGP INGT +++  +EK+ EK D CIVGEP+    +GD IK GRRGSL+
Sbjct: 125 GSIAMLITSDEEGPFINGTTRVIDCLEKRNEKIDYCIVGEPSSTEQVGDVIKNGRRGSLT 184

Query: 188 GEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPS 247
            +I I GKQGHVAYPHL +NPI   +    +L+N  +D GN  F PT+ +IT  + G  +
Sbjct: 185 ADIRIIGKQGHVAYPHLVKNPIHSCLSAFAELSNEMWDNGNAYFPPTSFQITQFNAGTGA 244

Query: 248 KNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTH 307
            N++P   ++  N R++   N     E+I +RL + I +  +L++ ++++   SP F+T 
Sbjct: 245 SNMVPGDAQLQCNFRYSTQLN----SEQISARL-EAILDKHQLNYEINWTYNGSP-FITT 298

Query: 308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASL 366
              LT  +S +I+   G    LSTSGGTSDARFI      V+E G+   ++H ++EN ++
Sbjct: 299 PGYLTDAVSDAIFEINGLKTELSTSGGTSDARFIAPTGAQVVELGVCNGSIHQIDENVNI 358

Query: 367 QDLEDLTCIYENFLQ 381
            D+E LT IY+  L+
Sbjct: 359 NDVEQLTLIYQRILE 373


>gi|294668464|ref|ZP_06733564.1| hypothetical protein NEIELOOT_00379 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291309617|gb|EFE50860.1| hypothetical protein NEIELOOT_00379 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 378

 Score =  303 bits (777), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 165/377 (43%), Positives = 224/377 (59%), Gaps = 13/377 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           QLI   SVTP D G   +L   L+ +GF++E+ DF        KN++AR G+ AP L FA
Sbjct: 13  QLIARASVTPDDQGCQELLAERLQKIGFTVEQLDFGQ-----TKNIWARRGSGAPLLCFA 67

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIP-KYKNFGS 129
           GH DVVP G  + WT PPF  T  +G++YGRG  DMK SIA F+ A  RF+  +  + GS
Sbjct: 68  GHTDVVPSGPEDKWTSPPFEPTERDGRLYGRGAADMKSSIAAFVTACERFVAARPDHAGS 127

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GDT+K GRRGSLSG 
Sbjct: 128 IALLITSDEEGDALDGTTKVVDVLKARGETIDYCIVGEPTAVDTLGDTVKNGRRGSLSGN 187

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +T+ GKQGH+AYPHL ENP+    P L +LT   +D GN  F PT  +I+ I+ G  + N
Sbjct: 188 LTVKGKQGHIAYPHLAENPVHKATPALAELTAAEWDRGNAYFPPTGFQISNINGGTGATN 247

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP ++ + FN RF+   +   LK     R +  I +   L++ + ++    P FLT   
Sbjct: 248 VIPGELNVKFNFRFSTESDSDGLK-----RRVHEILDKHGLNYDLQWTLSGQP-FLTEAG 301

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNENASLQD 368
           +LT     ++    G    LSTSGGTSD RFIK     +IE G V  T+H ++EN  L  
Sbjct: 302 RLTEAAQAAVAEICGVRAELSTSGGTSDGRFIKAIARELIELGPVNATIHQIDENVELSA 361

Query: 369 LEDLTCIYENFLQNWFI 385
           L  L+ +YE  L    +
Sbjct: 362 LPKLSAVYERMLAELLM 378


>gi|261380040|ref|ZP_05984613.1| succinyl-diaminopimelate desuccinylase [Neisseria subflava NJ9703]
 gi|284797248|gb|EFC52595.1| succinyl-diaminopimelate desuccinylase [Neisseria subflava NJ9703]
          Length = 377

 Score =  303 bits (777), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 169/380 (44%), Positives = 228/380 (60%), Gaps = 15/380 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE   +LI  PSVTP D     +L   L+ +GF++EE  F        KN++ R GT+AP
Sbjct: 7   LELAKELISRPSVTPDDQNCQQLLAERLQKIGFAVEELHF-----GDTKNIWLRRGTQAP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
              FAGH DVVP G    W  PPF  T  E ++YGRG  DMK SIACF+ A  RF+ +Y 
Sbjct: 62  VFCFAGHTDVVPTGPVEKWDSPPFEPTEREDRLYGRGAADMKTSIACFVTACERFVAEYP 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GD +K GRRG
Sbjct: 122 DHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVDKLGDMLKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +TI GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 182 SLSGNLTIKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E+ LK+ + + L K G+Q      + + +S    P 
Sbjct: 242 TGATNVIPGELNVKFNFRFSTESTEEGLKQRVHTILDKHGVQ------YDLQWSCSGQP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLT   KLT +  ++I    G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 295 FLTQAGKLTDVAREAIAEICGVEAELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINE 354

Query: 363 NASLQDLEDLTCIYENFLQN 382
           N  L+D+  L+ +YE  L+ 
Sbjct: 355 NVRLEDIPKLSAVYEGMLKR 374


>gi|163733186|ref|ZP_02140630.1| succinyl-diaminopimelate desuccinylase [Roseobacter litoralis Och
           149]
 gi|161393721|gb|EDQ18046.1| succinyl-diaminopimelate desuccinylase [Roseobacter litoralis Och
           149]
          Length = 381

 Score =  303 bits (777), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 163/381 (42%), Positives = 232/381 (60%), Gaps = 19/381 (4%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA--PHLM 68
            L++C SVTP D GA  IL + L   GF     D    +   ++NL+AR+G++       
Sbjct: 12  DLVRCASVTPADEGALDILHDVLSDAGF-----DCAWADRGGIRNLFARWGSKGHPKTFG 66

Query: 69  FAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFG 128
           F GH DVVP G+ + W+ PPF A + +G +YGRG  DMK  +A F AA   F+      G
Sbjct: 67  FNGHTDVVPIGNADDWSMPPFGAEVKDGIMYGRGTTDMKSGVAAFAAAALDFVRDTPPDG 126

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           +I L ITGDEEG AI+GT  +L+++  + E+  AC+VGEPTC   +G+ IKIGRRGS++ 
Sbjct: 127 AIVLAITGDEEGDAIDGTTALLAYMAAQDEQMSACLVGEPTCPDRMGEMIKIGRRGSMTA 186

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
            IT+ GKQGH AYPH   NP+  L+ L+ +L +   D G   F P+ + I T+D GNP+ 
Sbjct: 187 WITVTGKQGHAAYPHRACNPLPALMRLMDRLASHKLDEGTEFFDPSTLAIVTVDTGNPAT 246

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-----GIQNVPKLSHTVHFSSPVSPV 303
           NVIPA    + NIRFND  +  +L E I++ L K     G+Q   ++  +          
Sbjct: 247 NVIPASCSGTVNIRFNDAHSGASLTEWIKTELSKIEAEFGVQTGLRIKIS-------GES 299

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           FLT    L++L+SK++   TG  P+LST+GGTSDARF+KD+CPV+EFGLVG++MH ++E+
Sbjct: 300 FLTPPGPLSALVSKAVKAQTGIEPVLSTTGGTSDARFVKDHCPVVEFGLVGQSMHQVDEH 359

Query: 364 ASLQDLEDLTCIYENFLQNWF 384
                + +L  IY   L ++F
Sbjct: 360 VKTDHIVELKAIYSRILTDYF 380


>gi|260429516|ref|ZP_05783493.1| succinyl-diaminopimelate desuccinylase [Citreicella sp. SE45]
 gi|260420139|gb|EEX13392.1| succinyl-diaminopimelate desuccinylase [Citreicella sp. SE45]
          Length = 380

 Score =  303 bits (776), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 164/379 (43%), Positives = 229/379 (60%), Gaps = 11/379 (2%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE--APHLM 68
            LI+CPSVTP+DGGA  +L + L+  GF+    D        + NLYAR+G +  A    
Sbjct: 10  DLIRCPSVTPEDGGALCVLQSLLEGAGFACTRVD-----RGGISNLYARWGDKGHARTFG 64

Query: 69  FAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFG 128
           F GH DVVP GD + W+  PF A I +G ++GRG  DMK  +A F AA   F+      G
Sbjct: 65  FNGHTDVVPVGDVDAWSADPFGAEIRDGIMFGRGATDMKSGVAAFAAAAVDFVRDTPPEG 124

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           ++ L ITGDEEG A +GT  +L W+  +GE+   C+VGEPTC   +G+ +KIGRRGS++ 
Sbjct: 125 AVVLAITGDEEGDAEHGTVALLDWMAAEGERMSVCLVGEPTCPSEMGEMMKIGRRGSMTA 184

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
             T+ G+QGH AYPH   NP+  +  L+ +L +   D G   F  T + + TID GNP+ 
Sbjct: 185 WFTVTGRQGHAAYPHRALNPMPAVARLMDRLASHELDRGTEHFDATTLAVVTIDTGNPAT 244

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS-PVFLTH 307
           NVIPAQ + + NIRFND     +L E +R+   K I +  +   T      +S   FLT 
Sbjct: 245 NVIPAQTRAAVNIRFNDAHTGASLSEWLRAEAAK-IDS--EFGCTTEVRIKISGESFLTP 301

Query: 308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQ 367
              L+ L++ ++   TG  P LST+GGTSDARF+KD+CPV+EFGLVG+TMH ++EN  + 
Sbjct: 302 PGALSDLIAGAVEAETGRRPELSTTGGTSDARFVKDHCPVVEFGLVGKTMHQVDENVPVA 361

Query: 368 DLEDLTCIYENFLQNWFIT 386
            + +L  IY   L+++F T
Sbjct: 362 QIGELKAIYTRILRDYFAT 380


>gi|294788228|ref|ZP_06753471.1| succinyl-diaminopimelate desuccinylase [Simonsiella muelleri ATCC
           29453]
 gi|294483659|gb|EFG31343.1| succinyl-diaminopimelate desuccinylase [Simonsiella muelleri ATCC
           29453]
          Length = 376

 Score =  303 bits (775), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 171/372 (45%), Positives = 227/372 (61%), Gaps = 13/372 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           QL+   S+TP D     IL   L+ +GF IEE  F        KN YA+ G  AP L FA
Sbjct: 11  QLLTEQSITPDDKNCQKILAARLRAIGFEIEEMHFGN-----TKNFYAKRGNNAPLLCFA 65

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVP GD N WT+ PF+ T   GK+Y RG  DMK +IACF+ A  RFI    +F GS
Sbjct: 66  GHTDVVPTGDVNQWTFDPFTPTEHNGKLYARGAADMKTAIACFVTACERFIAANPHFSGS 125

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           ++LLIT DEEG A +GT K++  ++++GE+ D CIVGEPT  + +GDT+K GRRGSLSG 
Sbjct: 126 LALLITSDEEGDAHDGTTKVVEQLKQRGEQIDYCIVGEPTAVNQLGDTLKNGRRGSLSGN 185

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +T+HGKQGH+AYPHL +NPI    P L +L    +DTGN  F  T+ +I+ I+ G  + N
Sbjct: 186 LTVHGKQGHIAYPHLAKNPIHAAAPALAELAATEWDTGNPYFPATSFQISNINGGTGATN 245

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIPA V + FN RF+    E +LK  +   L K       L + + +S   +P FLT   
Sbjct: 246 VIPAVVNVKFNFRFSTEQTESSLKTRVHEILDK-----HGLQYDLDWSLSGNP-FLTEAG 299

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNENASLQD 368
           +LT +  ++I    G    LST+GGTSD RFIK     +IE G V  T+H ++E+  L D
Sbjct: 300 QLTEVAQRAIGEICGIQAELSTTGGTSDGRFIKAIANELIELGFVNATIHQIDEHIELAD 359

Query: 369 LEDLTCIYENFL 380
           ++ L+ IYEN L
Sbjct: 360 IDKLSAIYENML 371


>gi|225025197|ref|ZP_03714389.1| hypothetical protein EIKCOROL_02092 [Eikenella corrodens ATCC
           23834]
 gi|224941955|gb|EEG23164.1| hypothetical protein EIKCOROL_02092 [Eikenella corrodens ATCC
           23834]
          Length = 378

 Score =  303 bits (775), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 168/377 (44%), Positives = 222/377 (58%), Gaps = 13/377 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           QLI   SVTP D G   I+   L+ +GF+IE   F        +NL+AR G   P + FA
Sbjct: 12  QLIAQASVTPDDHGCQEIIAERLRAIGFAIEPMPF-----GRTQNLWARHGNSTPLVCFA 66

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVPPG    WT PPF  T   GK+YGRG  DMK SIACFI A   FI ++  F GS
Sbjct: 67  GHTDVVPPGPAEAWTSPPFQPTERNGKLYGRGTADMKTSIACFITACECFIAQHPQFSGS 126

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           ++LLIT DEEG   +GT +++  + ++GE  D CIVGEPT  H +GDTIK GRRGSLSG 
Sbjct: 127 LALLITSDEEGDGKDGTVRVIETLRQRGEYIDYCIVGEPTAEHTLGDTIKNGRRGSLSGS 186

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +TIHGKQGH+AYPHL  NPI    P L +LT   +D GN  F PT  +I+ I  G  + N
Sbjct: 187 LTIHGKQGHIAYPHLAANPIHLAAPALAELTAEHWDNGNAYFPPTGFQISNIHAGTGATN 246

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP ++ + FN RF+   + ++L+     R +K I +   L +++ +     P F+T   
Sbjct: 247 VIPGELSVQFNFRFSTETDAESLQ-----RRVKAILDKHHLHYSLQWQLSGQP-FITEAG 300

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNENASLQD 368
           +LT     +I    G   +LSTSGGTSD RFIK     +IE G V  ++H ++E+  L  
Sbjct: 301 RLTQAAQAAIAEECGIQAVLSTSGGTSDGRFIKAIANELIELGPVNESIHQIDEHIELAA 360

Query: 369 LEDLTCIYENFLQNWFI 385
           +  L+ IYEN L    +
Sbjct: 361 IPRLSAIYENILHRLLL 377


>gi|126733865|ref|ZP_01749612.1| succinyl-diaminopimelate desuccinylase [Roseobacter sp. CCS2]
 gi|126716731|gb|EBA13595.1| succinyl-diaminopimelate desuccinylase [Roseobacter sp. CCS2]
          Length = 380

 Score =  303 bits (775), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 158/377 (41%), Positives = 224/377 (59%), Gaps = 11/377 (2%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           +L++CPS+TP +GGA  +L + L   GF+    D        V NLYAR+G +  +  F 
Sbjct: 11  ELVRCPSITPHEGGALVLLEDVLTKGGFTCTRVD-----RGDVSNLYARWGRQGANRTFG 65

Query: 71  --GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFG 128
             GH DVVP GD   WT PPF A I +G +YGRG  DMK  +A F AA   F+      G
Sbjct: 66  FNGHTDVVPLGDEAAWTMPPFEAEIKDGYLYGRGATDMKSGVAAFAAAAIDFVQNTPPDG 125

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           ++ L ITGDEEG A++GT  +L W+    E    C+VGEPTC  ++G+ +KIGRRGS++ 
Sbjct: 126 AVVLAITGDEEGDAVDGTTALLDWMATNNEAMSVCLVGEPTCPDVMGEAMKIGRRGSMTA 185

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
             T+ G QGH AYPH  +NP+  +  L+  L++   D G T F P+++++ TID GNP+ 
Sbjct: 186 FFTMTGVQGHAAYPHRAKNPMPAMARLMDVLSSRVLDEGTTHFDPSSLQVLTIDTGNPAT 245

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS-PVFLTH 307
           NVIP+  K + NIRFND  +   L   ++    K           V     VS   F+T 
Sbjct: 246 NVIPSHTKATVNIRFNDTHSSADLTTWMQEEADK---VAAAFDIQVDMRVRVSGESFVTP 302

Query: 308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQ 367
              L+ L+ K++ + TG  P LST+GGTSDARF+K +CPV+EFGLVG+TMH ++E  +++
Sbjct: 303 PGDLSDLVGKAVESETGVKPELSTTGGTSDARFVKHHCPVVEFGLVGKTMHQVDERVAVE 362

Query: 368 DLEDLTCIYENFLQNWF 384
            +  L  IY   L+++F
Sbjct: 363 QIGQLKAIYTRILRDYF 379


>gi|114769615|ref|ZP_01447225.1| succinyl-diaminopimelate desuccinylase [alpha proteobacterium
           HTCC2255]
 gi|114549320|gb|EAU52202.1| succinyl-diaminopimelate desuccinylase [alpha proteobacterium
           HTCC2255]
          Length = 377

 Score =  303 bits (775), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 169/387 (43%), Positives = 228/387 (58%), Gaps = 14/387 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D +     LI+C S+TP++ GA  +L   L   GF     D       +V NL+AR+
Sbjct: 1   MNIDPVNLTADLIRCKSITPKEAGALVLLEALLSKAGFECNRVD-----RGLVSNLFARW 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G+    L F GH DVVP G  N WT  PF A I +G +YGRG  DMK  +A F AA   F
Sbjct: 56  GS-GRTLGFNGHTDVVPVGSINDWTVDPFGAEIKDGFLYGRGSTDMKSGVAAFAAAAIDF 114

Query: 121 IPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
           +      GSI L ITGDEEG A++GT  +L W+ +  E  + CIVGEPTC   IG+ +KI
Sbjct: 115 VQNSPPDGSIVLAITGDEEGQAVDGTVALLDWMNENNEIINHCIVGEPTCPENIGEMMKI 174

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGS++   TI G QGH AYPH   NP+  +  L+  LT+   D G+  F P+ + +TT
Sbjct: 175 GRRGSMTAYFTIRGVQGHSAYPHRANNPLPIMAKLICDLTSFELDQGSKHFDPSTLAVTT 234

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLK---EEIRSRLIKGIQNVPKLSHTVHFS 297
           ID GN + NVIPA+ K + NIRFNDL   K L    +++  R+    +N  +++  +  S
Sbjct: 235 IDTGNLANNVIPAETKATVNIRFNDLHTSKKLSIWLDKVTKRIAS--ENDVEINTEIQVS 292

Query: 298 SPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTM 357
                 F+T     + L+S S++  TG  P  STSGGTSDARFIKD+CPV+EFGLVG+TM
Sbjct: 293 ---GESFITALGDFSDLISNSVHLETGIYPEASTSGGTSDARFIKDHCPVVEFGLVGKTM 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWF 384
           H ++E  S+  +  L  IY N ++N+F
Sbjct: 350 HQIDERVSIDQVYKLKAIYFNIIKNYF 376


>gi|85709440|ref|ZP_01040505.1| succinyl-diaminopimelate desuccinylase [Erythrobacter sp. NAP1]
 gi|85688150|gb|EAQ28154.1| succinyl-diaminopimelate desuccinylase [Erythrobacter sp. NAP1]
          Length = 385

 Score =  303 bits (775), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 171/380 (45%), Positives = 236/380 (62%), Gaps = 21/380 (5%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEE----KDFQTKNTSIVKNLYA- 58
           D L++  +LI  PSVTP  G  F  +   L  LGF++         +  + + V+NL+A 
Sbjct: 3   DALDYAKRLIAEPSVTPATGSVFDAMEQMLAPLGFAVHRFKRGDGEEGSDEAPVENLFAI 62

Query: 59  RFGTE-APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAV 117
           R G E + H  FAGH+DVVPPGD   W   PF  T     +YGRG VDMK SIAC +AAV
Sbjct: 63  RKGPEGSQHFAFAGHLDVVPPGD--GWASDPFEPTERGELLYGRGAVDMKSSIACMVAAV 120

Query: 118 ARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDT 177
           A  +PK  + G+IS +ITGDEEGPA++GT+ ++ ++ ++G K D C+VGEPT    +GD 
Sbjct: 121 AD-VPK--DAGTISFIITGDEEGPALHGTRALIDYMNEQGIKPDLCLVGEPTSVDRLGDM 177

Query: 178 IKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNME 237
           +KIGRRGS++  +T+ G QGHVAYPHL +NP   L+ +L +L  +  DTG   F P+N+E
Sbjct: 178 MKIGRRGSVNIWLTVEGMQGHVAYPHLADNPNPKLVAMLAELDALTLDTGTDWFQPSNLE 237

Query: 238 ITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHF 296
           IT I+VGN + NVIPA  K   +IRFNDL +  +L E + +   K G + +P +S     
Sbjct: 238 ITDIEVGNRAHNVIPATAKARISIRFNDLHSGASLSERVAAIAEKHGGRALPIIS----- 292

Query: 297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRT 356
                  FLT     +++L+++I   TG  P  ST+GGTSDARF++  CPVIEFGL   T
Sbjct: 293 ----GEPFLTEPGAFSNMLAEAIEAETGTRPDQSTTGGTSDARFLRAVCPVIEFGLCNAT 348

Query: 357 MHALNENASLQDLEDLTCIY 376
           MH  +E  ++ DL+ LT IY
Sbjct: 349 MHKRDEAVAIPDLDTLTRIY 368


>gi|291044051|ref|ZP_06569767.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae DGI2]
 gi|293399236|ref|ZP_06643401.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae F62]
 gi|291012514|gb|EFE04503.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae DGI2]
 gi|291610650|gb|EFF39760.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae F62]
          Length = 411

 Score =  302 bits (774), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 171/378 (45%), Positives = 225/378 (59%), Gaps = 15/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE    LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R GT+AP
Sbjct: 37  LELAKALISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGD-----TKNIWLRRGTKAP 91

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK SIACF+ A  RF+ ++ 
Sbjct: 92  VVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTSIACFVTACERFVAEHP 151

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GD IK GRRG
Sbjct: 152 DHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVDKLGDMIKNGRRG 211

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NPI    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 212 SLSGSLTVKGKQGHIAYPHLAVNPIHTFAPALLELTQEIWDEGNEYFPPTSFQISNINGG 271

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 272 TGATNVIPGELNVKFNFRFSTESTETGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 324

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLTH  KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 325 FLTHAGKLTDVARTAIAETCGVEAELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINE 384

Query: 363 NASLQDLEDLTCIYENFL 380
           N  L D+  L+ +YE  L
Sbjct: 385 NVRLDDIPKLSAVYERIL 402


>gi|194098365|ref|YP_002001423.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           NCCP11945]
 gi|193933655|gb|ACF29479.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           NCCP11945]
 gi|317164066|gb|ADV07607.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 411

 Score =  302 bits (773), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 170/378 (44%), Positives = 225/378 (59%), Gaps = 15/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE    LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R GT+AP
Sbjct: 37  LELAKALISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGD-----TKNIWLRRGTKAP 91

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK SIACF+ A  RF+ ++ 
Sbjct: 92  VVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTSIACFVTACERFVAEHP 151

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GD IK GRRG
Sbjct: 152 DHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVDKLGDMIKNGRRG 211

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 212 SLSGNLTVKGKQGHIAYPHLAVNPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 271

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 272 TGATNVIPGELNVKFNFRFSTESTETGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 324

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLTH  KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 325 FLTHAGKLTDVARTAIAETCGVEAELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINE 384

Query: 363 NASLQDLEDLTCIYENFL 380
           N  L D+  L+ +YE  L
Sbjct: 385 NVRLDDIPKLSAVYERIL 402


>gi|89052845|ref|YP_508296.1| succinyl-diaminopimelate desuccinylase [Jannaschia sp. CCS1]
 gi|122499698|sp|Q28VJ1|DAPE_JANSC RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|88862394|gb|ABD53271.1| succinyldiaminopimelate desuccinylase [Jannaschia sp. CCS1]
          Length = 388

 Score =  302 bits (773), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 165/377 (43%), Positives = 223/377 (59%), Gaps = 11/377 (2%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA--PHLM 68
            LI+C SVTP +GGA  +L   L   GF     D    +   + NLYAR+GT        
Sbjct: 18  DLIRCNSVTPLEGGALVLLEALLSDAGF-----DCTRVDRGGIANLYARWGTRGNGKAFG 72

Query: 69  FAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFG 128
           F GH DVVP GD   WT+PPF A +    +YGRG  DMK  +A F AA   F+      G
Sbjct: 73  FNGHTDVVPVGDEAAWTHPPFGAEVDGDWMYGRGATDMKSGVAAFAAAAIDFVRDTPPDG 132

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           +I L ITGDEEG + +GT  +L W+E+ GE+ D CIVGEPTC   +GD +KIGRRG+L+ 
Sbjct: 133 AIVLAITGDEEGESTDGTIALLDWMEEVGERIDVCIVGEPTCPEQMGDMMKIGRRGALTA 192

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
              + GKQGH AY H   NP+  +  L H+L+    D G   F P+   ITTID GNP+ 
Sbjct: 193 FFEVIGKQGHSAYLHKVINPMPAVALLGHRLSTHTLDEGTDHFDPSTCAITTIDTGNPAN 252

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS-PVFLTH 307
           NVIPA+ +M+ N+RFNDL +  +L   +R    +  ++      T+  ++ +S   FLT 
Sbjct: 253 NVIPAKTRMTVNLRFNDLHSGDSLTAWLREEADRVAEDT---GTTIRMTTKLSGESFLTP 309

Query: 308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQ 367
              L+ L+ K++   TG  P LST+GGTSDARF+K++CPV+EFGLVG  MH ++E   + 
Sbjct: 310 PGDLSDLVGKAVQAETGRQPTLSTTGGTSDARFVKNHCPVVEFGLVGHRMHQVDERVRIS 369

Query: 368 DLEDLTCIYENFLQNWF 384
           D+EDL  +Y   L  +F
Sbjct: 370 DIEDLKRVYGRVLTEYF 386


>gi|254487451|ref|ZP_05100656.1| succinyl-diaminopimelate desuccinylase [Roseobacter sp. GAI101]
 gi|214044320|gb|EEB84958.1| succinyl-diaminopimelate desuccinylase [Roseobacter sp. GAI101]
          Length = 368

 Score =  301 bits (772), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 163/379 (43%), Positives = 227/379 (59%), Gaps = 19/379 (5%)

Query: 13  IKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA-- 70
           ++CPSVTP D GA  IL + L   GF     D    +   ++NL+AR+G +     F   
Sbjct: 1   MQCPSVTPADAGALDILHDLLSGAGF-----DCAWADRGGIRNLFARWGNKGNTRCFGFN 55

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSI 130
           GH DVVP G+   W++ PF A I +G +YGRG  DMK  +A F AA   F+      GSI
Sbjct: 56  GHTDVVPIGNEADWSFAPFGAEIKDGVMYGRGTTDMKSGVAAFAAAAVDFVRDTPPDGSI 115

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
            L ITGDEE   I+GT+ +L ++EK GE+ D C+VGEPTC   +GD IKIGRRGSL+   
Sbjct: 116 VLAITGDEEAEGIDGTRALLEYMEKAGERMDVCLVGEPTCPEKMGDMIKIGRRGSLNAHF 175

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
            + GKQGH AYPH   NP+  ++ L+ QL     D G   F P+ + I T+D GNP+ NV
Sbjct: 176 RVIGKQGHAAYPHRANNPLPAMMRLMDQLAGHELDAGTDHFDPSTLAIVTVDTGNPATNV 235

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-----GIQNVPKLSHTVHFSSPVSPVFL 305
           IPA+ + + NIRFND  +  +L + + ++        G+Q    +   V  S      F+
Sbjct: 236 IPAECRATVNIRFNDTHSGASLTDWLEAQTAAIADSFGVQ----IDLNVKIS---GESFI 288

Query: 306 THDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENAS 365
           T    L+ ++SK++   TG  P LSTSGGTSDARF+K++CPV+EFGLVG++MHA++EN  
Sbjct: 289 TPPGALSDMVSKAVAAETGVTPELSTSGGTSDARFVKNHCPVVEFGLVGKSMHAVDENVE 348

Query: 366 LQDLEDLTCIYENFLQNWF 384
           +  +  L  IY   L+++F
Sbjct: 349 VAQIHQLKAIYTRILKDYF 367


>gi|240128003|ref|ZP_04740664.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           SK-93-1035]
 gi|268686393|ref|ZP_06153255.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           SK-93-1035]
 gi|268626677|gb|EEZ59077.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           SK-93-1035]
          Length = 381

 Score =  301 bits (772), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 170/378 (44%), Positives = 225/378 (59%), Gaps = 15/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE    LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R GT+AP
Sbjct: 7   LELAKALISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGD-----TKNIWLRRGTKAP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK SIACF+ A  RF+ ++ 
Sbjct: 62  VVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTSIACFVTACERFVAEHP 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GD IK GRRG
Sbjct: 122 DHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVDKLGDMIKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 182 SLSGSLTVKGKQGHIAYPHLAVNPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 242 TGATNVIPGELNVKFNFRFSTESTETGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLTH  KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 295 FLTHAGKLTDVARTAIAETCGVEAELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINE 354

Query: 363 NASLQDLEDLTCIYENFL 380
           N  L D+  L+ +YE  L
Sbjct: 355 NVRLDDIPKLSAVYERIL 372


>gi|59801375|ref|YP_208087.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae FA
           1090]
 gi|240115450|ref|ZP_04729512.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           PID18]
 gi|240125550|ref|ZP_04738436.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           SK-92-679]
 gi|254493561|ref|ZP_05106732.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae 1291]
 gi|260440738|ref|ZP_05794554.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae DGI2]
 gi|268601127|ref|ZP_06135294.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           PID18]
 gi|268684139|ref|ZP_06151001.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           SK-92-679]
 gi|75432474|sp|Q5F812|DAPE_NEIG1 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|59718270|gb|AAW89675.1| putative succinyl-diaminopimelate desuccinylase [Neisseria
           gonorrhoeae FA 1090]
 gi|226512601|gb|EEH61946.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae 1291]
 gi|268585258|gb|EEZ49934.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           PID18]
 gi|268624423|gb|EEZ56823.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           SK-92-679]
          Length = 381

 Score =  301 bits (772), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 171/378 (45%), Positives = 225/378 (59%), Gaps = 15/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE    LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R GT+AP
Sbjct: 7   LELAKALISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGD-----TKNIWLRRGTKAP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK SIACF+ A  RF+ ++ 
Sbjct: 62  VVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTSIACFVTACERFVAEHP 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GD IK GRRG
Sbjct: 122 DHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVDKLGDMIKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NPI    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 182 SLSGSLTVKGKQGHIAYPHLAVNPIHTFAPALLELTQEIWDEGNEYFPPTSFQISNINGG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 242 TGATNVIPGELNVKFNFRFSTESTETGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLTH  KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 295 FLTHAGKLTDVARTAIAETCGVEAELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINE 354

Query: 363 NASLQDLEDLTCIYENFL 380
           N  L D+  L+ +YE  L
Sbjct: 355 NVRLDDIPKLSAVYERIL 372


>gi|239998775|ref|ZP_04718699.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           35/02]
 gi|240014308|ref|ZP_04721221.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           DGI18]
 gi|240016743|ref|ZP_04723283.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           FA6140]
 gi|240080935|ref|ZP_04725478.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae FA19]
 gi|240112705|ref|ZP_04727195.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae MS11]
 gi|240117746|ref|ZP_04731808.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae PID1]
 gi|240121871|ref|ZP_04734833.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           PID24-1]
 gi|240123301|ref|ZP_04736257.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           PID332]
 gi|268594620|ref|ZP_06128787.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           35/02]
 gi|268597053|ref|ZP_06131220.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae FA19]
 gi|268598768|ref|ZP_06132935.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae MS11]
 gi|268603445|ref|ZP_06137612.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae PID1]
 gi|268681925|ref|ZP_06148787.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           PID332]
 gi|238064824|sp|B4RKY8|DAPE_NEIG2 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|268548009|gb|EEZ43427.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           35/02]
 gi|268550841|gb|EEZ45860.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae FA19]
 gi|268582899|gb|EEZ47575.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae MS11]
 gi|268587576|gb|EEZ52252.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae PID1]
 gi|268622209|gb|EEZ54609.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           PID332]
          Length = 381

 Score =  301 bits (771), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 170/378 (44%), Positives = 225/378 (59%), Gaps = 15/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE    LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R GT+AP
Sbjct: 7   LELAKALISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGD-----TKNIWLRRGTKAP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK SIACF+ A  RF+ ++ 
Sbjct: 62  VVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTSIACFVTACERFVAEHP 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GD IK GRRG
Sbjct: 122 DHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVDKLGDMIKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 182 SLSGNLTVKGKQGHIAYPHLAVNPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 242 TGATNVIPGELNVKFNFRFSTESTETGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLTH  KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 295 FLTHAGKLTDVARTAIAETCGVEAELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINE 354

Query: 363 NASLQDLEDLTCIYENFL 380
           N  L D+  L+ +YE  L
Sbjct: 355 NVRLDDIPKLSAVYERIL 372


>gi|241762232|ref|ZP_04760314.1| succinyl-diaminopimelate desuccinylase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241373279|gb|EER62898.1| succinyl-diaminopimelate desuccinylase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 376

 Score =  301 bits (771), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 164/385 (42%), Positives = 228/385 (59%), Gaps = 13/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           + PD ++   +LI C SVTP D GA  I+ + LK  GF++            V NL A  
Sbjct: 3   IAPDPVDLAARLIACKSVTPSDDGAMNIMADALKSAGFTVHLLTKGQAPDGPVTNLIAIR 62

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   PHL +AGH DVVP G    W+  PF+ TI +G + GRG VDMK S+A FIAA +R+
Sbjct: 63  GEGHPHLAYAGHSDVVPAG--QGWSSDPFTPTIKDGYLVGRGAVDMKSSVAAFIAAASRY 120

Query: 121 IPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
               ++ G++SLLITGDEEGPA  GT  ++ W+ ++  K D C+VGEPT    +GDT+K 
Sbjct: 121 T---EHKGTLSLLITGDEEGPATFGTPAIIEWLNEQSIKPDYCLVGEPTSVERLGDTVKN 177

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGS++  I + G QGHVAYP    NPI  L  ++  L +   D G+  F P+N+E+T+
Sbjct: 178 GRRGSVNMWIEVEGIQGHVAYPDRARNPIPVLARIISDLESWVLDKGDQWFQPSNLEVTS 237

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV 300
           I+  N + NVIPA  K   NIRFN L     L + ++ R       V  +       + +
Sbjct: 238 IECDNKATNVIPALAKAQLNIRFNALHKGAELVDSLKKR-------VAAIDPKARVKAAI 290

Query: 301 S-PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
           S   F+T +  LT  +S +I   TG  P LSTSGGTSDARF+   CPV+EFGLV  TMH 
Sbjct: 291 SGEAFVTEEGVLTDTISAAIAKNTGITPSLSTSGGTSDARFLTKLCPVVEFGLVNATMHK 350

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           ++E AS++D+  L+ I E+ ++++ 
Sbjct: 351 VDEKASVEDIRQLSRIDEDIIKSFL 375


>gi|121998253|ref|YP_001003040.1| succinyl-diaminopimelate desuccinylase [Halorhodospira halophila
           SL1]
 gi|238064751|sp|A1WX26|DAPE_HALHL RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|121589658|gb|ABM62238.1| succinyldiaminopimelate desuccinylase [Halorhodospira halophila
           SL1]
          Length = 378

 Score =  301 bits (771), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 154/379 (40%), Positives = 227/379 (59%), Gaps = 13/379 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE   +LI+ PSVTP+D G   ++   L   GF  E       N + V NL+A+ GTE P
Sbjct: 5   LELARELIQRPSVTPEDAGCQTLVAERLAAAGFGAE-----WLNAAGVTNLWAQRGTERP 59

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
              F GH DVVP G  + W +PPF   +  G +YGRG  DMKGS+A F+AAV RF+ ++ 
Sbjct: 60  LFCFLGHTDVVPSGPESAWQHPPFQPIVENGCLYGRGAADMKGSVAAFVAAVERFVARHP 119

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  G+I++L+T DEEGPA++GT++++  +  +G   D C+VGEP+    +GD  K+GRRG
Sbjct: 120 DHAGAIAVLLTSDEEGPAVDGTRRVVETLAARGAAIDYCLVGEPSSQARLGDEYKVGRRG 179

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SL+G +T+HG+QGHVAYPH  +NPI    P L +L    +D G+  F PT+ +I+ I  G
Sbjct: 180 SLTGHLTVHGEQGHVAYPHQADNPIHAFAPALQELVATEWDQGDADFPPTSFQISNIQAG 239

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
             + NVIP  +++ FN+R+    + + L+E I S L +       + HT+H+    +P F
Sbjct: 240 TGADNVIPGAMEVVFNLRYAPAVSAEELQERIESILHRH-----GVHHTLHWRHSGAP-F 293

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNEN 363
            T +  L   + +++   TG  P  STSGGTSD RF+      V+E G +  T+H  NE+
Sbjct: 294 ATREGALIDAVEQAVTAHTGQCPRRSTSGGTSDGRFMGPTGAQVVELGPLNATIHKANEH 353

Query: 364 ASLQDLEDLTCIYENFLQN 382
            ++ DLE L  IY + LQ+
Sbjct: 354 VAVADLEALEAIYFDILQH 372


>gi|325982874|ref|YP_004295276.1| succinyl-diaminopimelate desuccinylase [Nitrosomonas sp. AL212]
 gi|325532393|gb|ADZ27114.1| succinyl-diaminopimelate desuccinylase [Nitrosomonas sp. AL212]
          Length = 400

 Score =  301 bits (770), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 173/388 (44%), Positives = 229/388 (59%), Gaps = 17/388 (4%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D LE    LI   S+TP D G   IL++ L+ LGF IE+  F       V NL+AR 
Sbjct: 1   MPNDTLELAQTLIARRSLTPDDDGCQQILIDHLEKLGFHIEKMRFGN-----VDNLWARR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G  AP L FAGH DVVP G    W   PF+ TI +G++YGRG  DMK S+A FI A+  F
Sbjct: 56  GNTAPLLCFAGHTDVVPTGPLEQWDSDPFNPTIRDGRLYGRGAADMKSSLAAFITAIEAF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ +  GSI+LLIT DEEG AI+GT K++  ++ +GE  D CIVGEPTC   +GDTIK
Sbjct: 116 LAQHADHQGSIALLITSDEEGVAIDGTAKVVETLKARGELLDYCIVGEPTCTDKLGDTIK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSLSG +TI G QGH+AYPHL +NPI    P++ +L +  +D GN  F PT   I+
Sbjct: 176 NGRRGSLSGNLTIKGIQGHIAYPHLAKNPIHLAAPVIAELAHTEWDQGNEFFPPTTWHIS 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NVIP  + + FN RF+     ++L  +++  L K       L + + +   
Sbjct: 236 NINAGTGATNVIPGTLNLLFNFRFSTANTVESLTTKVQETLDKH-----GLDYELQWELS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMH 358
             P +LT   +L   +S +I   T   P LSTSGGTSD RFI D C  V+EFG    T+H
Sbjct: 291 GKP-YLTPKAELADAISAAITKVTAVEPQLSTSGGTSDGRFIADICSQVVEFGPRNATIH 349

Query: 359 ALNENASLQDLEDLTCIY----ENFLQN 382
            LNE   + DL+ L+ IY    EN L +
Sbjct: 350 KLNEYVDVDDLDQLSRIYLLTMENLLSS 377


>gi|332283977|ref|YP_004415888.1| succinyl-diaminopimelate desuccinylase [Pusillimonas sp. T7-7]
 gi|330427930|gb|AEC19264.1| succinyl-diaminopimelate desuccinylase [Pusillimonas sp. T7-7]
          Length = 378

 Score =  300 bits (769), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 169/374 (45%), Positives = 226/374 (60%), Gaps = 13/374 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           +LI  PSVTP D G    L + L   GF+ E   F       V NL+AR GT AP L+FA
Sbjct: 12  ELISRPSVTPDDLGCQQALASRLTAAGFNCETLAFGD-----VVNLWARRGTAAPLLVFA 66

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGS 129
           GH DVVP G  + W   PF+ T   G +YGRG  DMK SIA F+ AV  F+  + ++ GS
Sbjct: 67  GHTDVVPTGPLDRWDSDPFTPTERGGNLYGRGAADMKSSIAAFMVAVEEFVAAHPQHSGS 126

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I+LLIT DEEGP+++GT K+   + ++GE+ D CIVGEPT    +GDT+K GRRGSLSG+
Sbjct: 127 IALLITSDEEGPSVDGTVKVCQALAQRGEQLDYCIVGEPTSVDTLGDTVKNGRRGSLSGK 186

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +TI GKQGHVAYPHL  NPI  L P L +LT   +D GN  F  T  +++ +  G  + N
Sbjct: 187 LTIKGKQGHVAYPHLARNPIHLLGPALVELTAEQWDEGNEYFPATTFQVSNLHAGTGATN 246

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           V+P    + FN RF+      TLK  + + L K      KL + + ++    P FLT   
Sbjct: 247 VVPGAAVLDFNFRFSTASTPDTLKARVAAILHKH-----KLDYDLDWTQGGEP-FLTPKG 300

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMHALNENASLQD 368
           +L++ +S++I + TG I  LST+GGTSD RFI   CP VIEFG +  ++H +NE+  L  
Sbjct: 301 ELSTAMSQAILDETGVITQLSTTGGTSDGRFIAKICPQVIEFGPINASIHQVNEHVRLDT 360

Query: 369 LEDLTCIYENFLQN 382
           LE L  IY   L++
Sbjct: 361 LEPLKNIYRRTLEH 374


>gi|269213534|ref|ZP_05982180.2| succinyl-diaminopimelate desuccinylase [Neisseria cinerea ATCC
           14685]
 gi|269146359|gb|EEZ72777.1| succinyl-diaminopimelate desuccinylase [Neisseria cinerea ATCC
           14685]
          Length = 398

 Score =  300 bits (769), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 170/378 (44%), Positives = 225/378 (59%), Gaps = 15/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE   +LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R GT+AP
Sbjct: 24  LELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHF-----GDTKNIWLRRGTQAP 78

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK SIACF+ A  RF+ ++ 
Sbjct: 79  VVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTSIACFVTACERFVAEHP 138

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD IK GRRG
Sbjct: 139 DHPGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMIKNGRRG 198

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NPI    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 199 SLSGNLTVKGKQGHIAYPHLAVNPIHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 258

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 259 TGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 311

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLTH  KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 312 FLTHAGKLTDVARTAIAETCGVETELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINE 371

Query: 363 NASLQDLEDLTCIYENFL 380
           N  L D+  L+ +YE  L
Sbjct: 372 NVRLDDIPKLSAVYEGIL 389


>gi|254452230|ref|ZP_05065667.1| succinyl-diaminopimelate desuccinylase [Octadecabacter antarcticus
           238]
 gi|198266636|gb|EDY90906.1| succinyl-diaminopimelate desuccinylase [Octadecabacter antarcticus
           238]
          Length = 380

 Score =  300 bits (769), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 162/387 (41%), Positives = 224/387 (57%), Gaps = 11/387 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D +     LI+CPSVTP +GGA  +L   L   GF     D      +   NLYAR+
Sbjct: 1   MPVDPIALTADLIRCPSVTPVEGGALQLLDRLLSDAGFETWRVD-----RADTPNLYARW 55

Query: 61  GTEAPHLMFA--GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
           G    +  F   GH DVVP GD   WT  PF   I +G +YGRG  DMK  +A F AA  
Sbjct: 56  GARGANKSFGFNGHTDVVPVGDAAAWTVDPFGGEIRDGILYGRGATDMKSGVAAFAAAAI 115

Query: 119 RFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
            F+      G+I L ITGDEEG + +GT  +L W++  GE   ACIVGEPTC  ++G+ I
Sbjct: 116 DFVQDTPPDGAIILAITGDEEGASTDGTIALLDWMQSNGEAMTACIVGEPTCQDVMGEMI 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K+GRRGSL+   T+ GKQGH AYPH   NP+  +  L+ +L +   D G+  F P+ + +
Sbjct: 176 KVGRRGSLTSHFTVTGKQGHSAYPHRANNPLPAMARLMDRLASHEMDAGSDHFDPSTLAV 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
            TID GNP+ NVIPA  K S N+RFNDL+   T+   ++  +        +    +   +
Sbjct: 236 VTIDTGNPATNVIPAICKASANVRFNDLYTSHTVIAWMQGEVDA---VAAEFRVQIDIDT 292

Query: 299 PVS-PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTM 357
            VS   F+T   +L+ L+S ++   TG  P LST+GGTSDARF+K++CPV+E GLVG+TM
Sbjct: 293 RVSGESFVTPPGELSDLISAAVLAETGITPELSTTGGTSDARFVKNHCPVVEVGLVGKTM 352

Query: 358 HALNENASLQDLEDLTCIYENFLQNWF 384
           H ++E   ++ +  L  IY   L+++F
Sbjct: 353 HQVDECVPVEQITQLKAIYARILRDYF 379


>gi|297184317|gb|ADI20434.1| acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase
           and related deacylases [uncultured alpha proteobacterium
           EB080_L43F08]
          Length = 377

 Score =  300 bits (768), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 167/387 (43%), Positives = 228/387 (58%), Gaps = 14/387 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D +     LI+C S+TP++ GA  +L   L   GF     D       +V NL+AR+
Sbjct: 1   MNIDPVNLTADLIRCKSITPKEAGALVLLEALLSKAGFECNRVD-----RGLVSNLFARW 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G+    L F GH DVVP G  N W+  PF A I +G +YGRG  DMK  +A F AA   F
Sbjct: 56  GS-GRTLGFNGHTDVVPVGSINDWSVDPFGAEIKDGFLYGRGSTDMKSGVAAFAAAAIDF 114

Query: 121 IPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
           +      GSI L ITGDEEG A++GT  +L W+ +  E  + CIVGEPTC   IG+ +KI
Sbjct: 115 VQNSPPDGSIVLAITGDEEGQAVDGTVALLDWMNENNEIINHCIVGEPTCPENIGEMMKI 174

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGS++   TI G QGH AYPH   NP+  +  L+  LT+   D G+  F P+ + +TT
Sbjct: 175 GRRGSMTAYFTIRGVQGHSAYPHRANNPLPIMAKLICDLTSFELDQGSKHFDPSTLAVTT 234

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLK---EEIRSRLIKGIQNVPKLSHTVHFS 297
           ID GN + NVIPA+ K + NIRFNDL   K L    +++  ++    +N  +++  +  S
Sbjct: 235 IDTGNLANNVIPAETKATVNIRFNDLHTSKKLSIWLDKVTKKIAS--ENDVEINTEIQVS 292

Query: 298 SPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTM 357
                 F+T     + L+S S++  TG  P  STSGGTSDARFIKD+CPV+EFGLVG+TM
Sbjct: 293 ---GESFITALGDFSDLISNSVHLETGIYPEASTSGGTSDARFIKDHCPVVEFGLVGKTM 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWF 384
           H ++E  S+  +  L  IY N ++N+F
Sbjct: 350 HQIDERVSIDQVYKLKAIYFNIIKNYF 376


>gi|71065129|ref|YP_263856.1| succinyl-diaminopimelate desuccinylase [Psychrobacter arcticus
           273-4]
 gi|123649391|sp|Q4FU86|DAPE_PSYA2 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|71038114|gb|AAZ18422.1| succinyldiaminopimelate desuccinylase [Psychrobacter arcticus
           273-4]
          Length = 407

 Score =  300 bits (767), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 170/388 (43%), Positives = 229/388 (59%), Gaps = 8/388 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIE---EKDFQTKNT-SIVKNLYAR 59
           + L+  I L++ PSVTP D G   IL   L   GF  E     D Q K   + VKNL+AR
Sbjct: 21  ETLDLSIALLERPSVTPNDDGCQDILSERLTQAGFDCEFMYYGDRQAKGEHAEVKNLWAR 80

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT  P + FAGH DVVP GD  +WTYPPF+ TIA+G ++ RG  DMK  IA F  A  R
Sbjct: 81  RGTSNPVICFAGHTDVVPTGDEKNWTYPPFTPTIADGYLWARGAADMKTGIAAFTIAAER 140

Query: 120 FIPKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+  + ++ GSI+ LIT DEEGP+INGT K++  +E + EK   C+VGEP+    +GD I
Sbjct: 141 FVANHPQHNGSIAFLITSDEEGPSINGTVKVIETLEARQEKITYCLVGEPSSTDTLGDII 200

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSL   +T+ GKQGHVAYPHL  NPI   +  L +LTN  +D GN  F  T+++I
Sbjct: 201 KNGRRGSLGAVLTVTGKQGHVAYPHLASNPIHAAMSALSELTNASWDNGNDYFPATSLQI 260

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP  +++ FN RF+    E  LK +  +   K  ++  K  + +H+  
Sbjct: 261 SNINGGTGATNVIPETLEVVFNFRFSTETTEDELKAKTHAIFDKYFKD-SKAKYDIHWKL 319

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTM 357
              P FLT + KL S   ++I + TG    LSTSGGTSD RFI      V+E G+   T+
Sbjct: 320 SGQP-FLTPEGKLVSACQQAIKSVTGTDTTLSTSGGTSDGRFIAPTGAQVVELGVRNATI 378

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H ++E   + DL  L  IYE  L+N  +
Sbjct: 379 HQVDEKVEVDDLGRLAQIYERILENLLL 406


>gi|114321019|ref|YP_742702.1| succinyl-diaminopimelate desuccinylase [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|122311387|sp|Q0A7H5|DAPE_ALHEH RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|114227413|gb|ABI57212.1| succinyldiaminopimelate desuccinylase [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 375

 Score =  300 bits (767), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 153/381 (40%), Positives = 229/381 (60%), Gaps = 13/381 (3%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           + LE    LI   SVTP D G   +L   L+ LGF  E  D+       V NL+AR G +
Sbjct: 3   ETLELASALIARRSVTPMDAGCQQLLAERLRPLGFDCERLDYGE-----VNNLWARRGQQ 57

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            P   FAGH DVVPPG    W +PPF   + +G +YGRG  DMKGS+A F+ A+ R++  
Sbjct: 58  GPVFCFAGHTDVVPPGPEAQWRHPPFQPVVEQGLLYGRGAADMKGSVAAFVTALERYLAG 117

Query: 124 -YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
            ++  GS++LLIT DEEGPA++GT+ ++  + ++GE+ D C+VGEP+    +GD +K+GR
Sbjct: 118 GHRPRGSLALLITSDEEGPAVDGTRHVVETLSERGERIDWCLVGEPSSTERVGDVVKVGR 177

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSL+G +T+ G QGHVAYPHL  NP+   +  L +L    +D GN  F PT+ +I+ + 
Sbjct: 178 RGSLNGRLTVRGDQGHVAYPHLARNPVHQALAALDELVTTRWDEGNDHFPPTSFQISNVQ 237

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
            G  + NVIP +++++FN RF    + +   +E++ R ++ + +   L   + +S    P
Sbjct: 238 AGTGATNVIPGELEVTFNFRF----STEVTADELQQR-VEAVLDRHGLDGRIDWSLSGEP 292

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALN 361
            FLT + +L +    ++ +  G+ P+LSTSGGTSD RFI      V+E G V  T+H +N
Sbjct: 293 -FLTAEGELVAATQAAVRDVCGDPPVLSTSGGTSDGRFIAPTGAQVLELGPVNATIHKVN 351

Query: 362 ENASLQDLEDLTCIYENFLQN 382
           E+    DL+ L+ IYE  L+ 
Sbjct: 352 EHVRAADLDTLSRIYEGVLRR 372


>gi|56552528|ref|YP_163367.1| succinyl-diaminopimelate desuccinylase [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|81354704|sp|Q5NM04|DAPE_ZYMMO RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|56544102|gb|AAV90256.1| succinyl-diaminopimelate desuccinylase [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 376

 Score =  299 bits (766), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 164/385 (42%), Positives = 228/385 (59%), Gaps = 13/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           + PD ++   +LI C SVTP D GA  I+ + LK  GF++            V NL A  
Sbjct: 3   IAPDPVDLAARLIACKSVTPSDDGAMNIMADALKSAGFTVHLLTKGQAPDGPVTNLIAIR 62

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   PHL +AGH DVVP G    W+  PF+ TI +G + GRG VDMK S+A FIAA +R+
Sbjct: 63  GEGYPHLAYAGHSDVVPAG--QGWSSDPFTPTIKDGYLVGRGAVDMKSSVAAFIAAASRY 120

Query: 121 IPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
               ++ G++SLLITGDEEGPA  GT  ++ W+ ++  K D C+VGEPT    +GDT+K 
Sbjct: 121 T---EHKGTLSLLITGDEEGPATFGTPAIIEWLNEQSIKPDYCLVGEPTSVERLGDTVKN 177

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGS++  I + G QGHVAYP    NPI  L  ++  L +   D G+  F P+N+E+T+
Sbjct: 178 GRRGSVNMWIEVEGIQGHVAYPDRACNPIPVLARIISDLESWVLDKGDQWFQPSNLEVTS 237

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV 300
           I+  N + NVIPA  K   NIRFN L     L + ++ R       V  +       + +
Sbjct: 238 IECDNKATNVIPALAKAQLNIRFNALHKGAELVDSLKKR-------VAAIDPKARVKAAI 290

Query: 301 S-PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
           S   F+T +  LT  +S +I   TG  P LSTSGGTSDARF+   CPV+EFGLV  TMH 
Sbjct: 291 SGEAFVTEEGVLTDTISAAIAKNTGITPSLSTSGGTSDARFLTKLCPVVEFGLVNATMHK 350

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           ++E AS++D+  L+ I E+ ++++ 
Sbjct: 351 VDEKASVEDIRQLSRIDEDIIKSFL 375


>gi|260753812|ref|YP_003226705.1| succinyl-diaminopimelate desuccinylase [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|258553175|gb|ACV76121.1| succinyl-diaminopimelate desuccinylase [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 376

 Score =  299 bits (765), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 163/385 (42%), Positives = 227/385 (58%), Gaps = 13/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           + PD ++   +LI C SVTP D GA  I+ + LK  GF++            V NL A  
Sbjct: 3   IAPDPVDLAARLIACKSVTPSDDGAMNIMADALKSAGFTVHLLTKGQAPDGPVTNLIAIR 62

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   PHL +AGH DVVP G    W+  PF+ TI +G + GRG VDMK S+A FIAA +R+
Sbjct: 63  GEGHPHLAYAGHSDVVPAG--QGWSSDPFTPTIKDGYLVGRGAVDMKSSVAAFIAAASRY 120

Query: 121 IPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
               ++ G++SLLITGDEEGPA  GT  ++ W+ ++  K D C+VGEPT    +GDT+K 
Sbjct: 121 T---EHKGTLSLLITGDEEGPATFGTPAIIEWLNEQSIKPDYCLVGEPTSVERLGDTVKN 177

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGS++  I + G QGHVAYP    NPI  L  ++  L +   D G+  F P+N+E+T+
Sbjct: 178 GRRGSVNMWIEVEGIQGHVAYPDRARNPIPVLARIISDLESWVLDKGDQWFQPSNLEVTS 237

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV 300
           I+  N + NVIPA  K   NIRFN L     L + ++ R       V  +       + +
Sbjct: 238 IECDNKATNVIPALAKAQLNIRFNALHKGAELVDSLKKR-------VAAIDPKARVKAAI 290

Query: 301 S-PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
           S   F+T +  LT  +S +I   TG  P LST GGTSDARF+   CPV+EFGLV  TMH 
Sbjct: 291 SGEAFVTEEGILTDTISAAIAKNTGITPSLSTGGGTSDARFLTKLCPVVEFGLVNATMHK 350

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           ++E AS++D+  L+ I E+ ++++ 
Sbjct: 351 VDEKASVEDIRQLSRIDEDIIKSFL 375


>gi|329849463|ref|ZP_08264309.1| succinyl-diaminopimelate desuccinylase [Asticcacaulis biprosthecum
           C19]
 gi|328841374|gb|EGF90944.1| succinyl-diaminopimelate desuccinylase [Asticcacaulis biprosthecum
           C19]
          Length = 383

 Score =  299 bits (765), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 167/375 (44%), Positives = 221/375 (58%), Gaps = 15/375 (4%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+  SVTP D GA  ++   L+ LGF+ E   F       ++NLYAR GT  P+L FAG
Sbjct: 19  LIRRESVTPADAGAMDVVQRVLEGLGFACERLKFGQ-----IENLYARRGTTGPNLCFAG 73

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF-IPKYKNFGSI 130
           H DVVP G  + W Y PF A I +G + GRG VDMKG IA +IAAV+R  +P     GS+
Sbjct: 74  HTDVVPGGVRSLWRYDPFGAEIHDGLVIGRGAVDMKGGIAAWIAAVSRVDVP-----GSL 128

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           S LITGDEEG A +GT +++ W+ ++GE  D CIVGEP+ +  +GD IK+GRRGS++   
Sbjct: 129 SFLITGDEEGEASDGTIRVVEWLRERGEVIDHCIVGEPSSSAQLGDMIKVGRRGSINATF 188

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
           T+ GKQGHVAYP    NP+  L+ L+  L     D G   F P+N+EITTID GN + NV
Sbjct: 189 TVTGKQGHVAYPQRALNPLPVLVDLVAALKARVLDDGYEGFPPSNLEITTIDTGNTATNV 248

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           IP       NIRFN       LK       +    ++  K+   V  S      FLT   
Sbjct: 249 IPQSAMARVNIRFNPTHTGAELKAWFEGLAVDHAARSGAKIDVRVSIS---GEAFLTEPG 305

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDL 369
               L+++ I    G     ST+GGTSDARFI+  CPV+EFGLVG+TMH +NE   + +L
Sbjct: 306 PFVDLIAEVIQAQFGIETDRSTTGGTSDARFIRALCPVVEFGLVGQTMHQINECVPVTEL 365

Query: 370 EDLTCIYENFLQNWF 384
           + LT +Y   ++ +F
Sbjct: 366 QALTDVYAALIEAYF 380


>gi|284008486|emb|CBA74981.1| N-succinyl-diaminopimelate deacylase [Arsenophonus nasoniae]
          Length = 378

 Score =  298 bits (764), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 161/373 (43%), Positives = 226/373 (60%), Gaps = 13/373 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           QLI+ PSV+P D G   IL+N LK +GFSIE   F         NL+A  G +   L+FA
Sbjct: 11  QLIQQPSVSPNDHGCQTILINRLKKIGFSIEVMPFDD-----TANLWAYHGEQGETLVFA 65

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVP G   +W YPPF+ T+  G +YGRG  DMKGS+A  I A  RFI  + N  G 
Sbjct: 66  GHTDVVPAGATQNWRYPPFTPTLNNGLLYGRGAADMKGSLAAMIVAAERFIIDFPNHAGR 125

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           ++ LIT DEE  A NGT K++  +  + E+ D CIVGEPT    +GD IK GRRGSL+ +
Sbjct: 126 LAFLITSDEEAKATNGTVKVVDKLMMRNEQIDYCIVGEPTSQVKLGDIIKNGRRGSLTAK 185

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +T+ G QGH+AYPHL  N I   +P L++L N  +D GN  F PT+M+I+ I  G  S N
Sbjct: 186 LTVQGIQGHIAYPHLANNAIHSSLPFLNELVNKKWDDGNAFFPPTSMQISNIHAGTGSNN 245

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           +IP ++ + FN RF+    E+ +++++ + L K      +L++ + +S    P FLT   
Sbjct: 246 IIPGELVIQFNFRFSTELTEQQIRQQVETILKK-----YQLNYKIEWSLSGHP-FLTEKG 299

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFI-KDYCPVIEFGLVGRTMHALNENASLQD 368
           KL +++S+ I    G  P LST GGTSD RFI K    ++E G +  T+H ++E  S+ D
Sbjct: 300 KLINIVSQVIAQYCGYQPQLSTDGGTSDGRFIAKMGAQIVELGPINETIHKVDECVSVVD 359

Query: 369 LEDLTCIYENFLQ 381
           L+ L+ IY+  +Q
Sbjct: 360 LQQLSLIYQQIMQ 372


>gi|15677382|ref|NP_274537.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           MC58]
 gi|81784416|sp|Q9JYL2|DAPE_NEIMB RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|7226774|gb|AAF41885.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           MC58]
 gi|316986004|gb|EFV64941.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           H44/76]
 gi|325140681|gb|EGC63197.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           CU385]
 gi|325199868|gb|ADY95323.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           H44/76]
          Length = 381

 Score =  298 bits (763), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 169/378 (44%), Positives = 223/378 (58%), Gaps = 15/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE   +LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R GT+AP
Sbjct: 7   LELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGD-----TKNIWLRRGTKAP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF     +G++YGRG  DMK SIACF+ A  RF+ K+ 
Sbjct: 62  VVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACERFVAKHP 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           N  GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD IK GRRG
Sbjct: 122 NHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMIKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 182 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 242 TGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLT   KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 295 FLTQAGKLTDVARAAIAETCGIEAELSTTGGTSDGRFIKAIAQELIELGPSNATIHQINE 354

Query: 363 NASLQDLEDLTCIYENFL 380
           N  L D+  L+ +YE  L
Sbjct: 355 NVRLNDIPKLSAVYEGIL 372


>gi|326794428|ref|YP_004312248.1| Succinyl-diaminopimelate desuccinylase [Marinomonas mediterranea
           MMB-1]
 gi|326545192|gb|ADZ90412.1| Succinyl-diaminopimelate desuccinylase [Marinomonas mediterranea
           MMB-1]
          Length = 388

 Score =  298 bits (763), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 168/386 (43%), Positives = 230/386 (59%), Gaps = 14/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           +TP  LE  I L+   SVTP+D G    ++  L+ +GF++E+  F       VKN YA+ 
Sbjct: 14  LTP-TLELAIDLMSRASVTPEDAGCQETMIKRLEKIGFTVEKMPFGD-----VKNFYAKR 67

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G + P+L FAGH DVVP G    W  PPF   I +G +YGRG  DMKGS+A  I AV RF
Sbjct: 68  GNDGPNLCFAGHTDVVPTGPEAEWKVPPFEPQIIDGILYGRGAADMKGSLASMIIAVERF 127

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           I    N  G IS LIT DEEGP ++GT +++  +  + EK D CIVGEP+  + +GD IK
Sbjct: 128 IDNNPNHKGQISFLITSDEEGPFVDGTTRVVDTLMARNEKVDWCIVGEPSSTNTLGDIIK 187

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS SG++T+ GKQGHVAYPHL +NPI    P + +L+   +D GN  F PT+ +++
Sbjct: 188 NGRRGSFSGDLTVFGKQGHVAYPHLAKNPIHLASPAITELSETVWDQGNDFFPPTSFQVS 247

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NV+P  +   FN RF+   +  +LKE++ S L K      +L++ V ++  
Sbjct: 248 NINAGTGATNVVPGTLNAQFNFRFSSELDFDSLKEKVISILDKH-----ELNYEVDWTYN 302

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFI-KDYCPVIEFGLVGRTMH 358
             P FLT   +L   ++K+I  T    P LSTSGGTSD RFI K    V+E G +  T+H
Sbjct: 303 GLP-FLTRPGELVDAITKAIEKTVDITPTLSTSGGTSDGRFIAKMGTQVVELGPINATIH 361

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            +NE+     L  LT IYE  L+N F
Sbjct: 362 QINEHIEANSLNQLTSIYEGVLENLF 387


>gi|254805296|ref|YP_003083517.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           alpha14]
 gi|254668838|emb|CBA06878.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           alpha14]
          Length = 381

 Score =  298 bits (763), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 168/378 (44%), Positives = 224/378 (59%), Gaps = 15/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE   +LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R GT+AP
Sbjct: 7   LELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGD-----TKNIWLRRGTKAP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF     +G++YGRG  DMK SIACF+ A  RF+ ++ 
Sbjct: 62  VVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACERFVAEHP 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GD IK GRRG
Sbjct: 122 DHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVDKLGDMIKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 182 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 242 TGATNVIPGELSVKFNFRFSTESTEAGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLTH  KLT +   +I    G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 295 FLTHAGKLTDVARAAIAEICGVETELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINE 354

Query: 363 NASLQDLEDLTCIYENFL 380
           N  L D+  L+ +YE  L
Sbjct: 355 NVRLDDIPKLSAVYEGIL 372


>gi|332969959|gb|EGK08959.1| succinyl-diaminopimelate desuccinylase [Kingella kingae ATCC 23330]
          Length = 374

 Score =  298 bits (763), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 166/372 (44%), Positives = 224/372 (60%), Gaps = 13/372 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           QL+   S+TP D     IL + L+ +GF+IEE  F        KN YAR G   P L FA
Sbjct: 9   QLLAEQSITPDDKNCQTILADRLRAIGFTIEEMHFGE-----TKNFYARLGDTTPVLCFA 63

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVP GD + WT+ PF+ T  +GK+Y RG  DMK +IACFI A  RF+    +F GS
Sbjct: 64  GHTDVVPTGDVSKWTFDPFTPTEHDGKLYARGAADMKTAIACFITACERFVAANPDFSGS 123

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           ++LLIT DEEG A +GT K++  ++++GE  D CIVGEPT  + +GDT+K GRRGSLSG 
Sbjct: 124 LALLITSDEEGDAHDGTTKVVDKLKERGEMLDYCIVGEPTAVNQLGDTLKNGRRGSLSGS 183

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +T+ GKQGH+AYPHL  NPI    P L +L    +D GN  F  T+ +I+ I+ G  + N
Sbjct: 184 LTVQGKQGHIAYPHLANNPIHAAAPALAELAATEWDKGNAYFPATSFQISNINGGTGATN 243

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIPA V + FN RF+    E +LK  +   L K       L++ + +S   +P FLT   
Sbjct: 244 VIPATVNVKFNFRFSTEQTESSLKNRVYEILDK-----HDLTYDLAWSLSGNP-FLTEAG 297

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNENASLQD 368
           KLT +   +     G  P LST+GGTSD RFIK     +IE G V  T+H ++E+  L D
Sbjct: 298 KLTEIAQAACTEICGVTPELSTTGGTSDGRFIKAIARELIELGFVNATIHQIDEHIELAD 357

Query: 369 LEDLTCIYENFL 380
           ++ L+ +YE  +
Sbjct: 358 IDKLSAVYEKMM 369


>gi|261365438|ref|ZP_05978321.1| succinyl-diaminopimelate desuccinylase [Neisseria mucosa ATCC
           25996]
 gi|288566103|gb|EFC87663.1| succinyl-diaminopimelate desuccinylase [Neisseria mucosa ATCC
           25996]
          Length = 381

 Score =  298 bits (763), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 169/378 (44%), Positives = 224/378 (59%), Gaps = 15/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE   +LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R GT+AP
Sbjct: 7   LELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGN-----TKNIWLRRGTKAP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK SIACF+ A  RF+ ++ 
Sbjct: 62  VVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTSIACFVTACERFVAEHP 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD IK GRRG
Sbjct: 122 DHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMIKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP     P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 182 SLSGNLTVKGKQGHIAYPHLAINPAHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 242 TGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLTH  KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 295 FLTHAGKLTDVARAAIAETCGVETELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINE 354

Query: 363 NASLQDLEDLTCIYENFL 380
           N  L D+  L+ +YE  L
Sbjct: 355 NVRLDDIPKLSAVYEGIL 372


>gi|56698156|ref|YP_168528.1| succinyl-diaminopimelate desuccinylase [Ruegeria pomeroyi DSS-3]
 gi|81349000|sp|Q5LN80|DAPE_SILPO RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|56679893|gb|AAV96559.1| succinyl-diaminopimelate desuccinylase [Ruegeria pomeroyi DSS-3]
          Length = 380

 Score =  298 bits (763), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 162/387 (41%), Positives = 225/387 (58%), Gaps = 11/387 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT D       LI+C SVTP D GA  +L   L   GFS    D        + NL+AR+
Sbjct: 1   MTLDAARLTADLIRCASVTPADDGALDVLERVLSQAGFSCTRVD-----RGGICNLFARW 55

Query: 61  GTE--APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
           G +  A    F GH DVVP GD   WT  PF A   +G +YGRG  DMK  +A F+AA  
Sbjct: 56  GDKGHARSFGFNGHTDVVPVGDAAAWTVAPFGAEEKDGFLYGRGATDMKSGVAAFVAAAV 115

Query: 119 RFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
             +      G++ + ITGDEEG A++GTK +L ++   GE+   C+VGEPTC   +G+ I
Sbjct: 116 DLVTTTPPEGAVIVTITGDEEGDALDGTKALLDYMAASGERMSVCLVGEPTCPDRMGEMI 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGS++   T+ G QGH AYPH  +NP+  +  L+ +L + G D G   F P+ + +
Sbjct: 176 KIGRRGSMTAWFTVTGVQGHSAYPHRAKNPLPAMARLMDRLASHGLDQGTDHFDPSTLAV 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
            TID GN + NVIPAQ + + NIRFNDL +  +L   ++    +  +   +    V    
Sbjct: 236 VTIDTGNTATNVIPAQCRGAVNIRFNDLHSGASLTGWMQGEADRVAE---EFGVAVEMKV 292

Query: 299 PVS-PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTM 357
            +S   FLT   +L+ L++ ++   TG  P+LSTSGGTSDARF+KD+CPV+EFGLVGRTM
Sbjct: 293 KISGESFLTPPGELSDLVAAAVEAETGVTPVLSTSGGTSDARFVKDHCPVVEFGLVGRTM 352

Query: 358 HALNENASLQDLEDLTCIYENFLQNWF 384
           H ++E   +  +  L  IY   L+++F
Sbjct: 353 HQVDERVEIAQIHQLKAIYGRILRDFF 379


>gi|86139452|ref|ZP_01058021.1| succinyl-diaminopimelate desuccinylase [Roseobacter sp. MED193]
 gi|85823955|gb|EAQ44161.1| succinyl-diaminopimelate desuccinylase [Roseobacter sp. MED193]
          Length = 381

 Score =  298 bits (762), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 161/377 (42%), Positives = 224/377 (59%), Gaps = 11/377 (2%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE--APHLM 68
            LI+CPSVTP++GGA  +L   L   GF+    D        + NL+AR+G +  A    
Sbjct: 12  DLIRCPSVTPEEGGALQLLDELLTQAGFACTRVD-----RGGIANLFARWGDKGHARTFG 66

Query: 69  FAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFG 128
           F GH DVVP GD   WT PPF A I EG +YGRG  DMK  +A F AA   F+      G
Sbjct: 67  FNGHTDVVPLGDEAAWTMPPFGAEIKEGVMYGRGATDMKSGVAAFAAAAIDFVTNTPPDG 126

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           ++ L ITGDEEG AI+GT  +L  +E  GE  D C+VGEPTC + +G+ IKIGRRGS++ 
Sbjct: 127 AVILTITGDEEGDAIDGTTALLDHLETAGEAMDVCLVGEPTCPNTMGEMIKIGRRGSMTA 186

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
             T+ GKQGH AYPH   NP+  +  L+ +L +   D G   F  + + + TID GNP+ 
Sbjct: 187 WFTVTGKQGHSAYPHRANNPLNAMARLMDRLASHELDQGTEHFDASTLAVVTIDTGNPAT 246

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS-PVFLTH 307
           NVIPAQ + + NIRFND  +  +L   ++  + +      +   +V  +  +S   F+T 
Sbjct: 247 NVIPAQSRATVNIRFNDSHSGASLSAWLQEEVDR---VTTEFGVSVDLTIKISGESFITP 303

Query: 308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQ 367
              L+ L++ ++   TG  P LST+GGTSDARF+K +CPV+EFGLVG+TMH ++E   + 
Sbjct: 304 PGALSDLVATAVEAETGLKPELSTTGGTSDARFVKHHCPVVEFGLVGKTMHQVDECVPIA 363

Query: 368 DLEDLTCIYENFLQNWF 384
            +  L  IY   L+++F
Sbjct: 364 QITQLKSIYTRILKDYF 380


>gi|312884928|ref|ZP_07744618.1| succinyl-diaminopimelate desuccinylase [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309367405|gb|EFP94967.1| succinyl-diaminopimelate desuccinylase [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 377

 Score =  298 bits (762), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 161/375 (42%), Positives = 229/375 (61%), Gaps = 17/375 (4%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+ PSVTP+D G   +++  LK LGF+IE   F+        N +AR GTE+P  +FAG
Sbjct: 13  LIRRPSVTPKDEGCQEVMIERLKALGFNIEVMVFED-----TTNFWARRGTESPLFVFAG 67

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI---PKYKNFG 128
           H DVVP G+   W YPPF  T+ +G ++GRG  DMKGS+A  + AV  FI   P ++  G
Sbjct: 68  HTDVVPAGNIEQWQYPPFEPTVKDGFLFGRGAADMKGSLASMVVAVEEFISTNPDHQ--G 125

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           SI  LIT DEEGP INGT +++  +  +GE  + CIVGEP+   I+GD IK GRRGS++G
Sbjct: 126 SIGFLITSDEEGPFINGTVRVVDTLMARGENIEMCIVGEPSSTDIVGDVIKNGRRGSITG 185

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
           +ITI G QGHVAYPHL  NP+   +  L +LTN+ +D GN  F PT+ +I  I+ G  + 
Sbjct: 186 DITIKGIQGHVAYPHLANNPVHHSLAALQELTNMEWDQGNKYFPPTSFQIPNINAGTGAS 245

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHD 308
           NVIP ++K+ FN+RF+   N   +  ++ + L K      +L + + ++    P FLT  
Sbjct: 246 NVIPGELKVQFNLRFSTELNNDIIMSKVIAVLDKH-----QLDYGIDWTFNGDP-FLTDT 299

Query: 309 RKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQ 367
             L   + K++ +     P L T+GGTSD RFI      V+E G V  T+H +NE  +++
Sbjct: 300 GALLESVVKAVNDVNQTEPQLLTTGGTSDGRFIARMGGQVVELGPVNATIHKVNECVNIE 359

Query: 368 DLEDLTCIYENFLQN 382
           DLE LT +Y+  ++N
Sbjct: 360 DLEKLTNMYKKTMEN 374


>gi|325198651|gb|ADY94107.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           G2136]
          Length = 381

 Score =  298 bits (762), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 168/378 (44%), Positives = 224/378 (59%), Gaps = 15/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE   +LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R GT+ P
Sbjct: 7   LELAKELIARPSVTPDDQNCQKLLAERLHKIGFAAEELHFGD-----TKNIWLRRGTKVP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK SIACF+ A  RF+ ++ 
Sbjct: 62  VVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTSIACFVTACERFVAEHP 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GD IK GRRG
Sbjct: 122 DHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVGKLGDMIKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 182 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 242 TGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLTH  KLT +   +I    G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 295 FLTHAGKLTDVARAAIAEICGVETELSTTGGTSDGRFIKAIAKELIELGSSNATIHQINE 354

Query: 363 NASLQDLEDLTCIYENFL 380
           N  L D+  L+ +YE  L
Sbjct: 355 NVRLDDIPKLSAVYEGIL 372


>gi|218768512|ref|YP_002343024.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           Z2491]
 gi|238064801|sp|A1ISU7|DAPE_NEIMA RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|121052520|emb|CAM08859.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           Z2491]
          Length = 381

 Score =  298 bits (762), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 169/378 (44%), Positives = 224/378 (59%), Gaps = 15/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE    LI  PSVTP D     +LV  L  +GF+ EE  F        KN++ R GT+ P
Sbjct: 7   LELAKALISRPSVTPDDRDCQKLLVERLYKIGFAAEELHFGD-----TKNIWLRRGTKVP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK SIACF+ A  RF+ ++ 
Sbjct: 62  VVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTSIACFVTACERFVAEHP 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GD IK GRRG
Sbjct: 122 DHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVDKLGDMIKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 182 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNKYFPPTSFQISNINGG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 242 TGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLT   KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 295 FLTQAGKLTDVARAAIAETCGIEAELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINE 354

Query: 363 NASLQDLEDLTCIYENFL 380
           N  L D+  L+ +YE  L
Sbjct: 355 NVRLDDIPKLSAVYEGIL 372


>gi|58697492|ref|ZP_00372764.1| succinyl-diaminopimelate desuccinylase [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|58536056|gb|EAL59718.1| succinyl-diaminopimelate desuccinylase [Wolbachia endosymbiont of
           Drosophila simulans]
          Length = 340

 Score =  298 bits (762), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 157/333 (47%), Positives = 210/333 (63%), Gaps = 7/333 (2%)

Query: 53  VKNLYARFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIAC 112
           VKNLYA++    P+L FAGH+DVVPPG    W + PF+  + +G +YGRG VDMK  +A 
Sbjct: 7   VKNLYAKYINGVPNLCFAGHVDVVPPGQLKDWAFGPFNPEVRDGILYGRGAVDMKSGVAA 66

Query: 113 FIAAVARFIP-KYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCN 171
           FIAA+   I  K++  GSIS LIT  EE     GTK +L W++ K +K D C+V EPT +
Sbjct: 67  FIAAMVNLIAEKFQFNGSISALITSAEESTEEYGTKAVLEWMKSKQKKVDFCVVAEPTSS 126

Query: 172 HIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTF 231
             +GDTIKIGRRGS++ E+  HGKQGHVAYP L +NPI  +I +L ++ N  FD GN  F
Sbjct: 127 EKLGDTIKIGRRGSVTFELICHGKQGHVAYPDLADNPIYKVISILSKVKNTTFDHGNKYF 186

Query: 232 SPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLS 291
            P++ E+TTIDVGN + N+IP      FNIR+N+      L + I   +   + N  KLS
Sbjct: 187 QPSHCEVTTIDVGNNTSNLIPGLATTRFNIRYNNEQTPGGLYKLI-DEICSSVTNDYKLS 245

Query: 292 HTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFG 351
             VH S     VFL+   + T ++  +I   T     LSTSGGTSDA FIKD CPVIEFG
Sbjct: 246 --VHSS---RDVFLSTPDRNTDIMLDAINKVTSIDAALSTSGGTSDAAFIKDVCPVIEFG 300

Query: 352 LVGRTMHALNENASLQDLEDLTCIYENFLQNWF 384
           ++ +T H +NE   + D+  LT IY+ F++N+ 
Sbjct: 301 IINKTAHQINECVLVNDIHKLTAIYKEFIENYL 333


>gi|161870391|ref|YP_001599563.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           053442]
 gi|238064800|sp|A9M0W6|DAPE_NEIM0 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|161595944|gb|ABX73604.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           053442]
          Length = 381

 Score =  298 bits (762), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 169/378 (44%), Positives = 224/378 (59%), Gaps = 15/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE    LI  PSVTP D     +LV  L  +GF+ EE  F        KN++ R GT+ P
Sbjct: 7   LELAKALISRPSVTPDDRDCQKLLVERLYKIGFAAEELHFGD-----TKNIWLRRGTKVP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK SIACF+ A  RF+ ++ 
Sbjct: 62  VVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTSIACFVTACERFVAEHP 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GD IK GRRG
Sbjct: 122 DHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVDKLGDMIKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 182 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNKYFPPTSFQISNINGG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 242 TGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLT   KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 295 FLTQAGKLTDVARAAIAETCGIEAELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINE 354

Query: 363 NASLQDLEDLTCIYENFL 380
           N  L D+  L+ +YE  L
Sbjct: 355 NVRLNDIPKLSAVYEGIL 372


>gi|261392225|emb|CAX49740.1| succinyl-diaminopimelate desuccinylase (SDAP) [Neisseria
           meningitidis 8013]
          Length = 381

 Score =  298 bits (762), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 168/378 (44%), Positives = 224/378 (59%), Gaps = 15/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE   +LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R GT+ P
Sbjct: 7   LELAKELISRPSVTPDDQNCQQLLAERLHKIGFAAEELHFGD-----TKNIWLRRGTKVP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK SIACF+ A  RF+ ++ 
Sbjct: 62  VVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTSIACFVTACERFVAEHP 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GD IK GRRG
Sbjct: 122 DHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVGKLGDMIKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 182 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 242 TGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLTH  KLT +   +I    G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 295 FLTHAGKLTDVARAAIAEICGVETELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINE 354

Query: 363 NASLQDLEDLTCIYENFL 380
           N  L D+  L+ +YE  L
Sbjct: 355 NVRLNDIPKLSAVYEGIL 372


>gi|93005379|ref|YP_579816.1| succinyl-diaminopimelate desuccinylase [Psychrobacter
           cryohalolentis K5]
 gi|122415857|sp|Q1QDC1|DAPE_PSYCK RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|92393057|gb|ABE74332.1| succinyldiaminopimelate desuccinylase [Psychrobacter cryohalolentis
           K5]
          Length = 407

 Score =  297 bits (761), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 168/386 (43%), Positives = 227/386 (58%), Gaps = 8/386 (2%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIE---EKDFQTKNT-SIVKNLYARFG 61
           L+  I L++ PSVTP D G   IL   L   GF  E     D Q K   + VKNL+AR G
Sbjct: 23  LDLSIALLERPSVTPDDDGCQDILSERLTQAGFDCEFMYYGDRQAKGEHAEVKNLWARRG 82

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
              P + FAGH DVVP GD  +WTYPPF+ TIA+G ++ RG  DMK  IA F  A  RF+
Sbjct: 83  NTNPVICFAGHTDVVPTGDEKNWTYPPFTPTIADGYLWARGAADMKTGIAAFTVAAERFV 142

Query: 122 PKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
             + ++ GSI+ LIT DEEGP+INGT K++  +E + EK   C+VGEP+    +GD IK 
Sbjct: 143 ANHPEHNGSIAFLITSDEEGPSINGTVKVVETLEARNEKITYCLVGEPSSTDTLGDIIKN 202

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGSL   +T+ GKQGHVAYPHL  NPI   +  L +LTN  +D GN  F  T+++I+ 
Sbjct: 203 GRRGSLGAVLTVTGKQGHVAYPHLASNPIHAAMSALAELTNATWDNGNDYFPATSLQISN 262

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV 300
           I+ G  + NVIP  ++  FN RF+   +E  LK +  +   +   +  K ++ +H+    
Sbjct: 263 INSGTGATNVIPETLEAVFNFRFSTETSEDELKAKTHAIFDRYFAD-SKAAYDIHWKLSG 321

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHA 359
            P FLT + KL S   ++I + TG    LSTSGGTSD RFI      V+E G+   T+H 
Sbjct: 322 QP-FLTPEGKLVSACQQAIKSVTGTDTTLSTSGGTSDGRFIAPTGAQVVELGVRNATIHQ 380

Query: 360 LNENASLQDLEDLTCIYENFLQNWFI 385
           ++E   + DL  L  IYE  L+N  +
Sbjct: 381 VDEKVEVDDLGKLAQIYEGILENLLL 406


>gi|254439436|ref|ZP_05052930.1| succinyl-diaminopimelate desuccinylase [Octadecabacter antarcticus
           307]
 gi|198254882|gb|EDY79196.1| succinyl-diaminopimelate desuccinylase [Octadecabacter antarcticus
           307]
          Length = 380

 Score =  297 bits (760), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 160/389 (41%), Positives = 223/389 (57%), Gaps = 15/389 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D +   + LI+CP+VTP +GGA  +L   L   GF     D      +   NL+AR+
Sbjct: 1   MPVDPIALTVDLIRCPTVTPTEGGALQLLDRLLSDAGFETWRVD-----RAGTPNLFARW 55

Query: 61  GTEAPHLMFA--GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
           G    +  F   GH DVVP GD   WT  PF   I +G +YGRG  DMK  +A F AA  
Sbjct: 56  GARGANKSFGFNGHTDVVPVGDAAAWTVDPFGGEICDGVLYGRGATDMKSGVAAFAAAAI 115

Query: 119 RFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
            F+      G+I L IT DEEGP+ +GT  +L W+   GE   ACIVGEPTC  ++G+ I
Sbjct: 116 DFVQVTPPDGAIILAITCDEEGPSTDGTIALLDWMRSHGEAMTACIVGEPTCPDVMGEMI 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K+GRRGSL+   T+ GKQGH AYPH   NP+  ++ L+ +L +   D G+  F P+ + +
Sbjct: 176 KVGRRGSLTSHFTVTGKQGHSAYPHRANNPLPAMVRLMDRLASYEMDKGSDHFDPSTLAV 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
            TID GNP+ NVIPA  K S N+RFNDL   +++        ++G  +V      V    
Sbjct: 236 VTIDTGNPATNVIPAICKASANVRFNDLHTSQSVIA-----WMQGEVDVVAADFGVQIDM 290

Query: 299 PV---SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGR 355
                   F+T   +L+ L+  ++   TG  P LST+GGTSDARF+KD+CPV+E GLVG+
Sbjct: 291 ACRVSGESFITPPGELSDLVCAAVLAETGMTPELSTTGGTSDARFVKDHCPVVEVGLVGK 350

Query: 356 TMHALNENASLQDLEDLTCIYENFLQNWF 384
           TMH ++E   ++ +  L  IY+  L+++F
Sbjct: 351 TMHQVDECVPVEQITQLKAIYDRILRSYF 379


>gi|319410760|emb|CBY91144.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis WUE
           2594]
          Length = 398

 Score =  296 bits (759), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 168/378 (44%), Positives = 223/378 (58%), Gaps = 15/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE    LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R GT+ P
Sbjct: 24  LELAKALISRPSVTPDDQNCQKLLAERLHKIGFAAEELHFGD-----TKNIWLRRGTKVP 78

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK SIACF+ A  RF+ ++ 
Sbjct: 79  VVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTSIACFVTACERFVAEHP 138

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GD IK GRRG
Sbjct: 139 DHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVDKLGDMIKNGRRG 198

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 199 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 258

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 259 TGATNVIPGELSVKFNFRFSTESTEAGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 311

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLTH  KLT +   +I    G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 312 FLTHAGKLTDVARAAIAEICGVETELSTTGGTSDGRFIKAITKELIELGPSNATIHQINE 371

Query: 363 NASLQDLEDLTCIYENFL 380
           N  L D+  L+ +YE  L
Sbjct: 372 NVRLNDIPKLSAVYEGIL 389


>gi|297171151|gb|ADI22161.1| acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase
           and related deacylases [uncultured gamma proteobacterium
           HF0200_24F15]
          Length = 382

 Score =  296 bits (759), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 170/376 (45%), Positives = 227/376 (60%), Gaps = 19/376 (5%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+  SVTP+DGG   ++   LK  GF  E  DF       V N++ R GT  P ++FAG
Sbjct: 18  LIRRASVTPEDGGCQQLISEALKPFGFVSESFDFGG-----VHNIWLRRGTGNPLIVFAG 72

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVP G    W +PPFSA +++G ++GRG  DMKGSIA  + A  RF    +N  GSI
Sbjct: 73  HTDVVPTGSLERWRFPPFSAIVSQGLLHGRGAADMKGSIAAMVTACQRFAATNQNHTGSI 132

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
             LIT DEEGPAINGTK +++ ++K+GE +  CIVGEPT    IGDTIK GRRGSL+G +
Sbjct: 133 GFLITSDEEGPAINGTKHVITELQKRGESFKWCIVGEPTSRKRIGDTIKNGRRGSLNGTL 192

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
            + G QGHVAYPHL  NPI    PL+  LTN  +D+GN  F PT ++I+ I  G+ + NV
Sbjct: 193 NLRGIQGHVAYPHLARNPIHHAAPLIVALTNHEWDSGNEDFPPTTLQISNIRGGSGATNV 252

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFS---SPVSPVFLTH 307
           IP ++++ FN RF+    E T+ E     L    Q++ K   T  F+    P SP++ T 
Sbjct: 253 IPDEIEIIFNFRFSP---ESTVPE-----LQDKFQDICK-EQTNDFTIDWQPASPMYHTP 303

Query: 308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASL 366
             +L  +  K I   TG  P L+T GGTSD RFI      VIE G + RT+H+ +E+  +
Sbjct: 304 AAELVKVARKIIRAKTGIKPTLATDGGTSDGRFISGTGAQVIELGPINRTIHSSDEHVRV 363

Query: 367 QDLEDLTCIYENFLQN 382
            DL  L+ IYE+ L +
Sbjct: 364 SDLGLLSEIYEDILTD 379


>gi|309378734|emb|CBX22684.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 381

 Score =  296 bits (759), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 168/378 (44%), Positives = 223/378 (58%), Gaps = 15/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE    LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R GT+AP
Sbjct: 7   LELAKALISRPSVTPDDQNCQKLLAERLHKIGFAAEELHFGD-----TKNIWLRRGTKAP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK  IACF+ A  RF+ ++ 
Sbjct: 62  VVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTGIACFVTACERFVAEHP 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD IK GRRG
Sbjct: 122 DHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMIKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 182 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 242 TGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLTH  KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 295 FLTHAGKLTDVARAAIAETCGVETELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINE 354

Query: 363 NASLQDLEDLTCIYENFL 380
           N  L D+  L+ +YE  L
Sbjct: 355 NVRLDDIPKLSAVYEGIL 372


>gi|255067950|ref|ZP_05319805.1| succinyl-diaminopimelate desuccinylase [Neisseria sicca ATCC 29256]
 gi|255047832|gb|EET43296.1| succinyl-diaminopimelate desuccinylase [Neisseria sicca ATCC 29256]
          Length = 411

 Score =  296 bits (759), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 168/378 (44%), Positives = 223/378 (58%), Gaps = 15/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE    LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R GT+ P
Sbjct: 37  LELAKALISRPSVTPDDRDCQKLLAERLHKIGFAAEEFHFGD-----TKNIWLRRGTQVP 91

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK SIACF+ A  RF+ ++ 
Sbjct: 92  VVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTSIACFVTACERFVAEHP 151

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD IK GRRG
Sbjct: 152 DHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMIKNGRRG 211

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 212 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 271

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 272 TGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 324

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLTH  KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 325 FLTHAGKLTDVARAAISETCGVETELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINE 384

Query: 363 NASLQDLEDLTCIYENFL 380
           N  L D+  L+ +YE  L
Sbjct: 385 NVRLDDIPKLSAVYEGIL 402


>gi|225075372|ref|ZP_03718571.1| hypothetical protein NEIFLAOT_00377 [Neisseria flavescens
           NRL30031/H210]
 gi|224953292|gb|EEG34501.1| hypothetical protein NEIFLAOT_00377 [Neisseria flavescens
           NRL30031/H210]
          Length = 377

 Score =  296 bits (759), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 168/380 (44%), Positives = 224/380 (58%), Gaps = 15/380 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE    LI  PSVTP D     +L   L  +GF  EE  F        KN++ R GT+AP
Sbjct: 7   LELSKALISRPSVTPDDRDCQKLLAERLHKIGFVAEELHFGD-----TKNIWLRRGTKAP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK  IACF+ A  RF+ ++ 
Sbjct: 62  VVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTGIACFVTACERFVAEHP 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD IK GRRG
Sbjct: 122 DHQGSIALLITSDEEGDALDGTTKVVDVLKARSELIDYCIVGEPTAVDKLGDMIKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 182 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 242 TGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLTH  KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 295 FLTHAGKLTDVARAAIAETCGVETELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINE 354

Query: 363 NASLQDLEDLTCIYENFLQN 382
           N  L+D+  L+ +YE  L+ 
Sbjct: 355 NVRLEDIPKLSAVYEGMLKR 374


>gi|149200888|ref|ZP_01877863.1| succinyl-diaminopimelate desuccinylase [Roseovarius sp. TM1035]
 gi|149145221|gb|EDM33247.1| succinyl-diaminopimelate desuccinylase [Roseovarius sp. TM1035]
          Length = 383

 Score =  296 bits (758), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 163/377 (43%), Positives = 222/377 (58%), Gaps = 11/377 (2%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE--APHLM 68
            LI+C SVTP++GGA  +L   L   GFS    D        V NL+AR+G +  A    
Sbjct: 14  DLIRCASVTPEEGGALRLLEQVLTDAGFSCVRVD-----RGEVPNLFARWGPKGAARSFG 68

Query: 69  FAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFG 128
           F GH DVVP GD   W+ PPF     +G I+GRG  DMK  +A F AA   F+      G
Sbjct: 69  FNGHTDVVPVGDLAAWSVPPFGGVEKDGMIWGRGATDMKSGVAAFAAAAVDFVRDTPPDG 128

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           ++ L ITGDEEG A++GT  +L W+   GE   AC+VGEPTC   +G+ IKIGRRGSLS 
Sbjct: 129 AVILAITGDEEGDAVDGTVALLDWMTAHGEAMTACLVGEPTCPERMGEMIKIGRRGSLSA 188

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
             T+ G QGH AYPH   NP+  +  L+ +L +   DTG   F P+ + + TID GNP+ 
Sbjct: 189 WFTLTGVQGHSAYPHRARNPLPAMARLMDRLASHQLDTGTAHFDPSTLAVVTIDTGNPAT 248

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS-PVFLTH 307
           NVIPAQ + + NIRFND  +   L + +++ L +   +      T      VS   FLT 
Sbjct: 249 NVIPAQCRATVNIRFNDAHHSTDLIKWMQAELDRVCGD---FEITGEMRVKVSGESFLTP 305

Query: 308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQ 367
              L+ L+++++    G +P LST+GGTSDARF+KD+CPV+EFGLVG+TMH ++E   + 
Sbjct: 306 PGPLSDLVARAVAAEAGVVPTLSTTGGTSDARFVKDHCPVVEFGLVGQTMHQVDERVEVA 365

Query: 368 DLEDLTCIYENFLQNWF 384
            +  L  IY   L+++F
Sbjct: 366 QIHQLKAIYGRVLRDYF 382


>gi|37526612|ref|NP_929956.1| succinyl-diaminopimelate desuccinylase [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|81419150|sp|Q7N3J4|DAPE_PHOLL RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|36786044|emb|CAE15096.1| Succinyl-diaminopimelate desuccinylase (SDAP) [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 375

 Score =  296 bits (758), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 160/384 (41%), Positives = 224/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT   +E   QLI+ PS++P D G   I++  L+ +GF+IE   F   N     N +A  
Sbjct: 1   MTCPVIELAQQLIRQPSISPDDKGCQDIMIAHLQTIGFTIERMPFGDTN-----NFWAYR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   P L FAGH DVVP GD + W YPPF  TI  G +YGRG  DMKGS+A  I A  RF
Sbjct: 56  GI-GPTLAFAGHTDVVPAGDESQWEYPPFEPTIRNGMLYGRGAADMKGSLAAMIVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  + N  G ++ LIT DEE  A +GT K++  +  + E+ D C++GEP+  H +GD +K
Sbjct: 115 VAAHPNHNGRLAFLITSDEEAKATHGTVKVVEALMSRNERLDYCLIGEPSSQHRLGDMVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +T+HG QGHVAYPHL +NPI  ++P L  L N  +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTANLTVHGIQGHVAYPHLADNPIHRVLPALQTLVNTHWDEGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP  V++ FN RF+    +  ++E++ + L         L++T+ +   
Sbjct: 235 NIHAGTGSHNVIPGNVQVQFNFRFSTELTDSQIREQVETILKNH-----NLNYTIEWILA 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   +L + + +SI    G  P LSTSGGTSD RFI      V+E G +  T+H
Sbjct: 290 GQP-FLTAKGELVNAVIQSIDQYCGYQPELSTSGGTSDGRFIAQMGAQVVELGPLNSTIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE+ S  DL+ L+ IY+  ++ 
Sbjct: 349 KVNESVSAADLQQLSRIYQRVMEQ 372


>gi|11992024|gb|AAG42411.1|AF300471_14 succinyl-diaminopimelate desuccinylase [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 376

 Score =  296 bits (758), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 162/384 (42%), Positives = 228/384 (59%), Gaps = 11/384 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           + P  ++   +LI C SVTP D GA  I+ + LK  GF++            V NL A  
Sbjct: 3   IAPXPVDLAARLIACKSVTPSDDGAMNIMADALKSAGFTVHLLPKVEAPDGPVTNLIAIR 62

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   PHL +AGH DVVP G    W+  PF+ TI +G + GRG VDMK S+A FIAA +R+
Sbjct: 63  GEGYPHLAYAGHSDVVPAG--QGWSSDPFTPTIKDGYLVGRGAVDMKSSVAAFIAAASRY 120

Query: 121 IPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
               ++ G++SLLITGDEEGPA  GT  ++ W+ ++  K D C+VGEPT    +GDT+K 
Sbjct: 121 T---EHKGTLSLLITGDEEGPATFGTPAIIEWLNEQSIKPDYCLVGEPTSVERLGDTVKN 177

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGS++  I + G QGHVAYP    NPI  L  ++  L +   D G+  F P+N+E+T+
Sbjct: 178 GRRGSVNMWIEVEGIQGHVAYPDRACNPIPVLARIISDLESWVLDKGDQWFQPSNLEVTS 237

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV 300
           I+  N + NVIPA  K   NIRFN L     L + ++ R +  I    ++   +   +  
Sbjct: 238 IECDNKATNVIPALAKAQLNIRFNALHKGAELVDSLKKR-VAAIDPKARVKAAISGEA-- 294

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL 360
              F+T +  LT  +S +I   TG  P LSTSGGTSDARF+   CPV+EFGLV  TMH +
Sbjct: 295 ---FVTEEGVLTDTISAAIAKNTGITPSLSTSGGTSDARFLTKLCPVVEFGLVNATMHKV 351

Query: 361 NENASLQDLEDLTCIYENFLQNWF 384
           +E AS++D+  L+ I E+ ++++ 
Sbjct: 352 DEKASVEDIRQLSRIDEDIIKSFL 375


>gi|325132686|gb|EGC55370.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           M6190]
 gi|325138542|gb|EGC61105.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           ES14902]
          Length = 381

 Score =  296 bits (757), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 167/378 (44%), Positives = 223/378 (58%), Gaps = 15/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE   +LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R GT+AP
Sbjct: 7   LELAKELISRPSVTPDDQNCQKLLAERLHKIGFAAEELHFGD-----TKNIWLRRGTKAP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF     +G++YGRG  DMK SIACF+ A  RF+ ++ 
Sbjct: 62  VVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACERFVAEHP 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD IK GRRG
Sbjct: 122 DHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMIKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 182 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNKYFPPTSFQISNINGG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 242 TGATNVIPGELSVKFNFRFSTESTEAGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLT   KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 295 FLTQAGKLTDVARAAIAETCGIEAELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINE 354

Query: 363 NASLQDLEDLTCIYENFL 380
           N  L D+  L+ +YE  L
Sbjct: 355 NVRLDDIPKLSAVYEGIL 372


>gi|325205722|gb|ADZ01175.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           M04-240196]
          Length = 381

 Score =  296 bits (757), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 167/378 (44%), Positives = 223/378 (58%), Gaps = 15/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE   +LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R GT+AP
Sbjct: 7   LELAKELISRPSVTPDDQNCQKLLAERLHKIGFAAEELHFGD-----TKNIWLRRGTKAP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF     +G++YGRG  DMK SIACF+ A  RF+ ++ 
Sbjct: 62  VVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACERFVAEHP 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD IK GRRG
Sbjct: 122 DHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMIKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 182 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNKYFPPTSFQISNINGG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 242 TGATNVIPGELSVKFNFRFSTESTEAGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLTH  KLT +   +I    G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 295 FLTHAGKLTDVARAAIAEICGVETELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINE 354

Query: 363 NASLQDLEDLTCIYENFL 380
           N  L D+  L+ +YE  L
Sbjct: 355 NVRLNDIPKLSAVYEGIL 372


>gi|187477918|ref|YP_785942.1| succinyl-diaminopimelate desuccinylase [Bordetella avium 197N]
 gi|123515305|sp|Q2L2J6|DAPE_BORA1 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|115422504|emb|CAJ49029.1| succinyl-diaminopimelate desuccinylase [Bordetella avium 197N]
          Length = 377

 Score =  296 bits (757), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 166/383 (43%), Positives = 219/383 (57%), Gaps = 13/383 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           L+ +  LI  PSVTPQD     +L   L  +GF  E     T     V NL+AR GT+ P
Sbjct: 5   LDLVRDLIARPSVTPQDKDCQQMLAQRLARIGFQCE-----TIARGGVTNLWARRGTQGP 59

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY- 124
            ++FAGH DVVPPG    W   PF  T  +G +YGRG  DMK SIA F+ AV  F+  + 
Sbjct: 60  LVVFAGHTDVVPPGPREKWDSDPFVPTERDGYLYGRGASDMKSSIAAFVVAVEEFVAAHP 119

Query: 125 KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           ++ GS++ L+T DEEGPAI+GT  +   ++ +GEK D CIVGEPT  H +GD  K GRRG
Sbjct: 120 QHEGSLAFLLTSDEEGPAIDGTVIVCDALQARGEKLDYCIVGEPTSTHELGDVCKNGRRG 179

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SL G +T+ G QGHVAYPHL  NP+    P L +L  I +D GN  F PT  +I+ ++ G
Sbjct: 180 SLGGTLTVKGIQGHVAYPHLARNPVHQFAPALAELVGIEWDKGNEYFPPTTFQISNLNSG 239

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
             + NV+PA+  + FN RF+     ++LK  +   L +       L + + +     P F
Sbjct: 240 TGATNVVPAEAIVEFNCRFSTASTPESLKARVHEVLDRH-----GLEYDLEWDLGGEP-F 293

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMHALNEN 363
           LT    LT  LS +I   TG  P LST+GGTSD RFI   CP VIEFG    T+H +NE 
Sbjct: 294 LTARGSLTDALSSAIQAETGLTPELSTTGGTSDGRFIAKICPQVIEFGPTNATIHKINER 353

Query: 364 ASLQDLEDLTCIYENFLQNWFIT 386
            +L  L+ L  IY   L+N  + 
Sbjct: 354 VALDCLDPLKNIYRRTLENLLLA 376


>gi|308389674|gb|ADO31994.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           alpha710]
 gi|325130601|gb|EGC53347.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           OX99.30304]
 gi|325136577|gb|EGC59178.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           M0579]
 gi|325144813|gb|EGC67103.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           M01-240013]
 gi|325201780|gb|ADY97234.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           M01-240149]
 gi|325208468|gb|ADZ03920.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           NZ-05/33]
          Length = 381

 Score =  295 bits (756), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 167/378 (44%), Positives = 223/378 (58%), Gaps = 15/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE   +LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R GT+AP
Sbjct: 7   LELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGD-----TKNIWLRRGTKAP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF     +G++YGRG  DMK SIACF+ A  RF+ ++ 
Sbjct: 62  VVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACERFVAEHP 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD IK GRRG
Sbjct: 122 DHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMIKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 182 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNKYFPPTSFQISNINGG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 242 TGATNVIPGELSVKFNFRFSTESTEAGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLTH  KLT +   +I    G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 295 FLTHAGKLTDVARAAIAEICGVETELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINE 354

Query: 363 NASLQDLEDLTCIYENFL 380
           N  L D+  L+ +YE  L
Sbjct: 355 NVRLNDIPKLSAVYEGIL 372


>gi|241759228|ref|ZP_04757334.1| succinyl-diaminopimelate desuccinylase [Neisseria flavescens SK114]
 gi|241320364|gb|EER56661.1| succinyl-diaminopimelate desuccinylase [Neisseria flavescens SK114]
          Length = 377

 Score =  295 bits (756), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 166/379 (43%), Positives = 224/379 (59%), Gaps = 15/379 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE   +LI  PSVTP D     +L   L+ +GF++EE  F        KN++ R G +AP
Sbjct: 7   LELAKELISRPSVTPDDQNCQQLLAERLQKIGFAVEELHF-----GDTKNVWLRRGAQAP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
              FAGH DVVP G    W   PF  T  EG++YGRG  DMK SIACF+ A  RF  +  
Sbjct: 62  VFCFAGHTDVVPAGPVRKWDSSPFEPTEREGRLYGRGAADMKTSIACFVTACERFAAENP 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GD +K GRRG
Sbjct: 122 DHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVDKLGDMLKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 182 SLSGNLTVKGKQGHIAYPHLAINPVHTFSPALLELTQEVWDEGNEYFPPTSFQISNINGG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E+ LK+ + + L K G+Q      + + +S    P 
Sbjct: 242 TGATNVIPGELNVKFNFRFSTQSTEEGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLT   KLT +  ++I    G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 295 FLTQAGKLTDVAREAIAEICGVEAELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINE 354

Query: 363 NASLQDLEDLTCIYENFLQ 381
           N  L D+  L+ +YE  L+
Sbjct: 355 NVRLDDIPKLSAVYEGMLK 373


>gi|83647924|ref|YP_436359.1| succinyl-diaminopimelate desuccinylase [Hahella chejuensis KCTC
           2396]
 gi|123531335|sp|Q2SBP0|DAPE_HAHCH RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|83635967|gb|ABC31934.1| succinyl-diaminopimelate desuccinylase [Hahella chejuensis KCTC
           2396]
          Length = 383

 Score =  295 bits (756), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 161/386 (41%), Positives = 228/386 (59%), Gaps = 13/386 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE  ++LIK PSVTP D G   +L   L+ +GF I +  F       V+N +AR G++AP
Sbjct: 9   LELAVELIKRPSVTPHDAGCQELLSQRLQTIGFEITDLPFGE-----VQNFWARRGSQAP 63

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            ++FAGH DVVP G    W +PPF+A + +G ++GRG  DMKGS+A F+ A  RF+ K+ 
Sbjct: 64  LVVFAGHTDVVPTGPEEKWEHPPFAAEVKDGVLHGRGAADMKGSLAAFMTACERFVKKHP 123

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           N  GSI  LIT DEEG A+NGT K++ ++  KGE  D CIVGEP+  H +GD IK GRRG
Sbjct: 124 NHRGSIGWLITSDEEGHAVNGTVKVVEYLVDKGEVIDWCIVGEPSSTHTVGDVIKNGRRG 183

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           S+   + + G QGHVAYPHL +NPI    P L +L N  +D GN  F  T+++I+ I+ G
Sbjct: 184 SIGATLIVKGVQGHVAYPHLADNPIHKAAPALAELANEKWDEGNAFFPATSLQISNINGG 243

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
             + NVIP ++ + FN+RF+   N   +K+   + L K       L + + +     P F
Sbjct: 244 TGATNVIPGELNIMFNLRFSTELNADVIKQRSEAILQK-----HGLDYDIEWRLYGEP-F 297

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNEN 363
           LT    L     K+I +  G+   LSTSGGTSD RFI      V+E G    T+H +NE 
Sbjct: 298 LTSKGPLIEATQKAIKHVRGSDTTLSTSGGTSDGRFIAPTGAQVVELGPCNATIHRINEQ 357

Query: 364 ASLQDLEDLTCIYENFLQNWFITPSQ 389
             + +++ L+ IYE+ L+   +  S+
Sbjct: 358 VLVSEIDQLSSIYEHILEELLVVGSE 383


>gi|325142715|gb|EGC65094.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           961-5945]
          Length = 381

 Score =  295 bits (755), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 167/378 (44%), Positives = 223/378 (58%), Gaps = 15/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE   +LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R GT+AP
Sbjct: 7   LELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGD-----TKNIWLRRGTKAP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF     +G++YGRG  DMK SIACF+ A  RF+ ++ 
Sbjct: 62  VVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACERFVAEHP 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD IK GRRG
Sbjct: 122 DHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMIKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 182 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 242 TGATNVIPGELSVKFNFRFSTESTEAGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLT   KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 295 FLTQAGKLTDVARAAIAETCGIEAELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINE 354

Query: 363 NASLQDLEDLTCIYENFL 380
           N  L D+  L+ +YE  L
Sbjct: 355 NVRLDDIPKLSAVYEGIL 372


>gi|121635201|ref|YP_975446.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           FAM18]
 gi|238064802|sp|A1KUW7|DAPE_NEIMF RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|120866907|emb|CAM10666.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           FAM18]
          Length = 381

 Score =  295 bits (755), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 167/378 (44%), Positives = 223/378 (58%), Gaps = 15/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE   +LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R GT+AP
Sbjct: 7   LELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGD-----TKNIWLRRGTKAP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF     +G++YGRG  DMK SIACF+ A  RF+ ++ 
Sbjct: 62  VVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACERFVAEHP 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD IK GRRG
Sbjct: 122 DHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMIKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 182 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 242 TGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLT   KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 295 FLTQAGKLTDVARAAIAETCGIEAELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINE 354

Query: 363 NASLQDLEDLTCIYENFL 380
           N  L D+  L+ +YE  L
Sbjct: 355 NVRLDDIPKLSAVYEGIL 372


>gi|298369143|ref|ZP_06980461.1| succinyl-diaminopimelate desuccinylase [Neisseria sp. oral taxon
           014 str. F0314]
 gi|298283146|gb|EFI24633.1| succinyl-diaminopimelate desuccinylase [Neisseria sp. oral taxon
           014 str. F0314]
          Length = 381

 Score =  295 bits (755), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 168/378 (44%), Positives = 223/378 (58%), Gaps = 15/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE    LI   SVTP D     +L   L  +GF+ EE  F        KN++ R GT+AP
Sbjct: 7   LELAKALISRSSVTPDDRDCQKLLAERLHKIGFAAEELHFGD-----TKNIWLRRGTQAP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK SIACF+ A  RF+ ++ 
Sbjct: 62  VVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTSIACFVTACERFVVEHP 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD IK GRRG
Sbjct: 122 DHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMIKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 182 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 242 TGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLTH  KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 295 FLTHAGKLTDVARAAISETCGVETELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINE 354

Query: 363 NASLQDLEDLTCIYENFL 380
           N  L D+  L+ +YE  L
Sbjct: 355 NVRLDDIPKLSAVYEGIL 372


>gi|297183962|gb|ADI20082.1| acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase
           and related deacylases [uncultured alpha proteobacterium
           EB080_L06A09]
          Length = 377

 Score =  295 bits (755), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 168/387 (43%), Positives = 227/387 (58%), Gaps = 14/387 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT D +     LI+C SVTP++ GA  +L   L   GF     D       +V NL+AR+
Sbjct: 1   MTIDPVNLTADLIRCESVTPKEAGALVLLEELLAKAGFECNRVD-----RGLVSNLFARW 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT    L F GH DVVP G  + W+  PF A I +G +YGRG  DMK  +A F AA   F
Sbjct: 56  GT-GKTLGFNGHTDVVPIGSLDDWSVDPFGAEIKDGFLYGRGSTDMKSGVAAFAAAAIDF 114

Query: 121 IPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
           +      GSI L ITGDEEG A +GT  +L W+    E  + CIVGEPTC   +G+ +KI
Sbjct: 115 VENNPAGGSIVLAITGDEEGQAKDGTLALLDWMNDNNETINHCIVGEPTCPENMGEMMKI 174

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGS++   T+ G QGH AYPH  +NP+  +  L+  LT+   D G+  F P+ + +TT
Sbjct: 175 GRRGSMTAYFTVRGIQGHSAYPHRAKNPLPVMAELICDLTSFELDQGSEHFDPSTLAVTT 234

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQN--VPKLSHTVHFSS 298
           ID GN + NVIPA+ + + NIRFND+   + L     S  +K + N    K    ++   
Sbjct: 235 IDTGNLANNVIPAECRATVNIRFNDMHTSEEL-----SVWLKEVTNKIASKSDVEINMEI 289

Query: 299 PVS-PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTM 357
            VS   F+T     + L+S S+Y+ TG  P  STSGGTSDARF+KD+CPV+EFGLVG+TM
Sbjct: 290 QVSGESFITALGSFSDLVSNSVYSETGIYPQASTSGGTSDARFVKDHCPVVEFGLVGKTM 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWF 384
           H ++E  S+  +  L  IY N ++N+F
Sbjct: 350 HQVDERVSVNHIHQLKAIYANIIKNYF 376


>gi|39655033|pdb|1VGY|A Chain A, Crystal Structure Of Succinyl Diaminopimelate
           Desuccinylase
 gi|39655034|pdb|1VGY|B Chain B, Crystal Structure Of Succinyl Diaminopimelate
           Desuccinylase
          Length = 393

 Score =  295 bits (754), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 167/378 (44%), Positives = 221/378 (58%), Gaps = 15/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE   +LI  PSVTP D     +    L  +GF+ EE  F        KN++ R GT+AP
Sbjct: 9   LELAKELISRPSVTPDDRDCQKLXAERLHKIGFAAEEXHFGN-----TKNIWLRRGTKAP 63

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF     +G++YGRG  D K SIACF+ A  RF+ K+ 
Sbjct: 64  VVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADXKTSIACFVTACERFVAKHP 123

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           N  GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD IK GRRG
Sbjct: 124 NHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDXIKNGRRG 183

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 184 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 243

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 244 TGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 296

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLT   KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 297 FLTQAGKLTDVARAAIAETCGIEAELSTTGGTSDGRFIKAXAQELIELGPSNATIHQINE 356

Query: 363 NASLQDLEDLTCIYENFL 380
           N  L D+  L+ +YE  L
Sbjct: 357 NVRLNDIPKLSAVYEGIL 374


>gi|74317289|ref|YP_315029.1| succinyl-diaminopimelate desuccinylase [Thiobacillus denitrificans
           ATCC 25259]
 gi|123611919|sp|Q3SJE0|DAPE_THIDA RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|74056784|gb|AAZ97224.1| succinyl-diaminopimelate desuccinylase [Thiobacillus denitrificans
           ATCC 25259]
          Length = 392

 Score =  295 bits (754), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 159/383 (41%), Positives = 223/383 (58%), Gaps = 13/383 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           +  + L   ++L+K  SVTP D G   ++   L+ LGF IE           V NL+AR 
Sbjct: 11  LASETLALAVELLKRRSVTPDDAGCHDLIAARLQALGFHIERHRHND-----VDNLWARR 65

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT +P + FAGH DVVPPG    W   PF  T+ +GK+Y RG  DMK S A F+ A  RF
Sbjct: 66  GTASPVVCFAGHTDVVPPGPLEQWLSDPFEPTLRDGKLYARGAADMKTSDAAFVTATERF 125

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + +  +  GSI+ L+T DEEGPA +GT +++  ++ +GE  D CIVGEPT     GDTIK
Sbjct: 126 LARRPDHPGSIAFLLTSDEEGPATDGTVRVVEALKARGELLDYCIVGEPTSAAEFGDTIK 185

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSLSG + + G QGH+AYPHL +NPI    P + +L    +D GN+ F PT  +I+
Sbjct: 186 NGRRGSLSGTLRVKGVQGHIAYPHLAKNPIHLAAPAIAELAETMWDEGNSYFPPTTWQIS 245

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G    NVIP  V++ FN RF+     + L + +       I +   L + + ++  
Sbjct: 246 NIHAGTGVTNVIPGMVEIQFNFRFSTASTAEGLMDAVNE-----ILDSHGLDYEIDWNLS 300

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMH 358
             P FLT    L   LS++++  TG  P LST+GGTSD RFI D C  V+EFG +  ++H
Sbjct: 301 GKP-FLTPRGALCDRLSEAVHEVTGLTPELSTTGGTSDGRFIADICREVVEFGPLNMSIH 359

Query: 359 ALNENASLQDLEDLTCIYENFLQ 381
            LNE+ +L+++E L  +YE  L+
Sbjct: 360 KLNEHVALENVEQLAAVYEKALE 382


>gi|89067294|ref|ZP_01154807.1| succinyl-diaminopimelate desuccinylase [Oceanicola granulosus
           HTCC2516]
 gi|89046863|gb|EAR52917.1| succinyl-diaminopimelate desuccinylase [Oceanicola granulosus
           HTCC2516]
          Length = 382

 Score =  294 bits (753), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 160/382 (41%), Positives = 223/382 (58%), Gaps = 23/382 (6%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE--APHLMF 69
           L++CPSVTP++GGA  +L   L   GF+    D   +N +   NL+AR+G +  A    F
Sbjct: 14  LVRCPSVTPEEGGALVLLEELLSAAGFACTRVD---RNGT--PNLFARWGEKGAAKSFGF 68

Query: 70  AGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGS 129
            GH DVVP GD   W   PF   I++G ++GRG VDMK  +A F AA A F+      G+
Sbjct: 69  NGHTDVVPVGDHAAWRVDPFGGEISDGILWGRGAVDMKSGVAAFAAAAADFVRDTPPDGA 128

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I L ITGDEEG + +GT  +L W+ + GE    C+VGEPTC   +G+ IKIGRRGSLS  
Sbjct: 129 ILLAITGDEEGGSADGTVALLDWMARAGEAMSVCLVGEPTCPETMGEMIKIGRRGSLSAF 188

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +T+ G QGH AYPH  +NP+  +  L+ +L +   D G   F P+ + + TID GN + N
Sbjct: 189 VTVTGVQGHSAYPHRAKNPLPAMARLMDRLASAALDDGTAHFDPSTLAVVTIDTGNGATN 248

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-------GIQNVPKLSHTVHFSSPVSP 302
           VIPA+ + + NIRFND  +  +L   + +            I  V K+S           
Sbjct: 249 VIPARSRATVNIRFNDRHSGDSLTAWLEAEAADVAEAFDVAIDVVVKVS---------GE 299

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNE 362
            FLT    L+ L++ ++   TG  P+LST+GGTSDARF+KD+CPV+EFGLVG+TMH ++E
Sbjct: 300 AFLTPPGALSDLVAGAVAAETGVTPVLSTTGGTSDARFVKDHCPVVEFGLVGQTMHEVDE 359

Query: 363 NASLQDLEDLTCIYENFLQNWF 384
              +  +  L  IY   L ++F
Sbjct: 360 RVPVAQIGQLKGIYRRILADYF 381


>gi|262371776|ref|ZP_06065055.1| succinyl-diaminopimelate desuccinylase [Acinetobacter junii SH205]
 gi|262311801|gb|EEY92886.1| succinyl-diaminopimelate desuccinylase [Acinetobacter junii SH205]
          Length = 378

 Score =  294 bits (752), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 163/381 (42%), Positives = 231/381 (60%), Gaps = 13/381 (3%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D LE  +QL++ PSVTP D     I+ + L+  GF IE   F+      V NL+AR G E
Sbjct: 6   DTLELSLQLLRQPSVTPVDHDCQKIMADRLEKAGFKIENMRFED-----VDNLWARRGRE 60

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            P   FAGH DVVP G  + W   PF  +I +GK+YGRG  DMK ++A  + A  RF+ K
Sbjct: 61  QPVFCFAGHTDVVPTGHLDAWNSDPFLPSIRDGKLYGRGSADMKTALAAMVVASERFVAK 120

Query: 124 Y-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
           + K+ GSI+ LIT DEEGP+INGT K++  +E + EK   C+VGEP+  H +GD +K GR
Sbjct: 121 HPKHKGSIAFLITSDEEGPSINGTVKVVETLEARNEKMTWCLVGEPSSTHQLGDIVKNGR 180

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSL+G +TIHGKQGHVAYPHL +NPI      +++L    +D GN  F  T+ +I+ I 
Sbjct: 181 RGSLNGVLTIHGKQGHVAYPHLAQNPIHLASKAINELCETVWDNGNEYFPATSFQISNIH 240

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
            G  + NV+P  +K++FN R++     + LK+ +   L K      +L++ + ++    P
Sbjct: 241 AGTGATNVVPGTLKVTFNFRYSTEVTAEILKQRVIETLDKH-----QLTYDIQWTLSGLP 295

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALN 361
            FLT   +L +    +I N TG    LSTSGGTSD RFI      V+E G++  T+H +N
Sbjct: 296 -FLTPVGELVNAAKTAIKNVTGIETELSTSGGTSDGRFIAPTGAQVLELGVLNATIHQIN 354

Query: 362 ENASLQDLEDLTCIYENFLQN 382
           E+ ++ +L+ LT IYE  L+N
Sbjct: 355 EHVNVDELDPLTDIYEQILEN 375


>gi|110677593|ref|YP_680600.1| succinyl-diaminopimelate desuccinylase [Roseobacter denitrificans
           OCh 114]
 gi|123362399|sp|Q16DM9|DAPE_ROSDO RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|109453709|gb|ABG29914.1| putative succinyl-diaminopimelate desuccinylase [Roseobacter
           denitrificans OCh 114]
          Length = 381

 Score =  294 bits (752), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 164/378 (43%), Positives = 231/378 (61%), Gaps = 13/378 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA--PHLM 68
            L++C SVTP D GA  IL + L   GF     D    +   ++NL+AR+G +       
Sbjct: 12  DLVRCASVTPADEGALDILHDVLSDAGF-----DCAWADRGGIRNLFARWGRKGHPKTFG 66

Query: 69  FAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFG 128
           F GH DVVP G+ + W+ PPF A + +G +YGRG  DMK  +A F AA   F+      G
Sbjct: 67  FNGHTDVVPIGNADDWSMPPFGAEVKDGIMYGRGTTDMKSGVAAFAAAAVDFVRDTPPDG 126

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           +I L ITGDEEG A +GT  +L+++  +GE+  AC+VGEPTC   +G+ IKIGRRGS++ 
Sbjct: 127 AIVLAITGDEEGDATDGTTALLAYMAAQGEQMSACLVGEPTCPDRMGEMIKIGRRGSMTA 186

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
            IT  GKQGH AYPH   NP+  L+ L+ +L +   D G   F P+ + I T+D GNP+ 
Sbjct: 187 WITFIGKQGHAAYPHRACNPLPALMRLMDRLASHKLDEGTEFFDPSTLAIVTVDTGNPAT 246

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRL--IKGIQNVPKLSHTVHFSSPVSPVFLT 306
           NVIPA    + NIRFND  +  +L E I++ L  I+G   V ++   +  S      FLT
Sbjct: 247 NVIPASCSGTVNIRFNDAHSGASLTEWIKTELSRIEGEFGV-QIDLRIKIS---GESFLT 302

Query: 307 HDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASL 366
               L++L+SK++   TG  P+LST+GGTSDARF+KD+CPV+EFGLVG++MH ++E+   
Sbjct: 303 PPGPLSALVSKAVKAQTGIEPVLSTTGGTSDARFVKDHCPVVEFGLVGQSMHQVDEHVKT 362

Query: 367 QDLEDLTCIYENFLQNWF 384
             + +L  IY   L ++F
Sbjct: 363 DHIVELKAIYSRILTDYF 380


>gi|84684540|ref|ZP_01012441.1| succinyl-diaminopimelate desuccinylase [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84667519|gb|EAQ13988.1| succinyl-diaminopimelate desuccinylase [Rhodobacterales bacterium
           HTCC2654]
          Length = 381

 Score =  294 bits (752), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 155/378 (41%), Positives = 223/378 (58%), Gaps = 13/378 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLM-- 68
           +LI+CPSVTP++GGA   L + L+  GF     D        + NL+AR G +   L   
Sbjct: 12  RLIECPSVTPEEGGALVYLADLLEGAGFVCTRVD-----RGGIANLFARLGPKGARLTLG 66

Query: 69  FAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFG 128
           F GH DVVP GD   WT  PF A   +G ++GRG  DMK  +A ++AA         +  
Sbjct: 67  FNGHTDVVPVGDTGAWTVQPFGAEERDGHLWGRGATDMKSGVAAWVAAAMDATRDLPDDC 126

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           ++ L ITGDEEG A +GTK +L W+++ GE  DAC+VGEPTC   +G+ +KIGRRGS++ 
Sbjct: 127 ALILAITGDEEGDATDGTKALLDWMDQNGEAMDACVVGEPTCPDTMGEMMKIGRRGSMTA 186

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
             T  G QGH AYPH  +NP+  L  L+  L     D G   F  + + +TT DVGNP+ 
Sbjct: 187 FFTARGVQGHAAYPHRAKNPVPALARLVSDLDAHVLDEGTAHFDASTLAVTTFDVGNPAT 246

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRL--IKGIQNVPKLSHTVHFSSPVSPVFLT 306
           NVIPA+ K + NIRFND      L + +++++  + G   + ++   V  S      F+T
Sbjct: 247 NVIPAEAKATVNIRFNDAHTSADLTDWLQAQMDRVAGETGI-EIGMVVKVS---GESFVT 302

Query: 307 HDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASL 366
               L+  ++ ++   TG  P++STSGGTSDARF+KD+CPV+EFGLVG+TMH ++E   +
Sbjct: 303 PPGPLSDTVAAAVEAETGLRPVMSTSGGTSDARFVKDHCPVVEFGLVGKTMHQVDERVEI 362

Query: 367 QDLEDLTCIYENFLQNWF 384
             +  L  IY   ++++F
Sbjct: 363 AQIGQLKSIYGRIIRDFF 380


>gi|261400708|ref|ZP_05986833.1| succinyl-diaminopimelate desuccinylase [Neisseria lactamica ATCC
           23970]
 gi|269209465|gb|EEZ75920.1| succinyl-diaminopimelate desuccinylase [Neisseria lactamica ATCC
           23970]
          Length = 381

 Score =  294 bits (752), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 167/378 (44%), Positives = 221/378 (58%), Gaps = 15/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE    LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R GT+AP
Sbjct: 7   LELAKALISRPSVTPDDQNCQKLLAERLHKIGFAAEELHFGD-----TKNIWLRRGTKAP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF     +G++YGRG  DMK  IACF+ A  RF+ ++ 
Sbjct: 62  VVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTGIACFVTACERFVAEHP 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD IK GRRG
Sbjct: 122 DHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMIKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NPI    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 182 SLSGNLTVKGKQGHIAYPHLAVNPIHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 242 TGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLT   KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 295 FLTQAGKLTDVARAAIAETCGVEAELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINE 354

Query: 363 NASLQDLEDLTCIYENFL 380
           N  L D+  L+ +YE  L
Sbjct: 355 NVRLDDIPKLSAVYEGIL 372


>gi|85705193|ref|ZP_01036293.1| succinyl-diaminopimelate desuccinylase [Roseovarius sp. 217]
 gi|85670515|gb|EAQ25376.1| succinyl-diaminopimelate desuccinylase [Roseovarius sp. 217]
          Length = 383

 Score =  294 bits (752), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 158/384 (41%), Positives = 224/384 (58%), Gaps = 11/384 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D       LI+C SVTP++GGA  +L   L   GF+    D        + NL+AR+G +
Sbjct: 7   DAARLTADLIRCASVTPEEGGALQLLEQVLTGAGFTCVRVD-----RGGIANLFARWGEK 61

Query: 64  --APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
             A    F GH DVVP GD   W+ PPF A    G ++GRG  DMK ++A F+AA    +
Sbjct: 62  GAARAFGFNGHTDVVPVGDVEAWSVPPFGAVEKAGMLWGRGATDMKSAVAAFVAAAVDMV 121

Query: 122 PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
                 G+I + ITGDEEG A++GT  +L W+    E+  AC+VGEPTC   +G+ IKIG
Sbjct: 122 RDAPPKGAIIITITGDEEGDAVDGTVALLDWMAANDERMTACLVGEPTCPERMGEMIKIG 181

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSLS    + G QGH AYPH  +NP+  +  L+ +L +   D+G   F P+ + + TI
Sbjct: 182 RRGSLSAWFALTGVQGHSAYPHRAKNPLPAMARLMDRLASHTLDSGTAHFDPSTLAVVTI 241

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
           D GNP+ NVIPA  + + NIRFND    ++L   +++ L  G+ +  +          VS
Sbjct: 242 DTGNPATNVIPASCRATVNIRFNDAHTSQSLIAWMQAEL-DGVSD--EFGVACEMRVKVS 298

Query: 302 -PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL 360
              FLT    L+ L+++++   TG  P+LST+GGTSDARF+KD+CPV+EFGLVG+TMH +
Sbjct: 299 GESFLTPPGPLSDLVTRAVEAETGVKPVLSTTGGTSDARFVKDHCPVVEFGLVGQTMHQV 358

Query: 361 NENASLQDLEDLTCIYENFLQNWF 384
           +E   +  +  L  IY   L ++F
Sbjct: 359 DERVEVAQIHQLKAIYARILSDYF 382


>gi|304387061|ref|ZP_07369313.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis ATCC
           13091]
 gi|304338860|gb|EFM04962.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis ATCC
           13091]
          Length = 398

 Score =  294 bits (752), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 167/378 (44%), Positives = 222/378 (58%), Gaps = 15/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE    LI  PSVTP D     +L   L  +GF+ E   F        KN++ R GT+AP
Sbjct: 24  LELAKALISRPSVTPDDQNCQKLLAERLHKIGFAAEALHFGD-----TKNIWLRRGTKAP 78

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK SIACF+ A  RF+ ++ 
Sbjct: 79  VVCFAGHTDVVPTGPIEKWDSPPFEPTERDGRLYGRGAADMKTSIACFVTACERFVAEHP 138

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD IK GRRG
Sbjct: 139 DHQGSIALLITSDEEGDALDGTTKVVDILKARDELIDYCIVGEPTTVDKLGDMIKNGRRG 198

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 199 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 258

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 259 TGATNVIPGELSVKFNFRFSTESTEAGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 311

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLTH  KLT +   +I    G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 312 FLTHAGKLTDVARAAIAEICGIEAELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINE 371

Query: 363 NASLQDLEDLTCIYENFL 380
           N  L D+  L+ +YE  L
Sbjct: 372 NVRLDDIPKLSAVYEGIL 389


>gi|325134654|gb|EGC57294.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           M13399]
          Length = 381

 Score =  294 bits (752), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 166/378 (43%), Positives = 222/378 (58%), Gaps = 15/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE   +LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R GT+AP
Sbjct: 7   LELAKELISRPSVTPDDQNCQKLLAERLHKIGFAAEELHFGD-----TKNIWLRRGTKAP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF     +G++YGRG  DMK  IACF+ A  RF+ ++ 
Sbjct: 62  VVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTGIACFVTACERFVAEHP 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD IK GRRG
Sbjct: 122 DHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMIKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 182 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNKYFPPTSFQISNINGG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 242 TGATNVIPGELSVKFNFRFSTESTEAGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLTH  KLT +   +I    G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 295 FLTHAGKLTDVARAAIAEICGVETELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINE 354

Query: 363 NASLQDLEDLTCIYENFL 380
           N  L D+  L+ +YE  L
Sbjct: 355 NVRLNDIPKLSAVYEGIL 372


>gi|253996071|ref|YP_003048135.1| succinyl-diaminopimelate desuccinylase [Methylotenera mobilis JLW8]
 gi|253982750|gb|ACT47608.1| succinyl-diaminopimelate desuccinylase [Methylotenera mobilis JLW8]
          Length = 379

 Score =  294 bits (752), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 164/375 (43%), Positives = 226/375 (60%), Gaps = 11/375 (2%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE  I L++  S TP D G   ++++ L+ LGF IE   F       V N YAR GT AP
Sbjct: 5   LELAIDLLQRQSNTPLDAGCQELMISRLEPLGFKIERMRFGD-----VDNFYARRGTAAP 59

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            L+FAGH DVVP G  + W  PPF  TI +G +Y RG  DMK S+A FI ++  F+ +  
Sbjct: 60  FLVFAGHTDVVPTGPLDKWHTPPFEPTIKDGMLYARGAADMKTSLAAFITSIEAFVAENP 119

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           N  GSI LLIT DEEG A+NGT K++  ++ +GE  D CIVGEPT N  +GD IK GRRG
Sbjct: 120 NHQGSIGLLITSDEEGIAVNGTVKVVEALKARGELIDYCIVGEPTSNKKVGDMIKNGRRG 179

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG + + G QGH+AYPHL +NPI  + P +  +    +D GN  F PT+ +I+ ++ G
Sbjct: 180 SLSGNLVVKGIQGHIAYPHLVKNPIHLVAPAIKDMVETVWDNGNEYFPPTSWQISNMNGG 239

Query: 245 NPSKNVIPAQVKMSFNIRF-NDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
             + NV+P +V++ FN RF  +L    + ++ +RSR +  I +  +L +T+ +    SP 
Sbjct: 240 TGATNVVPGEVEILFNFRFCPELDGAGSTEQNLRSR-VHAILDKHELEYTLEWE--YSPP 296

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMHALNE 362
           ++T    L   +S +I    G  P LST+GGTSD RFI D C  VIEFG +  T+H LNE
Sbjct: 297 YITPRGNLVEAISGAIEQAYGVTPELSTTGGTSDGRFIADICKQVIEFGPLNATIHKLNE 356

Query: 363 NASLQDLEDLTCIYE 377
              + D+E L   Y+
Sbjct: 357 CVGVTDIEPLKQTYQ 371


>gi|238919136|ref|YP_002932650.1| succinyl-diaminopimelate desuccinylase [Edwardsiella ictaluri
           93-146]
 gi|238868704|gb|ACR68415.1| succinyl-diaminopimelate desuccinylase, putative [Edwardsiella
           ictaluri 93-146]
          Length = 377

 Score =  294 bits (752), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 151/374 (40%), Positives = 225/374 (60%), Gaps = 13/374 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           QLI+CPS++P D G   IL+  L+ L F IEE           +NL+A  G   P L FA
Sbjct: 12  QLIRCPSISPNDAGCQEILLARLRALDFHIEEMP-----RGDTRNLWAWRGGNGPVLAFA 66

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI-PKYKNFGS 129
           GH DVVPPGD   W +PPFS T+ +G +YGRG  DMKGS+A  + A  RF+  + ++ G 
Sbjct: 67  GHTDVVPPGDERQWRHPPFSPTLQDGMLYGRGAADMKGSLAAMVVAAERFVSARPEHRGR 126

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           ++ LIT DEE  A+NGT +++  +  +GE+ D C+VGEP+    +GD +K GRRGS++  
Sbjct: 127 LAFLITSDEEASAVNGTVRVVEALMARGERLDYCLVGEPSSERCLGDVVKNGRRGSITAN 186

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +TIHG QGHVAYPHL +NP+   +P+L +L  I +D GN  F PT+++I  I  G  S N
Sbjct: 187 LTIHGTQGHVAYPHLADNPVHRAMPMLAELIAIEWDRGNDFFPPTSLQIANIAAGTGSNN 246

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP  + + FN+RF+   + +++++ + + L +       L +T+++S    P FLT   
Sbjct: 247 VIPGDLDVQFNLRFSTESSVESIQQRVTALLERH-----GLRYTLNWSLSGLP-FLTPGG 300

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQD 368
           +L   +  ++    G  P L T+GGTSD RFI      V+E G +  T+H +NE  S  D
Sbjct: 301 ELVDAVVNAVACYGGQTPRLLTTGGTSDGRFIARMGAQVVELGPLNATIHKVNECVSAAD 360

Query: 369 LEDLTCIYENFLQN 382
           L+ L+ +Y+  ++ 
Sbjct: 361 LQSLSRMYQRIMEQ 374


>gi|307822146|ref|ZP_07652378.1| succinyl-diaminopimelate desuccinylase [Methylobacter tundripaludum
           SV96]
 gi|307736712|gb|EFO07557.1| succinyl-diaminopimelate desuccinylase [Methylobacter tundripaludum
           SV96]
          Length = 375

 Score =  293 bits (750), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 164/382 (42%), Positives = 221/382 (57%), Gaps = 13/382 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE L  LI   SVTPQD G   +L   L  LGF  E  DF+       +N++ R G   P
Sbjct: 5   LELLKDLISRESVTPQDAGCQDVLAARLTKLGFKEERLDFED-----TQNIWLRRGEAKP 59

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            L F GH DVVP G    W  PPF   I +GK+YGRG  DMKG IACFI AV RFI K+ 
Sbjct: 60  LLTFLGHTDVVPTGPLEAWVSPPFEPMIRDGKLYGRGAADMKGGIACFITAVERFIAKHP 119

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI++++T DEEG A NG  K++  +E++ EK D C+VGEP+ +  IGD I++GRRG
Sbjct: 120 DHQGSIAVMMTSDEEGIATNGVVKVVEVLEQRNEKIDWCLVGEPSSDKKIGDVIRVGRRG 179

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SL  ++TI G QGHVAYP L +NPI    P L  LT   +D GN  F PT+++++ I+ G
Sbjct: 180 SLCAKLTIAGIQGHVAYPELADNPIHTFAPALKDLTEEVWDHGNAFFPPTSLQVSNINAG 239

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
             ++N+IP  V + FN+RF    +E+T+K+  R+ L K         + + +    +P F
Sbjct: 240 TGAENIIPGSVNVQFNLRFCTELDEETIKQRTRAILDK-----YDFKYELEWRLSGNP-F 293

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNEN 363
           LT    L      +I   TG   L  T GGTSD RFI      VIE G +  ++H +NE+
Sbjct: 294 LTEPGALIDAAHAAIKTVTGFETLDDTGGGTSDGRFIAPTGAQVIELGPLNESIHKINEH 353

Query: 364 ASLQDLEDLTCIYENFLQNWFI 385
             ++DLE L+ IYE  L N  +
Sbjct: 354 VGVEDLEILSDIYEQILVNLLV 375


>gi|325128595|gb|EGC51465.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           N1568]
          Length = 381

 Score =  293 bits (750), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 166/378 (43%), Positives = 222/378 (58%), Gaps = 15/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE   +LI  PSVTP D     +L   L  +GF+ E   F        KN++ R GT+AP
Sbjct: 7   LELAKELIARPSVTPDDQNCQKLLAERLHKIGFAAEALHFGD-----TKNIWLRRGTKAP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK  IACF+ A  RF+ ++ 
Sbjct: 62  VVCFAGHTDVVPTGPIEKWDSPPFEPTERDGRLYGRGAADMKTGIACFVTACERFVAEHP 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GD IK GRRG
Sbjct: 122 DHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVDKLGDMIKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 182 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNKYFPPTSFQISNINGG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVI  ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 242 TGATNVIQGELNVKFNFRFSTESTEAGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLT   KLT +   +I    G    LST+GGTSD RFIK     +IE GL   T+H +NE
Sbjct: 295 FLTQAGKLTDVARAAIAAICGVEAELSTTGGTSDGRFIKAIAKELIELGLSNATIHQINE 354

Query: 363 NASLQDLEDLTCIYENFL 380
           N  L D+  L+ +YE  L
Sbjct: 355 NVRLNDIPKLSAVYEGIL 372


>gi|313668084|ref|YP_004048368.1| succinyl-diaminopimelate desuccinylase [Neisseria lactamica ST-640]
 gi|313005546|emb|CBN86982.1| succinyl-diaminopimelate desuccinylase [Neisseria lactamica 020-06]
          Length = 398

 Score =  293 bits (750), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 166/378 (43%), Positives = 222/378 (58%), Gaps = 15/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE    LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R GT+AP
Sbjct: 24  LELAKALISRPSVTPDDQNCQKLLAERLHKIGFAAEELHF-----GDTKNIWLRRGTKAP 78

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF     +G++YGRG  DMK  IACF+ A  RF+ ++ 
Sbjct: 79  VVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTGIACFVTACERFVAEHP 138

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD IK GRRG
Sbjct: 139 DHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMIKNGRRG 198

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG++T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 199 SLSGKLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 258

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 259 TGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 311

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLT   KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 312 FLTQAGKLTDVARAAIAETCGIEAELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINE 371

Query: 363 NASLQDLEDLTCIYENFL 380
           N  L D+  L+ +YE  L
Sbjct: 372 NVRLNDIPKLSAVYEGIL 389


>gi|119946093|ref|YP_943773.1| succinyl-diaminopimelate desuccinylase [Psychromonas ingrahamii 37]
 gi|238064780|sp|A1SXF9|DAPE_PSYIN RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|119864697|gb|ABM04174.1| succinyldiaminopimelate desuccinylase [Psychromonas ingrahamii 37]
          Length = 377

 Score =  293 bits (750), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 164/378 (43%), Positives = 234/378 (61%), Gaps = 13/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           L  L  LI   S+TP D G   +L++ L+ LGF  E   F     +   NL+AR GTE P
Sbjct: 7   LALLKDLISRRSITPSDEGCQQLLISRLEKLGFECEVMIF-----ADTTNLWARRGTEKP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
              FAGH DVVP G   +WTYPPF  T+ +G ++GRG  DMK  IA FI A+ +FI  ++
Sbjct: 62  LFCFAGHTDVVPTGPEENWTYPPFEPTVVDGFLFGRGAADMKSGIAAFIIALEQFIKAHQ 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEGP INGT +++  +E + EK D CIVGEP+    +GDTIK GRRG
Sbjct: 122 DHQGSIALLITSDEEGPFINGTVRVIETLEARNEKIDYCIVGEPSSTEHVGDTIKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SL+ ++TI+G QGHVAYPH+ ENPI   I  L +L+ + +D GN  F PT+ ++T  + G
Sbjct: 182 SLTADLTINGVQGHVAYPHMVENPIHTCIGPLTELSQMEWDKGNKYFPPTSFQVTNFNAG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
             + NV+P + ++ FN R++     +   E I +R++  +Q   KL++ + ++   SP F
Sbjct: 242 TGASNVVPGEAQIQFNFRYST----ELTAEMIIARVVAILQK-HKLNYQIKWTYNGSP-F 295

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNEN 363
           +T    LT+ +S++I+   G    LSTSGGTSDARFI      V+E G   +T+H +NE+
Sbjct: 296 ITQPGSLTNAVSEAIFAVNGLTTELSTSGGTSDARFIAPTGAQVVELGPGNKTIHKVNES 355

Query: 364 ASLQDLEDLTCIYENFLQ 381
             + DLE+L  I+   L+
Sbjct: 356 VKIADLEELVHIHRLTLE 373


>gi|269138462|ref|YP_003295162.1| succinyl-diaminopimelate desuccinylase [Edwardsiella tarda EIB202]
 gi|267984122|gb|ACY83951.1| succinyl-diaminopimelate desuccinylase [Edwardsiella tarda EIB202]
 gi|304558488|gb|ADM41152.1| N-succinyl-L,L-diaminopimelate desuccinylase [Edwardsiella tarda
           FL6-60]
          Length = 377

 Score =  293 bits (749), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 149/374 (39%), Positives = 225/374 (60%), Gaps = 13/374 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           QLI+CPS++P D G   IL+  L+ L F IEE           +NL+A  G + P L FA
Sbjct: 12  QLIRCPSISPNDAGCQDILLARLRALDFHIEEMPHGD-----TRNLWAWRGGDGPVLAFA 66

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI-PKYKNFGS 129
           GH DVVPPGD   W +PPF+ T+ +G +YGRG  DMKGS+A  + A  RF+  +  + G 
Sbjct: 67  GHTDVVPPGDERQWRHPPFTPTLQDGMLYGRGAADMKGSLAAMVVAAERFVSARPDHRGR 126

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           ++ LIT DEE  A+NGT +++  +  +GE+ D C+VGEP+    +GD +K GRRGS++ +
Sbjct: 127 LAFLITSDEEASAVNGTVRVVETLMARGERLDYCLVGEPSSEQRLGDVVKNGRRGSITAD 186

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +T+HG QGHVAYPHL +NP+    P+L +L  I +D GN  F PT+++I  I  G  S N
Sbjct: 187 LTVHGTQGHVAYPHLADNPVHRAAPMLAELVAIAWDNGNDFFPPTSLQIANIAAGTGSNN 246

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP  + + FN+RF+   + +++++ + + L +       L +T+++S    P FLT   
Sbjct: 247 VIPGDMYVQFNLRFSTESSVESIQQRVTALLDRH-----GLRYTLNWSLSGLP-FLTPGG 300

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQD 368
           +L   +  ++    G  P L T+GGTSD RFI      V+E G +  T+H +NE  S  D
Sbjct: 301 ELVDAVVNAVACYGGQTPRLLTTGGTSDGRFIARMGAQVVELGPLNATIHKVNECVSAAD 360

Query: 369 LEDLTCIYENFLQN 382
           L+ L+ +Y+  ++ 
Sbjct: 361 LQSLSRMYQRIMEQ 374


>gi|304414141|ref|ZP_07395509.1| N-succinyl-diaminopimelate deacylase [Candidatus Regiella
           insecticola LSR1]
 gi|304283355|gb|EFL91751.1| N-succinyl-diaminopimelate deacylase [Candidatus Regiella
           insecticola LSR1]
          Length = 393

 Score =  293 bits (749), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 160/384 (41%), Positives = 224/384 (58%), Gaps = 16/384 (4%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDF-QTKNTSIVKNLYAR 59
           MT   ++   QLIK PSV+P D G   IL   LK +GF+IE  +F  TKN       +  
Sbjct: 18  MTCPVIKLAKQLIKRPSVSPADEGCQEILTQRLKAIGFTIEPMNFADTKN-------FCA 70

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
           +  E   L FAGH DVVPPGD N W +PPF  TI  G +YGRG  DMKGS+A  + A  R
Sbjct: 71  WRGEGKTLAFAGHTDVVPPGDENRWDFPPFEPTIRNGMLYGRGAADMKGSLAAMVVAAER 130

Query: 120 FIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           FI    N+ G +  LIT DEE  A NGT K++  ++ + E+ D C+VGEP+ N  +GD +
Sbjct: 131 FITVNPNYIGRLVFLITSDEEAKATNGTVKVVEVLQAREERLDYCLVGEPSSNKCLGDVV 190

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGS++  ++IHG QGHVAYPHL +NPI   +P+L +L +I +D GN +F  T+M+I
Sbjct: 191 KNGRRGSMTANLSIHGVQGHVAYPHLAKNPIHWALPMLQELVSIQWDKGNVSFPSTSMQI 250

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
             I  G  S NVIP ++ + FN RF+    E  +K+ + + L +      +L++++ +  
Sbjct: 251 ANIQAGTGSNNVIPGELFVQFNFRFSTELTESMIKQRVETLLEQ-----YRLNYSIDWVV 305

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTM 357
              P FLT    L   +  ++    G  P LST+GGTSD RFI      V+E G V  T+
Sbjct: 306 SGQP-FLTEKGDLVDAVINAVRCYNGITPELSTAGGTSDGRFIALLGAQVVELGPVNETI 364

Query: 358 HALNENASLQDLEDLTCIYENFLQ 381
           H +NE     DL+ L+ IY+  ++
Sbjct: 365 HKVNECVKAADLQLLSRIYQRIME 388


>gi|325204507|gb|ADY99960.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           M01-240355]
          Length = 381

 Score =  293 bits (749), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 166/378 (43%), Positives = 222/378 (58%), Gaps = 15/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE   +LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R GT+AP
Sbjct: 7   LELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGD-----TKNIWLRRGTKAP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF     +G++YGRG  DMK SIACF+ A  RF+ ++ 
Sbjct: 62  VVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACERFVAEHP 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD IK GRRG
Sbjct: 122 DHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMIKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 182 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 242 TGATNVIPGELSVKFNFRFSTESTEAGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLT   KLT +   +I    G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 295 FLTQAGKLTDVARAAIAEICGIEAELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINE 354

Query: 363 NASLQDLEDLTCIYENFL 380
           N  L D+  L+ +YE  L
Sbjct: 355 NVRLDDIPKLSAVYEGIL 372


>gi|296313502|ref|ZP_06863443.1| succinyl-diaminopimelate desuccinylase [Neisseria polysaccharea
           ATCC 43768]
 gi|296839965|gb|EFH23903.1| succinyl-diaminopimelate desuccinylase [Neisseria polysaccharea
           ATCC 43768]
          Length = 381

 Score =  293 bits (749), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 166/378 (43%), Positives = 221/378 (58%), Gaps = 15/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE    LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R GT+AP
Sbjct: 7   LELAKALISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGD-----TKNIWLRRGTKAP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF     +G++YGRG  DMK  IACF+ A  RF+ ++ 
Sbjct: 62  VVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTGIACFVTACERFVAEHP 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD IK GRRG
Sbjct: 122 DHQGSIALLITSDEEGDALDGTTKVVDVLKARSELIDYCIVGEPTAVDKLGDMIKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 182 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPV 303
             + NVIP ++ + FN RF+    E  LK+ + + L K G+Q      + + +S    P 
Sbjct: 242 TGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDKHGVQ------YDLQWSCSGQP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLT   KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+H +NE
Sbjct: 295 FLTQAGKLTDVARAAIAETCGVETELSTTGGTSDGRFIKAIAKELIELGPSNATIHQINE 354

Query: 363 NASLQDLEDLTCIYENFL 380
           N  L D+  L+ +YE  L
Sbjct: 355 NVRLDDIPKLSAVYEGIL 372


>gi|254490425|ref|ZP_05103611.1| succinyl-diaminopimelate desuccinylase [Methylophaga thiooxidans
           DMS010]
 gi|224464169|gb|EEF80432.1| succinyl-diaminopimelate desuccinylase [Methylophaga thiooxydans
           DMS010]
          Length = 391

 Score =  292 bits (748), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 157/372 (42%), Positives = 225/372 (60%), Gaps = 13/372 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           QLI+  SVTP+D G   +L + L   GF  E   F       V NL+ R G   P + FA
Sbjct: 25  QLIRRDSVTPEDKGCQVLLSDRLAPFGFKAEHMCFDD-----VDNLWLRRGNTGPVIAFA 79

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGS 129
           GH DVVP G   +W++ PF+A + +G +YGRG  DMKGSIA  + A  RF+ K+ ++ GS
Sbjct: 80  GHTDVVPTGPVENWSHAPFNADVIDGMLYGRGAADMKGSIAAMVTACERFVKKHPEHEGS 139

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I+ LIT DEEGPA+NGT K++  ++ +GE+ D C+VGEP+    +GD +K GRRGSL+G 
Sbjct: 140 IAFLITSDEEGPAVNGTVKVVETLQSRGEEIDWCLVGEPSSTDKVGDIVKNGRRGSLNGR 199

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +T+ GKQGH+AYPHL ENPI  + P L +L ++ +D GN  F PT+ +++ ++ G    N
Sbjct: 200 LTVKGKQGHIAYPHLAENPIHLMSPALTELCSVEWDQGNADFPPTSFQVSNLNAGTGVTN 259

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP   ++ FN RF    + +   EE++ R ++ I N  +L + + +     P F T   
Sbjct: 260 VIPGTAELIFNFRF----STEVTHEELQQR-VEAILNTHQLDYELKWELSGKP-FRTASG 313

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQD 368
           +L   +  +I+  TG    LSTSGGTSD RFI      VIE G +  T+H ++E  S+ D
Sbjct: 314 ELLEAVQNAIHEVTGYPTTLSTSGGTSDGRFIAPTGTQVIELGPLNATIHQIDECVSVAD 373

Query: 369 LEDLTCIYENFL 380
           L+ L+ IYE  L
Sbjct: 374 LDTLSEIYETLL 385


>gi|260432272|ref|ZP_05786243.1| succinyl-diaminopimelate desuccinylase [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260416100|gb|EEX09359.1| succinyl-diaminopimelate desuccinylase [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 379

 Score =  292 bits (748), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 159/381 (41%), Positives = 228/381 (59%), Gaps = 19/381 (4%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE--APHLM 68
            LI+CPSVTP++GGA  +L   L   GF+    D        V NL+AR+G +  A    
Sbjct: 10  DLIRCPSVTPEEGGALVLLEEILSRAGFTCTRVD-----RGGVCNLFARWGDKGHARSFG 64

Query: 69  FAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFG 128
           F GH DVVP GD   WT PPF A I +G +YGRG  DMK  +A F+AA   F+      G
Sbjct: 65  FNGHTDVVPVGDEAAWTRPPFGAEIHDGILYGRGATDMKSGVAAFVAAAVDFVRDTPPDG 124

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           +I L ITGDEEG A++GT  +L +++ + E+   C+VGEPTC + +G+ +KIGRRGS++ 
Sbjct: 125 AIILTITGDEEGDAVDGTTALLDYMQAQDERMSVCLVGEPTCPNEMGEMMKIGRRGSMTA 184

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
              + G QGH AYPH  +NP+  L  L+ +L +   D G   F  + + + T+D GN + 
Sbjct: 185 WFEVTGVQGHSAYPHRAKNPLPALARLMDRLASHELDRGTDHFDASTLAVVTMDTGNAAT 244

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-----GIQNVPKLSHTVHFSSPVSPV 303
           NVIPAQ + + NIRFNDL    +L + ++++        G+Q   ++  +          
Sbjct: 245 NVIPAQCRGAVNIRFNDLHTGASLSDWLKAQAADVAAEFGVQIDTRIKVS-------GES 297

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           FLT    L+ L+++++   TG  P LST+GGTSDARFIKD+CPV+EFGLVGRTMH ++E+
Sbjct: 298 FLTPPGPLSDLVARAVEAETGRRPELSTTGGTSDARFIKDHCPVVEFGLVGRTMHQVDES 357

Query: 364 ASLQDLEDLTCIYENFLQNWF 384
             ++ +  L  IY   L ++F
Sbjct: 358 VPVEQIRQLKAIYARILADYF 378


>gi|269960641|ref|ZP_06175013.1| succinyl-diaminopimelate desuccinylase [Vibrio harveyi 1DA3]
 gi|269834718|gb|EEZ88805.1| succinyl-diaminopimelate desuccinylase [Vibrio harveyi 1DA3]
          Length = 378

 Score =  292 bits (748), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 158/376 (42%), Positives = 218/376 (57%), Gaps = 17/376 (4%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            LI   SVTP+D G   +++  LK LGF IE   F+        N +AR GTEAP   FA
Sbjct: 12  DLISRQSVTPEDAGCQEVMIERLKALGFEIEVMVFEDTT-----NFWARRGTEAPLFAFA 66

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI---PKYKNF 127
           GH DVVP G    W  PPF  TI +G ++GRG  DMKGS+AC + AV RFI   P +K  
Sbjct: 67  GHTDVVPAGKLEQWDTPPFEPTIIDGYLHGRGAADMKGSLACMVVAVERFIAENPDHK-- 124

Query: 128 GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLS 187
           GSI  LIT DEEGP INGT +++  + ++GE  D CIVGEP+   ++GD +K GRRGS++
Sbjct: 125 GSIGFLITSDEEGPFINGTVRVVETLMERGENIDMCIVGEPSSTEVVGDVVKNGRRGSIT 184

Query: 188 GEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPS 247
           G++T+ G QGHVAYPHL  NP+   +  +H+L    +D GN  F PT+ +I  +  G  +
Sbjct: 185 GDLTVKGTQGHVAYPHLANNPVHQSLMAIHELATTEWDQGNDYFPPTSFQIPNVSAGTGA 244

Query: 248 KNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTH 307
            NVIP +  + FN+RF+   + + + + I   L K      +L + + ++    P FLT 
Sbjct: 245 SNVIPGEFNVQFNLRFSTELSNEVIVQRITETLDK-----HELDYDLKWTFNGDP-FLTD 298

Query: 308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASL 366
              L   +  ++       P L T+GGTSD RFI      V+E G V  T+H +NE   +
Sbjct: 299 TGALLDAVVAAVDEVNSTKPALLTTGGTSDGRFIARMGGQVVELGPVNATIHKVNECVKV 358

Query: 367 QDLEDLTCIYENFLQN 382
            DLE LT +YEN L++
Sbjct: 359 DDLEKLTDMYENTLKH 374


>gi|294651358|ref|ZP_06728677.1| succinyl-diaminopimelate desuccinylase [Acinetobacter haemolyticus
           ATCC 19194]
 gi|292822760|gb|EFF81644.1| succinyl-diaminopimelate desuccinylase [Acinetobacter haemolyticus
           ATCC 19194]
          Length = 401

 Score =  292 bits (748), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 163/379 (43%), Positives = 230/379 (60%), Gaps = 13/379 (3%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D LE  +QL++ PSVTP D     I+ + L  +GF+IE+  F+      V NL+AR GTE
Sbjct: 29  DTLELSLQLLRQPSVTPVDHDCQNIMADRLAKIGFNIEKLRFED-----VDNLWARRGTE 83

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            P   FAGH DVVP G  + W   PF  TI +GK+YGRG  DMK ++A  + A  RF+ K
Sbjct: 84  NPVFCFAGHTDVVPTGHLDAWNSDPFQPTIRDGKLYGRGSADMKTALAAMVVASERFVAK 143

Query: 124 YKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
           + +  GSI+ LIT DEEGP+INGT K++  +E + EK   C+VGEP+  + +GD +K GR
Sbjct: 144 HPDHKGSIAFLITSDEEGPSINGTVKVVETLEARNEKMTWCLVGEPSSTNQLGDIVKNGR 203

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSL+  +T++GKQGHVAYPHL ENPI      L++L    +D GN  F  T+ +I+ I 
Sbjct: 204 RGSLNAVLTVNGKQGHVAYPHLAENPIHLASKALNELCETVWDNGNEYFPATSFQISNIQ 263

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
            G  + NVIP  +KM+FN R++       +  EI  + +  I +  KL++ + ++    P
Sbjct: 264 AGTGATNVIPGHLKMTFNFRYS-----TEVTAEILQQRVLEILDKHKLNYDISWTFSGLP 318

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALN 361
            FLT   +L +    +I + TG   +LSTSGGTSD RFI      V+E G++  T+H +N
Sbjct: 319 -FLTPVGELVNAAKTAIKDVTGVETVLSTSGGTSDGRFIAPTGAQVLELGVLNATIHQIN 377

Query: 362 ENASLQDLEDLTCIYENFL 380
           E+ ++ DLE L  IYE  L
Sbjct: 378 EHVNVDDLEPLAEIYEQIL 396


>gi|328474420|gb|EGF45225.1| succinyl-diaminopimelate desuccinylase [Vibrio parahaemolyticus
           10329]
          Length = 378

 Score =  292 bits (747), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 158/374 (42%), Positives = 217/374 (58%), Gaps = 13/374 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            LI   SVTP+D G   +++  LK LGF IE   F+        N +AR G EAP   FA
Sbjct: 12  DLISRQSVTPEDAGCQDLMIERLKALGFEIEVMVFED-----TTNFWARRGNEAPLFAFA 66

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVP G    W  PPF  TI +G ++GRG  DMKGS+A  + AV RFI K+ +  GS
Sbjct: 67  GHTDVVPAGKLEQWDTPPFEPTIIDGYLHGRGAADMKGSLAAMVVAVERFIAKHPDHKGS 126

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I  LIT DEEGP INGT +++  + ++GE  D CIVGEP+   I+GD +K GRRGS++G+
Sbjct: 127 IGFLITSDEEGPFINGTVRVVEALMERGENIDMCIVGEPSSTEIVGDIVKNGRRGSITGD 186

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +T+ G QGHVAYPHL  NP+   +  +H+L    +D GN  F PT+ +I  +  G  + N
Sbjct: 187 LTVKGTQGHVAYPHLANNPVHASLLAIHELATTEWDKGNDYFPPTSFQIPNVSAGTGASN 246

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP +  + FN+RF+   N  T+ + +   L     N   L++ +H++    P FLT   
Sbjct: 247 VIPGEFNVQFNLRFSTELNNDTIVQRVTETL-----NKHDLNYDLHWTFNGDP-FLTDTG 300

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQD 368
            L   +  ++       P L T+GGTSD RFI      V+E G V  T+H +NE   + D
Sbjct: 301 ALLDAVVAAVAEVNNTKPALLTTGGTSDGRFIARMGGQVVELGPVNATIHKVNECVKVDD 360

Query: 369 LEDLTCIYENFLQN 382
           LE LT +YEN L++
Sbjct: 361 LEKLTDMYENTLKH 374


>gi|159042568|ref|YP_001531362.1| succinyl-diaminopimelate desuccinylase [Dinoroseobacter shibae DFL
           12]
 gi|238064732|sp|A8LJT5|DAPE_DINSH RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|157910328|gb|ABV91761.1| succinyl-diaminopimelate desuccinylase [Dinoroseobacter shibae DFL
           12]
          Length = 379

 Score =  292 bits (747), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 156/379 (41%), Positives = 227/379 (59%), Gaps = 15/379 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE--APHLM 68
            LI+CPSVTP++GGA  +L   L   GF+    D   +N   + NL+AR+G +  A    
Sbjct: 10  DLIRCPSVTPEEGGALSLLEARLSAAGFACTRVD---RNG--IANLFARWGEKGHARSFG 64

Query: 69  FAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFG 128
           F GH DVVP G    W + PF A +    +YGRG VDMK ++A F AA   F+      G
Sbjct: 65  FNGHTDVVPVGARADWRFDPFGAQVEGDWMYGRGAVDMKSAVAAFAAAAMDFVADTPPDG 124

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           ++ L ITGDEEG A +GT  +L W+  +GE  D C+VGEPTC   +G+ +KIGRRGS++ 
Sbjct: 125 AVILAITGDEEGDAKDGTVALLDWMAAQGEAMDVCLVGEPTCPDEMGEMMKIGRRGSMTF 184

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
                G QGH AYPH  +NP+  L  L+ +L  +  DTG   F P+ + +TT D GNP+ 
Sbjct: 185 FFEALGVQGHSAYPHRAKNPLPALAKLVDRLAGLELDTGTDHFDPSTLAVTTFDTGNPAN 244

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS---PVFL 305
           NVIPA  + + NIRFND  + ++L     + +++GI         +  +  VS     F+
Sbjct: 245 NVIPAACRATVNIRFNDAHSSESL-----TAMVRGIAAEVAAETGIEITDRVSVSGESFI 299

Query: 306 THDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENAS 365
           T   +L+ L++ ++   TG +P+LSTSGGTSDARF++ +CPV+EFGLVG++MH ++E  +
Sbjct: 300 TPPGRLSDLVAAAVETETGRVPVLSTSGGTSDARFVQHHCPVVEFGLVGKSMHQVDERVA 359

Query: 366 LQDLEDLTCIYENFLQNWF 384
           +  +  L  IY   L+++F
Sbjct: 360 IAQIPQLKAIYTRILRDYF 378


>gi|87118634|ref|ZP_01074533.1| succinyl-diaminopimelate desuccinylase [Marinomonas sp. MED121]
 gi|86166268|gb|EAQ67534.1| succinyl-diaminopimelate desuccinylase [Marinomonas sp. MED121]
          Length = 378

 Score =  292 bits (747), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 163/379 (43%), Positives = 226/379 (59%), Gaps = 19/379 (5%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI  PSVTP+D G   +++  L  LGF +EE  F       VKN YA+ G E P+L FAG
Sbjct: 14  LISRPSVTPEDAGCQALMIQRLTKLGFDVEEMPFGD-----VKNFYAKRGNEGPNLCFAG 68

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI---PKYKNFG 128
           H DVVP G  + W  PPF   I +GK++GRG  DMKGS+A  + AV  F+   P +K  G
Sbjct: 69  HTDVVPTGPESEWINPPFEPKIIDGKLFGRGAADMKGSLASMVVAVEEFVTANPDHK--G 126

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
            IS LIT DEEGP ++GT +++  + ++ EK D CIVGEP+  + +GD IK GRRGS SG
Sbjct: 127 QISFLITSDEEGPFVDGTTRVVDALMERKEKVDWCIVGEPSSTNQLGDIIKNGRRGSFSG 186

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
            +TI+GKQGHVAYPHL +NPI    P++ +L+   +D GN  F PT+ +++ I  G  + 
Sbjct: 187 NLTIYGKQGHVAYPHLAQNPIHLAAPVIAELSETHWDEGNDFFPPTSFQVSNISSGTGAT 246

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPVFLTH 307
           NV+P  +   FN+RF+   +   +K  I + L K G++      + + ++    P FLT 
Sbjct: 247 NVVPGTLNTQFNLRFSSELDFDKIKARILAILEKHGVK------YDIEWTYNGLP-FLTR 299

Query: 308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFI-KDYCPVIEFGLVGRTMHALNENASL 366
             +L   + KS+ ++    P LSTSGGTSD RFI K    V+E G V  T+H +NE    
Sbjct: 300 PGELVDAIVKSVEDSVKITPELSTSGGTSDGRFIAKMGTQVVELGPVNATIHQINECVEA 359

Query: 367 QDLEDLTCIYENFLQNWFI 385
           + L  LT IY   L+N F+
Sbjct: 360 ESLNQLTNIYRKTLENLFL 378


>gi|109898509|ref|YP_661764.1| succinyl-diaminopimelate desuccinylase [Pseudoalteromonas atlantica
           T6c]
 gi|123064569|sp|Q15TS8|DAPE_PSEA6 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|109700790|gb|ABG40710.1| succinyldiaminopimelate desuccinylase [Pseudoalteromonas atlantica
           T6c]
          Length = 376

 Score =  292 bits (747), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 162/383 (42%), Positives = 222/383 (57%), Gaps = 13/383 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+ + L    +LI   SVTP+D G   ++   L  LGF IE   F         N++AR 
Sbjct: 1   MSCEVLALTEELINRQSVTPEDAGCQQLMAEYLAPLGFDIESMVFDD-----TTNMWARK 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT  P   FAGH DVVP G    WT+PPF+AT  EG++YGRG  DMKGS+A  + A   F
Sbjct: 56  GTGGPVFCFAGHTDVVPSGPAEKWTFPPFTATQHEGQLYGRGAADMKGSLAAMLVATKAF 115

Query: 121 IPKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + K+ ++ GSI+ LIT DEEGP INGT +++  +E + EK   C+VGEP+   +IGD +K
Sbjct: 116 VTKHPEHSGSIAFLITSDEEGPFINGTTRVIDTLEARNEKMTWCLVGEPSSTTLIGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+G+IT+ G QGHVAYPHL +NPI    P   +L    +D+GN +F PT+ +++
Sbjct: 176 NGRRGSLTGDITVKGVQGHVAYPHLAKNPIHLSAPAFAELAQTHWDSGNASFPPTSFQVS 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NVIP  +   FN RF+    +K L E + + L K         + + ++  
Sbjct: 236 NINSGTGAGNVIPGDLSACFNFRFSTEVTDKQLIERVTTILDK-----YDFDYHIDWTFN 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL      +I + TG    LST+GGTSD RFI      VIE G +  T+H
Sbjct: 291 GQP-FLTDSGKLVEATQSAIKDVTGRETELSTAGGTSDGRFIAPTGAQVIELGPINATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQ 381
            ++EN ++ DL  L  IYE  LQ
Sbjct: 350 KIDENVNINDLAQLAKIYEGILQ 372


>gi|224825859|ref|ZP_03698963.1| succinyl-diaminopimelate desuccinylase [Lutiella nitroferrum 2002]
 gi|224602083|gb|EEG08262.1| succinyl-diaminopimelate desuccinylase [Lutiella nitroferrum 2002]
          Length = 375

 Score =  292 bits (747), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 160/377 (42%), Positives = 228/377 (60%), Gaps = 13/377 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           +LI+  SVTP D G    ++  L+ +GF++E   +       V N +AR GT  P + FA
Sbjct: 10  ELIRLDSVTPNDAGCQERMIARLEAVGFTVERMRYGD-----VDNFWARRGTSGPVVCFA 64

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVP G  + W   PF  TI  G ++GRG  DMK S+A FI ++ RF+ ++    GS
Sbjct: 65  GHTDVVPTGPLDKWDSHPFEPTIRNGYLFGRGAADMKASLAAFITSIERFVAQHPGHPGS 124

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I+LLIT DEEG AI+GT +++  +E +GE  D CIVGEPT NH++GDTIK GRRGSLSG 
Sbjct: 125 IALLITSDEEGSAIDGTVRVVDALEARGELIDYCIVGEPTSNHVLGDTIKNGRRGSLSGH 184

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           + +HG QGH+AYPHL +NP+  + P L +L    +D GN  F PT+ +++ I+ G  + N
Sbjct: 185 LIVHGIQGHIAYPHLAKNPVHLIAPALAELAAEEWDQGNHHFPPTSWQVSNINAGTGATN 244

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           +IP   ++ FN RF+     +TLK+ +       I +   L++ +H++   +P FLT + 
Sbjct: 245 IIPGSCEVKFNFRFSTEHTAETLKDRVHH-----ILDAHGLAYELHWTLSGNP-FLTEEG 298

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNENASLQD 368
            LT  L +SI    G    LST+GGTSD RFIK     + EFG V  ++H LNE   +  
Sbjct: 299 TLTRALERSIKQVMGVDAELSTTGGTSDGRFIKRIARELAEFGPVNASIHKLNECVEVHA 358

Query: 369 LEDLTCIYENFLQNWFI 385
           +E L+ IYE  L+N  +
Sbjct: 359 IERLSDIYEAALKNLLL 375


>gi|253989297|ref|YP_003040653.1| succinyl-diaminopimelate desuccinylase [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253780747|emb|CAQ83909.1| n-succinyl-diaminopimelate deacylase [Photorhabdus asymbiotica]
          Length = 375

 Score =  291 bits (746), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 158/384 (41%), Positives = 223/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT   +E   QLI+ PSV+P D G   I+++ L+ +GF+IE   F   N     N +A  
Sbjct: 1   MTCPVIELAQQLIRQPSVSPDDKGCQDIMISRLQAIGFTIERMPFGDTN-----NFWAYR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT    L FAGH DVVP GD + W +PPF  TI  G +YGRG  DMKGS+A  + A  RF
Sbjct: 56  GT-GLTLAFAGHTDVVPAGDESQWEHPPFEPTIRNGMLYGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  + N  G ++ LIT DEE  A NGT K++  +  + E+ D C++GEP+  + +GD +K
Sbjct: 115 VTSHPNHNGRLAFLITSDEEAQATNGTVKVVEALMSRNEQLDYCLIGEPSSQYRLGDMVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +T+HG QGHVAYPHL +NPI   IP L +L +  +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTANLTVHGIQGHVAYPHLADNPIHRAIPALQELVSTHWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP  +++ FN RF+    +  ++E + + L         L +T+ +  P
Sbjct: 235 NIHAGTGSHNVIPGNLQVQFNFRFSTELTDSQIRERVETILKNH-----DLDYTIEWILP 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   +L   + ++I +  G  P LSTSGGTSD RFI      V+E G +  T+H
Sbjct: 290 GEP-FLTAKGELVDAVVQAIDHYCGYKPELSTSGGTSDGRFIARMGAQVVELGPINSTIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  S  DL+ L+ IY+  ++ 
Sbjct: 349 KVNEAVSAADLQQLSRIYQRVMEQ 372


>gi|124266994|ref|YP_001020998.1| succinyl-diaminopimelate desuccinylase [Methylibium petroleiphilum
           PM1]
 gi|238064791|sp|A2SGS4|DAPE_METPP RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|124259769|gb|ABM94763.1| succinyldiaminopimelate desuccinylase [Methylibium petroleiphilum
           PM1]
          Length = 386

 Score =  291 bits (746), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 159/392 (40%), Positives = 230/392 (58%), Gaps = 22/392 (5%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEE-----KDFQTKNTSIVKN 55
           + P  L    QLI   SVTP+D G   ++V  L+  GF          DF+      V N
Sbjct: 4   LPPTALALAEQLIARASVTPEDAGCQALVVQRLQAQGFDCHTLESGPDDFR------VTN 57

Query: 56  LYA-RFGTEAPH--LMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIAC 112
           L+A R G  A    L+FAGH DVVP G    WT  PF  +  +G++YGRG  DMK SIAC
Sbjct: 58  LWAVRRGRSADGFTLVFAGHTDVVPTGPLERWTSDPFVPSHRDGRLYGRGAADMKTSIAC 117

Query: 113 FIAAVARFIPKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCN 171
            + A+  F+  Y ++ GSI+LL+T DEEGPA++GT +++ W++ +GE+ D CIVGEPT  
Sbjct: 118 MVVAIEEFVAAYPRHAGSIALLLTSDEEGPALDGTTQVVRWLQARGERLDGCIVGEPTSV 177

Query: 172 HIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTF 231
           + +GD IK GRRGSLSG + + G QGH+AYPHL +NPI  + P L +L  + +D GN  F
Sbjct: 178 NAVGDMIKNGRRGSLSGRLVVQGVQGHIAYPHLAKNPIHAVAPALAELVQVVWDGGNEHF 237

Query: 232 SPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLS 291
            PT+ +++ +  G  + NVIP +  + FN RF+     +TL++ + + L +       L 
Sbjct: 238 PPTSWQVSNLHAGTGASNVIPGEAVVDFNFRFSTESTPETLQQRLAAVLDRH-----GLQ 292

Query: 292 HTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEF 350
           +T+ ++    P FLT    LT  L  +I   TG    LST+GGTSD RFI   CP V+E 
Sbjct: 293 YTIDWTLGGRP-FLTRPGSLTEALGSAILQVTGRTTELSTTGGTSDGRFIATVCPQVVEC 351

Query: 351 GLVGRTMHALNENASLQDLEDLTCIYENFLQN 382
           G V  ++H ++E+ ++ ++E L  IY + L+ 
Sbjct: 352 GPVNASIHQIDEHVAVAEIEPLKEIYRSTLER 383


>gi|126666186|ref|ZP_01737166.1| succinyl-diaminopimelate desuccinylase [Marinobacter sp. ELB17]
 gi|126629508|gb|EBA00126.1| succinyl-diaminopimelate desuccinylase [Marinobacter sp. ELB17]
          Length = 382

 Score =  291 bits (746), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 166/377 (44%), Positives = 224/377 (59%), Gaps = 14/377 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           L+  + LI+ PSVTP D G   ++++ L  LGF+ E   F T +     NL+AR G+E P
Sbjct: 13  LKLAMDLIRRPSVTPDDAGCQPLMMSRLAPLGFAEENLRFGTTD-----NLWARKGSEGP 67

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            L FAGH DVVP G   +W  PPF A I +G ++GRG  DMKGS+A F+ A  RF+ K+ 
Sbjct: 68  VLAFAGHTDVVPTGPEKNWAIPPFEAIIKDGMLHGRGAADMKGSLAAFVTACERFVGKHP 127

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           N  GSI+LLIT DEEGPA +GT K++  +E + EK D C++GEP+    +GD IK GRRG
Sbjct: 128 NHRGSIALLITSDEEGPAGDGTVKVIKTLEARNEKIDWCLIGEPSSTVEVGDVIKNGRRG 187

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SL G +T+HG QGHVAYPHL ENPI  + P LH L    +D GN  F PT  +IT ++ G
Sbjct: 188 SLHGYLTVHGVQGHVAYPHLAENPIHKVAPALHDLAQEFWDNGNDYFPPTTFQITKVEAG 247

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
             S N+IP +  + FN R+      ++L+E + + L +       L++ + +     P F
Sbjct: 248 TGS-NIIPGECLVHFNFRYCTENTAESLEERVVAVLGRH-----SLNYDLQWHLSGRP-F 300

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNEN 363
           LT    L S  + +I    G    LSTSGGTSD RFI      V+E G +  T+H +NE 
Sbjct: 301 LTDKGALVSASTAAIARVCGRETELSTSGGTSDGRFIAPTGAQVVELGPINATIHKVNEC 360

Query: 364 ASLQDLEDLTCIYENFL 380
            S  DL+ L+ IYE  L
Sbjct: 361 VSADDLDTLSQIYEEIL 377


>gi|297538016|ref|YP_003673785.1| succinyl-diaminopimelate desuccinylase [Methylotenera sp. 301]
 gi|297257363|gb|ADI29208.1| succinyl-diaminopimelate desuccinylase [Methylotenera sp. 301]
          Length = 385

 Score =  291 bits (745), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 162/375 (43%), Positives = 230/375 (61%), Gaps = 11/375 (2%)

Query: 10  IQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMF 69
           I L+   S TP+D G   ++++ L+ LGF IE   F       V NLYAR GT  P L+F
Sbjct: 15  INLLTRRSNTPEDAGCQELMISHLEPLGFKIERMRFGN-----VDNLYARRGTTGPLLVF 69

Query: 70  AGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-G 128
           AGH DVVP G  + W   PF  TI +G +Y RG  DMK S+A FI ++  FI +  N  G
Sbjct: 70  AGHTDVVPTGPLDKWHTHPFEPTIKDGMLYARGAADMKTSLAAFITSIEEFIAENPNHTG 129

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           SI LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT N ++GD IK GRRGSLSG
Sbjct: 130 SIGLLITSDEEGVAVDGTVKVVEALKARGELIDYCIVGEPTSNKVVGDMIKNGRRGSLSG 189

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
           ++T+ G QGH+AYPHL +NPI  + P +  +    +D GN  F PT+ +I+ ++ G  + 
Sbjct: 190 KLTVKGIQGHIAYPHLVKNPIHLVAPAIKDMVETVWDNGNEYFPPTSWQISNMNGGTGAT 249

Query: 249 NVIPAQVKMSFNIRF-NDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTH 307
           NV+P +V++ FN RF  +L N+ + +  ++SR +  I +  +L++ + +    SP ++T 
Sbjct: 250 NVVPGEVEILFNFRFCPELNNQGSTEANLKSR-VHAILDGHQLNYDLEWE--YSPPYITP 306

Query: 308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMHALNENASL 366
              L   ++++I    G  P LST+GGTSD RFI D C  VIEFG +  T+H LNE   +
Sbjct: 307 RGNLVEAITEAIEQAYGVTPELSTTGGTSDGRFIADICKQVIEFGPLNATIHKLNECVGV 366

Query: 367 QDLEDLTCIYENFLQ 381
            D+E L   Y+  LQ
Sbjct: 367 ADIEPLKETYKLTLQ 381


>gi|254461599|ref|ZP_05075015.1| succinyl-diaminopimelate desuccinylase [Rhodobacterales bacterium
           HTCC2083]
 gi|206678188|gb|EDZ42675.1| succinyl-diaminopimelate desuccinylase [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 381

 Score =  291 bits (745), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 156/377 (41%), Positives = 228/377 (60%), Gaps = 11/377 (2%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            L++CPSVTP++GGA  +L   L   GF     D      + + NL+AR+G +     F 
Sbjct: 12  DLVRCPSVTPEEGGALILLQKLLDDAGFECSRVD-----RAGISNLFARWGIKGAVKTFG 66

Query: 71  --GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFG 128
             GH DVVP GD   W + PFSA I +G +YGRG  DMK  +A F AA   F+      G
Sbjct: 67  FNGHTDVVPIGDQTAWMHGPFSADIVDGIMYGRGTTDMKAGVAAFAAAAIDFVATTPPDG 126

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           ++ L ITGDEEG A++GT  +L ++E++ E+   C+VGEPTC + +G+ +KIGRRGSL+ 
Sbjct: 127 AVILTITGDEEGDALDGTTALLDYMERENERMSVCLVGEPTCPNEMGEMMKIGRRGSLTC 186

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
              + GKQGH AYPH  +NP+  L  L+ +L     D G   F  + + + TID GNP+ 
Sbjct: 187 WFEVTGKQGHSAYPHRAKNPLPALARLMDRLAGHELDQGTDHFDASTLAVVTIDTGNPAT 246

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS-PVFLTH 307
           NVIPA  + + NIRFNDL +  +L E ++   ++  +   +    +     +S   F+T 
Sbjct: 247 NVIPANCRATVNIRFNDLHSGASLSEWLQ---VEADKVASEFDMPITLKIKISGESFITP 303

Query: 308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQ 367
              L+ L++KS+   TG  P +ST+GGTSDARF+K++CPV+EFGLVG+TMH ++EN  ++
Sbjct: 304 PGPLSDLIAKSVEAETGVTPEMSTTGGTSDARFVKNHCPVVEFGLVGKTMHQVDENVPIE 363

Query: 368 DLEDLTCIYENFLQNWF 384
            +  L  IY   L+++F
Sbjct: 364 QIAQLKSIYLRILKDYF 380


>gi|34496911|ref|NP_901126.1| succinyl-diaminopimelate desuccinylase [Chromobacterium violaceum
           ATCC 12472]
 gi|81656252|sp|Q7NY19|DAPE_CHRVO RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|34102767|gb|AAQ59131.1| succinyl-diaminopimelate desuccinylase [Chromobacterium violaceum
           ATCC 12472]
          Length = 377

 Score =  291 bits (744), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 156/374 (41%), Positives = 218/374 (58%), Gaps = 13/374 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           +LI+  SVTP+D G   +++  L+ +GF +E+          V N +AR G   P   FA
Sbjct: 10  ELIRRDSVTPRDEGCQALMIERLEAIGFKVEKM-----RHGDVDNFWARRGDAGPLFCFA 64

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVP G  + W  PPF  T+  G +YGRG  DMK S+A F+ A  RF+ ++ +  GS
Sbjct: 65  GHTDVVPTGPLDKWDSPPFEPTVRNGLLYGRGAADMKASLAAFVTACERFVAEHPDHKGS 124

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           ++LLIT DEEG A++GT K++  +E +GE  D CIVGEPT    +GDT+K GRRGSLSG 
Sbjct: 125 LALLITSDEEGVAVDGTVKVVDALEARGETIDYCIVGEPTSEQRLGDTVKNGRRGSLSGR 184

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           + +HG QGH+AYP L +NPI  + P L +L    +D GN  F PT+ +++ I  G  + N
Sbjct: 185 LVVHGIQGHIAYPQLAKNPIHLMAPALAELAATRWDEGNAFFPPTSWQVSNIQAGTGATN 244

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP   ++ FN RF+     ++LKE +   L K       L + +H+     P F+T   
Sbjct: 245 VIPGHCELLFNFRFSPESTAESLKERVYQILDKH-----GLGYELHWQLSGQP-FITPPG 298

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNENASLQD 368
            LT  LS +I   +G    LST+GGTSD RFIK     ++EFG +  T+H LNE   + D
Sbjct: 299 ALTDALSAAIAEVSGAKAELSTTGGTSDGRFIKRIARELVEFGPINATIHKLNECVEVAD 358

Query: 369 LEDLTCIYENFLQN 382
           +E L  IY   L+ 
Sbjct: 359 VEPLAAIYRRTLEG 372


>gi|28899043|ref|NP_798648.1| succinyl-diaminopimelate desuccinylase [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|153836962|ref|ZP_01989629.1| succinyl-diaminopimelate desuccinylase [Vibrio parahaemolyticus
           AQ3810]
 gi|260365211|ref|ZP_05777768.1| succinyl-diaminopimelate desuccinylase [Vibrio parahaemolyticus
           K5030]
 gi|260876875|ref|ZP_05889230.1| succinyl-diaminopimelate desuccinylase [Vibrio parahaemolyticus
           AN-5034]
 gi|260897356|ref|ZP_05905852.1| succinyl-diaminopimelate desuccinylase [Vibrio parahaemolyticus
           Peru-466]
 gi|260899914|ref|ZP_05908309.1| succinyl-diaminopimelate desuccinylase [Vibrio parahaemolyticus
           AQ4037]
 gi|81727140|sp|Q87MI6|DAPE_VIBPA RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|28807262|dbj|BAC60532.1| succinyl-diaminopimelate desuccinylase [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|149749735|gb|EDM60480.1| succinyl-diaminopimelate desuccinylase [Vibrio parahaemolyticus
           AQ3810]
 gi|308088296|gb|EFO37991.1| succinyl-diaminopimelate desuccinylase [Vibrio parahaemolyticus
           Peru-466]
 gi|308091420|gb|EFO41115.1| succinyl-diaminopimelate desuccinylase [Vibrio parahaemolyticus
           AN-5034]
 gi|308107223|gb|EFO44763.1| succinyl-diaminopimelate desuccinylase [Vibrio parahaemolyticus
           AQ4037]
 gi|308115408|gb|EFO52948.1| succinyl-diaminopimelate desuccinylase [Vibrio parahaemolyticus
           K5030]
          Length = 378

 Score =  291 bits (744), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 157/374 (41%), Positives = 217/374 (58%), Gaps = 13/374 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            LI   SVTP+D G   +++  LK LGF IE   F+        N +AR G EAP   FA
Sbjct: 12  DLISRQSVTPEDAGCQDLMIERLKALGFEIEVMVFED-----TTNFWARRGNEAPLFAFA 66

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVP G    W  PPF  TI +G ++GRG  DMKGS+A  + AV RFI ++ +  GS
Sbjct: 67  GHTDVVPAGKLEQWDTPPFEPTIIDGYLHGRGAADMKGSLAAMVVAVERFIAEHPDHKGS 126

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I  LIT DEEGP INGT +++  + ++GE  D CIVGEP+   I+GD +K GRRGS++G+
Sbjct: 127 IGFLITSDEEGPFINGTVRVVEALMERGENIDMCIVGEPSSTEIVGDVVKNGRRGSITGD 186

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +T+ G QGHVAYPHL  NP+   +  +H+L    +D GN  F PT+ +I  +  G  + N
Sbjct: 187 LTVKGTQGHVAYPHLANNPVHASLLAIHELATTEWDKGNDYFPPTSFQIPNVSAGTGASN 246

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP +  + FN+RF+   N  T+ + +   L K       L++ +H++    P FLT   
Sbjct: 247 VIPGEFNVQFNLRFSTELNNDTIVQRVTETLDK-----HDLNYDLHWTFNGDP-FLTDTG 300

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQD 368
            L   +  ++       P L T+GGTSD RFI      V+E G V  T+H +NE   + D
Sbjct: 301 ALLDAVVAAVAEVNNTKPALLTTGGTSDGRFIARMGGQVVELGPVNATIHKVNECVKVDD 360

Query: 369 LEDLTCIYENFLQN 382
           LE LT +YEN L++
Sbjct: 361 LEKLTDMYENTLKH 374


>gi|91776221|ref|YP_545977.1| succinyl-diaminopimelate desuccinylase [Methylobacillus flagellatus
           KT]
 gi|123078811|sp|Q1H051|DAPE_METFK RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|91710208|gb|ABE50136.1| succinyldiaminopimelate desuccinylase [Methylobacillus flagellatus
           KT]
          Length = 375

 Score =  291 bits (744), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 163/378 (43%), Positives = 225/378 (59%), Gaps = 13/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE    LI   SVTP D G   +L++ L+ LGFSIE   F       V N YAR G   P
Sbjct: 5   LELAKDLIARKSVTPDDAGCQELLISRLEPLGFSIERLRFGD-----VDNFYARRGNTGP 59

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            L+FAGH DVVP G    W  PPF+ T+ +G +YGRG  DMK S+A FI A+  F+  + 
Sbjct: 60  LLVFAGHTDVVPTGPVAQWHTPPFTPTVKDGMLYGRGAADMKTSLAAFITAIEAFVADHP 119

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI L+IT DEEG AINGT K++  ++ + E  D CIVGEPT + ++GD IK GRRG
Sbjct: 120 DHPGSIGLIITSDEEGVAINGTVKVVETLKARNELIDYCIVGEPTSSKVVGDMIKNGRRG 179

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG++T+ G QGH+AYPHL +NPI    P + +L+   +D GN  F PT+ +I+ I  G
Sbjct: 180 SLSGKLTVKGIQGHIAYPHLVKNPIHMAAPAIKELSETIWDEGNEYFPPTSWQISNIHGG 239

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
             + NV+P +V++ FN RF+     + LK+ + +     I +  +L + + +     P F
Sbjct: 240 TGATNVVPGEVEILFNFRFSTASTAENLKQRVHA-----ILDRHQLEYDLAWELSGKP-F 293

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNEN 363
           LT    L + +S +I    G  P LSTSGGTSD RFI D    ++EFG +  T+H LNE 
Sbjct: 294 LTPRGSLVTAISSAIDQAFGVTPALSTSGGTSDGRFIADIAGQIVEFGPLNATIHKLNEC 353

Query: 364 ASLQDLEDLTCIYENFLQ 381
            ++ D+E L   Y+  L+
Sbjct: 354 VAVADIEPLRRTYQLTLE 371


>gi|296283109|ref|ZP_06861107.1| succinyl-diaminopimelate desuccinylase [Citromicrobium
           bathyomarinum JL354]
          Length = 377

 Score =  291 bits (744), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 159/379 (41%), Positives = 226/379 (59%), Gaps = 20/379 (5%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEE----KDFQTKNTSIVKNLYA- 58
           D L+   +LI  PSVTP  G  F  +   L+ LGF++            + + V+NL+A 
Sbjct: 3   DVLDLAKRLIAAPSVTPATGAVFDEMQAMLEPLGFTVHRFTRGSGPAGSDEAPVENLFAI 62

Query: 59  RFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
           R G    H  FAGH+DVVPPG+   W    F+       +YGRG VDMKG+IAC +AAVA
Sbjct: 63  RAGAGPKHFAFAGHLDVVPPGE--GWESGAFAPETRGDLLYGRGAVDMKGAIACMVAAVA 120

Query: 119 RFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
             +P   + G+IS +ITGDEEGPA++GT+ ++ ++       D C+VGEPT  + +GD +
Sbjct: 121 E-VPA--DAGTISFIITGDEEGPALHGTRALIDFMHANDHAPDLCLVGEPTSVNRLGDMM 177

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGS++  ++  G QGHVAYPHL +NPI  L+  + +L  +  D G   F P+N+EI
Sbjct: 178 KIGRRGSVNMWLSAKGTQGHVAYPHLADNPIPRLVAAMAELEALELDEGTDWFQPSNLEI 237

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           T I+VGNP+ NVIP + +   +IRFNDL +  +L E++ +   +         H V    
Sbjct: 238 TDIEVGNPAHNVIPGEARARLSIRFNDLHSGASLSEKVTTICAR---------HQVDVRP 288

Query: 299 PVS-PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTM 357
            +S   FLT   + + +++ ++   TG +P  STSGGTSDARF++  CPVIEFGLV  TM
Sbjct: 289 VISGEPFLTPPGEFSGMIAAAVEAETGVVPEASTSGGTSDARFLRSVCPVIEFGLVNATM 348

Query: 358 HALNENASLQDLEDLTCIY 376
           H  +E  ++ DL  L  IY
Sbjct: 349 HKTDEAVAVADLAVLARIY 367


>gi|148556522|ref|YP_001264104.1| succinyl-diaminopimelate desuccinylase [Sphingomonas wittichii RW1]
 gi|238055228|sp|A5VCF0|DAPE_SPHWW RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|148501712|gb|ABQ69966.1| succinyldiaminopimelate desuccinylase [Sphingomonas wittichii RW1]
          Length = 377

 Score =  290 bits (743), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 174/384 (45%), Positives = 226/384 (58%), Gaps = 11/384 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D L+   +LI CPSVTP D GA  ++   L+ +GF++            V+NL+A  G  
Sbjct: 3   DPLDLTQRLIACPSVTPADAGAMAVIATALESIGFTVHRFAAGEAPDGPVENLFAIRGQG 62

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PH  FAGH DVVPPGD   WT  PF   I    ++GRG VDMKG+IA FIAA AR    
Sbjct: 63  GPHFAFAGHSDVVPPGD--GWTSDPFVPEIRGELLHGRGAVDMKGAIAAFIAAAARL--- 117

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
             + G+ISL+ITGDEEGPA  GT  ++ W++ +G   D C+VGEPT  H +GD +KIGRR
Sbjct: 118 GDHPGTISLIITGDEEGPATFGTVALIDWMKARGLCPDLCLVGEPTSTHRLGDMVKIGRR 177

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++  I   G QGHVAYPHL  NPI  L+  L  L  +  D GN  F P+N+EITT+DV
Sbjct: 178 GSVNMWIENVGTQGHVAYPHLAANPIPALVKALDALAALHLDDGNAWFQPSNLEITTVDV 237

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GN + NVIPA  +   NIRFND      L E +R  +    ++ P  +     S      
Sbjct: 238 GNAATNVIPAVARARLNIRFNDEHRGADLVELVRRTV---AEHAPAATVRAVIS---GES 291

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           F+T     ++L+S +I   TG  P LST+GGTSDARF+   CPV+EFGL   TMH L+E 
Sbjct: 292 FITPPGDFSALISAAIMKVTGLTPELSTTGGTSDARFLSKLCPVVEFGLCNATMHKLDEA 351

Query: 364 ASLQDLEDLTCIYENFLQNWFITP 387
            ++ DL  L  IYE+ ++     P
Sbjct: 352 VAIPDLHALADIYEDIVRTVLAHP 375


>gi|84503467|ref|ZP_01001522.1| succinyl-diaminopimelate desuccinylase [Oceanicola batsensis
           HTCC2597]
 gi|84388145|gb|EAQ01098.1| succinyl-diaminopimelate desuccinylase [Oceanicola batsensis
           HTCC2597]
          Length = 380

 Score =  290 bits (743), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 161/386 (41%), Positives = 224/386 (58%), Gaps = 9/386 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D +     LI+CPSVTP++GGA  +L   L   GF+    D   +N +   NL+AR+
Sbjct: 1   MPTDPVALTADLIRCPSVTPEEGGALVLLEKVLGRAGFTCIRVD---RNGT--SNLFARW 55

Query: 61  GTEAPHLMFA--GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
           G    +  F   GH DVVP GD   W+ PPF A   +G ++GRG  DMK  +A F AA  
Sbjct: 56  GHRGANRSFGFNGHTDVVPVGDAAAWSVPPFGAVEKDGMLWGRGATDMKSGVAAFAAAAI 115

Query: 119 RFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
            F+ +    G++ L ITGDEEG A +GT  +L W+ + GE    C+VGEPTC   +G+ +
Sbjct: 116 DFVTETPPDGAVILAITGDEEGDATDGTVALLDWMRETGEAMTDCLVGEPTCPDRMGEMM 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGSL+    + G QGH AYPH  +NP+  L  L+ +L +   D G   F  + +  
Sbjct: 176 KIGRRGSLNAWFEVTGVQGHSAYPHRAKNPVPALARLMDRLASHDLDHGTDHFQASTVVP 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
            T+D GNP+ NVIPAQ + + NIRF+D  +  +L   +R     GI     +S  V    
Sbjct: 236 VTMDTGNPATNVIPAQCRGAVNIRFSDAHSGDSLSAWLRQE-AAGIAETFGVSVDVRIKV 294

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
                FLT    L++L++ ++   TG  P LSTSGGTSDARF+KD+CPV+EFGLVG+TMH
Sbjct: 295 S-GESFLTPPGPLSNLVATAVRAETGIAPELSTSGGTSDARFVKDHCPVVEFGLVGKTMH 353

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
           A++E   +  +  L  IY   L+++F
Sbjct: 354 AVDERVEIAQIRQLKEIYGRILRDYF 379


>gi|254465156|ref|ZP_05078567.1| succinyl-diaminopimelate desuccinylase [Rhodobacterales bacterium
           Y4I]
 gi|206686064|gb|EDZ46546.1| succinyl-diaminopimelate desuccinylase [Rhodobacterales bacterium
           Y4I]
          Length = 383

 Score =  290 bits (743), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 159/376 (42%), Positives = 222/376 (59%), Gaps = 11/376 (2%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA--PHLMF 69
           LI+CPSVTP++GGA  +L   L   GF     D    +   V NL+AR+G +       F
Sbjct: 13  LIRCPSVTPEEGGALVLLEQLLSAAGF-----DCTRTDRGEVSNLFARWGAKGHTKTFGF 67

Query: 70  AGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGS 129
            GH DVVP GD   WT PPF A   +G +YGRG  DMK  +A F AA   F+ +    G+
Sbjct: 68  NGHTDVVPLGDEAAWTMPPFGAEEKDGFMYGRGATDMKSGVAAFAAAAVDFVKETPPDGA 127

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I L ITGDEEG A +GT  +L +++++GEK   C+VGEPTC   +G+ IKIGRRGSL+  
Sbjct: 128 IILTITGDEEGDAEDGTTALLDYMDREGEKMSVCLVGEPTCPDEMGEMIKIGRRGSLTAW 187

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
            T+ G QGH AYPH   NP+  +  L+ +L +   D G   F  + + + TID GN + N
Sbjct: 188 FTVTGVQGHSAYPHRANNPLNAMARLMDRLASHELDQGTEHFDASTLAVVTIDTGNTATN 247

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVP-KLSHTVHFSSPVSPVFLTHD 308
           VIPAQ + + NIRFND     +L + ++    K       +++  V  S      F+T  
Sbjct: 248 VIPAQSRAAVNIRFNDAHTGASLTDWLQDEADKTAAEFGVEITVQVKIS---GESFITPP 304

Query: 309 RKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQD 368
             L+ L+++++   TG  P LST+GGTSDARF+K++CPV+EFGLVG+TMH ++E   +  
Sbjct: 305 GPLSDLVAEAVEAETGRKPELSTTGGTSDARFVKNHCPVVEFGLVGKTMHQVDERVEVAQ 364

Query: 369 LEDLTCIYENFLQNWF 384
           +  L  IY   LQ++F
Sbjct: 365 IHQLKTIYTRILQDYF 380


>gi|226951677|ref|ZP_03822141.1| succinyl-diaminopimelate desuccinylase [Acinetobacter sp. ATCC
           27244]
 gi|226837593|gb|EEH69976.1| succinyl-diaminopimelate desuccinylase [Acinetobacter sp. ATCC
           27244]
          Length = 377

 Score =  290 bits (743), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 162/379 (42%), Positives = 230/379 (60%), Gaps = 13/379 (3%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D LE  +QL++ PSVTP D     I+ + L  +GF+IE+  F+      V NL+AR GTE
Sbjct: 5   DTLELSLQLLRQPSVTPVDHDCQNIMADRLSKIGFNIEKLRFED-----VDNLWARRGTE 59

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            P   FAGH DVVP G  + W   PF  TI +GK+YGRG  DMK ++A  + A  RF+ K
Sbjct: 60  NPVFCFAGHTDVVPTGHLDAWNSDPFQPTIRDGKLYGRGSADMKTALAAMVVASERFVAK 119

Query: 124 YKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
           + +  GSI+ LIT DEEGP+INGT K++  +E + EK   C+VGEP+  + +GD +K GR
Sbjct: 120 HPDHKGSIAFLITSDEEGPSINGTVKVVETLEARNEKMTWCLVGEPSSTNQLGDIVKNGR 179

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSL+  +T++GKQGHVAYPHL ENPI      L++L    +D GN  F  T+ +I+ I 
Sbjct: 180 RGSLNAVLTVNGKQGHVAYPHLAENPIHLASKALNELCETVWDKGNEYFPATSFQISNIQ 239

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
            G  + NVIP  +K++FN R++       +  EI  + +  I +  KL++ + ++    P
Sbjct: 240 AGTGATNVIPGHLKVTFNFRYS-----TEVTAEILQQRVLEILDKHKLNYDISWTFSGLP 294

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALN 361
            FLT   +L +    +I + TG   +LSTSGGTSD RFI      V+E G++  T+H +N
Sbjct: 295 -FLTPVGELVNAAKTAIKDVTGVETVLSTSGGTSDGRFIAPTGAQVLELGVLNATIHQIN 353

Query: 362 ENASLQDLEDLTCIYENFL 380
           E+ ++ DLE L  IYE  L
Sbjct: 354 EHVNVDDLEPLAEIYEQIL 372


>gi|332306433|ref|YP_004434284.1| succinyl-diaminopimelate desuccinylase [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332173762|gb|AEE23016.1| succinyl-diaminopimelate desuccinylase [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 376

 Score =  290 bits (743), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 161/383 (42%), Positives = 222/383 (57%), Gaps = 13/383 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+ + L    +LI   SVTP+D G   ++   L  LGF IE   F+        N++AR 
Sbjct: 1   MSCEVLALTEELINRQSVTPEDAGCQQLMAEYLAPLGFEIETMVFED-----TTNMWARK 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   P   FAGH DVVP G    WT+PPF AT  EG++YGRG  DMKGS+A  + A   F
Sbjct: 56  GKGDPVFCFAGHTDVVPSGPAEKWTFPPFEATQHEGQLYGRGSADMKGSLAAMLVATKAF 115

Query: 121 IPKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + K+ ++ GSI+ LIT DEEGP INGT +++  +E + EK   C+VGEP+   ++GD +K
Sbjct: 116 VTKHPEHTGSIAFLITSDEEGPFINGTTRVIDTLEARNEKMTWCLVGEPSSTTLVGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+G+I I G QGHVAYPHL +NPI    P   +L    +D+GN +F PT+ +++
Sbjct: 176 NGRRGSLTGDIVIKGVQGHVAYPHLAKNPIHASAPAFAELAQTHWDSGNASFPPTSFQVS 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NVIP  +   FN RF+    +K L E + S L K         + + ++  
Sbjct: 236 NINSGTGAGNVIPGDLTACFNFRFSTEVTDKQLIERVISILDK-----YDFDYEIDWTFN 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL      +I + TG    LST+GGTSD RFI      VIE G V  T+H
Sbjct: 291 GQP-FLTDSGKLVEATQDAIKDVTGRQTELSTAGGTSDGRFIAPTGAQVIELGPVNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQ 381
            ++EN +++DL +L  IY+  LQ
Sbjct: 350 KIDENVNIKDLAELAKIYQGILQ 372


>gi|254477341|ref|ZP_05090727.1| succinyl-diaminopimelate desuccinylase [Ruegeria sp. R11]
 gi|214031584|gb|EEB72419.1| succinyl-diaminopimelate desuccinylase [Ruegeria sp. R11]
          Length = 389

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 159/377 (42%), Positives = 217/377 (57%), Gaps = 11/377 (2%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA-PHLM- 68
            LI+C SVTP++GGA  +L   L   GF     D        V NL AR+G +A P  M 
Sbjct: 18  DLIRCASVTPEEGGALVLLEKLLSEAGFECSRAD-----RGEVSNLIARWGDKAHPKTMG 72

Query: 69  FAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFG 128
           F GH DVVP GD   WT  PF A   +G +YGRG  DMK  +A F+AA   ++      G
Sbjct: 73  FNGHTDVVPIGDAAAWTVDPFGAEEKDGFMYGRGATDMKSGVAAFVAAAVDYVRTTPPEG 132

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           ++ + ITGDEEG AI+GT  +L  +  +GE+   C+VGEPTC + +G+ IKIGRRGSLS 
Sbjct: 133 AVLITITGDEEGDAIDGTTAILDQMAAEGERMSVCLVGEPTCPNEMGEMIKIGRRGSLSA 192

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
             T+ G QGH AYPH   NP+  +  L+ +L +   D G   F  + + + TID GNP+ 
Sbjct: 193 WFTVTGVQGHSAYPHRANNPLNAMARLMDRLASHELDQGTEHFDASTLAVVTIDTGNPAT 252

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS-PVFLTH 307
           NVIPAQ + + NIRFND      L   +R+   K  +       T+  +  +S   F+T 
Sbjct: 253 NVIPAQARSTVNIRFNDAHTGADLSAWLRAEADKVAE---AFGVTIDMTVKISGESFITP 309

Query: 308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQ 367
              L+ L+  ++   TG +P LST+GGTSDARFIK +CPV+E GLVG+TMH ++E   + 
Sbjct: 310 PGALSDLVGAAVKAETGRMPELSTTGGTSDARFIKSHCPVVEIGLVGKTMHQVDERVDID 369

Query: 368 DLEDLTCIYENFLQNWF 384
            +  L  IY   L ++F
Sbjct: 370 QIHQLKAIYSRILNDYF 386


>gi|251790556|ref|YP_003005277.1| succinyl-diaminopimelate desuccinylase [Dickeya zeae Ech1591]
 gi|247539177|gb|ACT07798.1| succinyl-diaminopimelate desuccinylase [Dickeya zeae Ech1591]
          Length = 375

 Score =  290 bits (742), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 151/384 (39%), Positives = 229/384 (59%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLIKCPS++P D G   +++  L+ +GF IE  DF        +N +A  
Sbjct: 1   MSCPVIELAQQLIKCPSLSPDDAGCQALMIERLQAIGFVIETMDFGD-----TQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVP G+ + W  PPF  TI +G +YGRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGKTLAFAGHTDVVPAGNPSQWQTPPFEPTIRDGVLYGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  + N  G ++ LIT DEE  A+NGT K++  +  + E+ D C+VGEP+    +GD +K
Sbjct: 115 VAAHPNHQGRLAFLITSDEEASAVNGTVKVVEALMARQERLDYCLVGEPSSTERVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++  + IHG QGHVAYPHL +NP+  +IP LHQL +  +D GN  F PT+M+I 
Sbjct: 175 NGRRGSITANLRIHGVQGHVAYPHLADNPVHRVIPALHQLVDTVWDQGNEFFPPTSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  S NVIP ++ + FN RF+    ++ +K+++++ L     +  +L++T+ +   
Sbjct: 235 NINAGTGSNNVIPGELSVQFNFRFSTELTDELIKQQVKALL-----DSHQLNYTLEWQLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   +L   +  ++ + +   P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GHP-FLTGRGELVDAVVNAVEHYSEITPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            ++E  S  DL+ L+ +Y+  ++ 
Sbjct: 349 KVDECVSAADLQLLSRMYQRIMEQ 372


>gi|56460563|ref|YP_155844.1| succinyl-diaminopimelate desuccinylase [Idiomarina loihiensis L2TR]
 gi|81362149|sp|Q5QTZ3|DAPE_IDILO RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|56179573|gb|AAV82295.1| N-succinyl-diaminopimelate deacylase [Idiomarina loihiensis L2TR]
          Length = 376

 Score =  290 bits (742), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 159/384 (41%), Positives = 218/384 (56%), Gaps = 15/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+ + L+   +LI  PS+TP+D G   ++   L   GF++E   F+        NL+AR 
Sbjct: 1   MSSETLKFARELISRPSITPEDEGCQQLIGERLAAQGFNLESMIFED-----TTNLWARR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G       FAGH DVVPPGD N W +PPF  T  EG +YGRG  DMKGS+A  I A  RF
Sbjct: 56  GQGRKLFCFAGHTDVVPPGDINDWQFPPFEPTTHEGYLYGRGAADMKGSLAAMITATERF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           I  Y N    I  LIT DEEGP INGTK+++  ++++ E  D CIVGEP+    +GD +K
Sbjct: 116 IKDYPNVDADIGFLITSDEEGPFINGTKRVIETLQERNENIDWCIVGEPSSTDTLGDIVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+G++T+ G QGHVAYPHL +NP+  L P L +L N  +D GN +F PT  +++
Sbjct: 176 NGRRGSLTGDLTVLGIQGHVAYPHLAKNPVHDLAPALSELINEEWDQGNASFPPTTFQVS 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  + NVIP ++   FN RF+     + +K+ + + L        K S   H    
Sbjct: 236 NIQAGTGAGNVIPGRIDTQFNFRFSTELTAEKIKQRVEAIL-------DKHSLKYHLQWK 288

Query: 300 VS-PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTM 357
           ++ P FLT    L   +  +I +  G    LST+GGTSD RFI      VIE G V  T+
Sbjct: 289 LNGPPFLTESGALVEAVQAAIEHECGFSTTLSTAGGTSDGRFIAPTGAQVIELGPVNATI 348

Query: 358 HALNENASLQDLEDLTCIYENFLQ 381
           H +NE   + DL+ L+ +Y   L+
Sbjct: 349 HKVNECVKISDLDKLSDVYYRCLE 372


>gi|85374948|ref|YP_459010.1| succinyl-diaminopimelate desuccinylase [Erythrobacter litoralis
           HTCC2594]
 gi|122543782|sp|Q2N7X8|DAPE_ERYLH RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|84788031|gb|ABC64213.1| succinyl-diaminopimelate desuccinylase [Erythrobacter litoralis
           HTCC2594]
          Length = 378

 Score =  290 bits (742), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 161/383 (42%), Positives = 231/383 (60%), Gaps = 19/383 (4%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEE----KDFQTKNTSIVKNLYA-R 59
            L++  +LI  PSVTP  G  F  +   L+ LGF++      +  +  + + V+NL+A R
Sbjct: 4   ALDYAKRLIAAPSVTPATGAVFDEMQAMLEPLGFAVHRFTRGEGEEGSDEAPVENLFAIR 63

Query: 60  FGTE-APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
            G E + H  FAGH+DVVPPG+   WT  PF        +YGRG VDMKG+IAC + AVA
Sbjct: 64  HGPEGSKHFAFAGHLDVVPPGE--GWTSAPFEPEERGELLYGRGAVDMKGAIACMVDAVA 121

Query: 119 RFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
             +P+    G+IS +ITGDEEGPA++GT+ ++ ++  +G K D C+VGEPT  + +GD +
Sbjct: 122 N-VPQ--EAGTISFIITGDEEGPALHGTRALIDYMRSEGIKPDLCLVGEPTSVNRLGDMM 178

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGS++  + + G QGHVAYPHL  NP+  ++ +L +L N+  D G   F P+N+EI
Sbjct: 179 KIGRRGSVNIWLEVEGTQGHVAYPHLAGNPLPAMVEILRELNNLPLDEGTDWFQPSNLEI 238

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           T IDV N + NVIPA+ K   +IRFND  +  +L +++       I+   K   T     
Sbjct: 239 TEIDVPNRAHNVIPAKAKARISIRFNDTHSGASLSKQV-------IEIAEKHGGTARPVI 291

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
              P FLT     +S+++ ++   T   P  ST+GGTSDARF++  CPVIEFGL   TMH
Sbjct: 292 SGEP-FLTEPGAFSSMIAAAVKAETAIDPEPSTTGGTSDARFLRSVCPVIEFGLCNATMH 350

Query: 359 ALNENASLQDLEDLTCIYENFLQ 381
             +E  ++ DL+ L+ IY    Q
Sbjct: 351 KRDEAVAMADLDTLSRIYARVAQ 373


>gi|56479089|ref|YP_160678.1| succinyl-diaminopimelate desuccinylase [Aromatoleum aromaticum
           EbN1]
 gi|81598505|sp|Q5NYT7|DAPE_AZOSE RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|56315132|emb|CAI09777.1| predicted peptidase M20 [Aromatoleum aromaticum EbN1]
          Length = 384

 Score =  290 bits (741), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 166/380 (43%), Positives = 222/380 (58%), Gaps = 14/380 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           +LI   SVTP D G   ++   L  LGF  E  D     +S V NL+AR G  AP L FA
Sbjct: 15  ELISRSSVTPDDCGCLDLIAARLAPLGFRFERVD-----SSGVCNLWARRGGTAPVLCFA 69

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKN-FGS 129
           GH DVVP G  + W  PPF  T+  G+++GRG  DMK SIA F+ A+ RF+  + +  GS
Sbjct: 70  GHTDVVPAGPLDGWDSPPFEPTVRGGQLFGRGAADMKTSIAAFVTAIERFVATHPDHVGS 129

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I+LL+T DEEG A +GT K++  +  +GE+ D C+VGEPT  + +GDTIK GRRGSLSG 
Sbjct: 130 IALLLTSDEEGIATHGTVKVVEALAGRGERLDYCVVGEPTSVNTLGDTIKNGRRGSLSGT 189

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           + + G QGHVAYP L  NPI    P L +L +I +D GN  F PT  +++ I  G  + N
Sbjct: 190 LRVKGVQGHVAYPQLARNPIHEFAPALAELASIRWDEGNEFFPPTTWQVSNIHAGTGANN 249

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP   ++ FN RF  + +   L++     L +       L + + +     P FLT   
Sbjct: 250 VIPGTCEVLFNFRFASVSSADELRQRTHVVLDR-----HGLDYELDWHLSGKP-FLTGRG 303

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNENASLQD 368
           KL   LS +I +T G    LSTSGGTSD RFI D C  V+EFG V  T+H +NE+ +L  
Sbjct: 304 KLVEALSDAIRDTVGVETELSTSGGTSDGRFIADICNEVVEFGPVNATIHKVNESVALDA 363

Query: 369 LEDLTCIYENFLQNWFITPS 388
           +E L+ IYE  L N  + P+
Sbjct: 364 IEPLSAIYERTL-NALLLPN 382


>gi|315179438|gb|ADT86352.1| succinyl-diaminopimelate desuccinylase [Vibrio furnissii NCTC
           11218]
          Length = 378

 Score =  290 bits (741), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 153/376 (40%), Positives = 216/376 (57%), Gaps = 13/376 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI   SVTP D G   +++  L+ LGF IE   F+        N +AR GT+AP   FAG
Sbjct: 13  LISRQSVTPVDAGCQDLMIERLQALGFEIEMMVFEDTT-----NFWARRGTQAPLFAFAG 67

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVP G    W  PPF  T+ +  ++GRG  DMKGS+AC + AV RFI +Y N  GSI
Sbjct: 68  HTDVVPAGPLTQWHTPPFEPTVIDDHLHGRGAADMKGSLACMVVAVERFIAEYPNHTGSI 127

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           + LIT DEEGP INGT +++  +  + E  D C+VGEP+    +GD +K GRRGS++G++
Sbjct: 128 AFLITSDEEGPFINGTTRVVDTLMARNEIIDMCVVGEPSSTRAVGDVVKNGRRGSITGDL 187

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
           T+ G QGHVAYPHL  NP+   +P L +L +  +D GN  F PT+ +I  +  G  + NV
Sbjct: 188 TVKGVQGHVAYPHLANNPVHQALPALAELASTTWDEGNEYFPPTSFQIPNLQAGTGASNV 247

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IP +  + FN RF+    ++ +K  + S L     +   L + + ++    P FLT    
Sbjct: 248 IPGEFNVQFNFRFSTELTDEDIKRRVHSTL-----DAHGLEYDLKWTLSGHP-FLTDTGA 301

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDL 369
           L   + K++       P L T+GGTSD RFI      V+E G V  T+H +NE  ++ DL
Sbjct: 302 LLDAVVKAVGEVNHQEPQLLTTGGTSDGRFIAQMGAQVVELGPVNATIHKVNECVNIADL 361

Query: 370 EDLTCIYENFLQNWFI 385
           E LT +Y+  L+N  +
Sbjct: 362 EKLTDMYQKTLENLLV 377


>gi|238064827|sp|A6VUR6|DAPE_MARMS RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 377

 Score =  290 bits (741), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 162/386 (41%), Positives = 227/386 (58%), Gaps = 14/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+P  L+  + LI  PSVTP+D G   +++  LK +GF IE   F       VKN YA+ 
Sbjct: 1   MSP-TLKLALDLISRPSVTPEDAGCQDLMIERLKNIGFEIEYMPFGE-----VKNFYAKR 54

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   P+L FAGH DVVP G    W  PPF+  I +G +YGRG  DMKGS+A  + AV  F
Sbjct: 55  GNSGPNLCFAGHTDVVPTGPEAEWKIPPFAPEIVDGVLYGRGAADMKGSLAAMVTAVENF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + K+ N  G IS LIT DEEGP ++GT +++  + ++ E+ D CIVGEP+    +GD IK
Sbjct: 115 VAKHPNHSGQISFLITSDEEGPFVDGTTRVVDALMERNEQVDWCIVGEPSSTKTLGDIIK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS SG++T++GKQGHVAYPHL ENPI    P L ++ +  +D GN  F PT+ +++
Sbjct: 175 NGRRGSFSGDLTVYGKQGHVAYPHLAENPIHLAAPALAEMASSHWDDGNDFFPPTSFQVS 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  + NV+P ++   FN RF+   +   LK     R+I+ I +   L + + ++  
Sbjct: 235 NIHSGTGATNVVPGKLNAQFNFRFSSELDFDALK----VRVIE-ILDKHNLRYDIEWTYN 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFI-KDYCPVIEFGLVGRTMH 358
             P FLT   +L   + +++  T    P LSTSGGTSD RFI K    V+E G +  T+H
Sbjct: 290 GLP-FLTRPGELVDAIVEAVQATVNITPELSTSGGTSDGRFIAKMGTQVVELGPINATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            +NE    + L  L+ IY   L+N F
Sbjct: 349 QINECVDAESLNQLSEIYARILENLF 374


>gi|260767730|ref|ZP_05876665.1| N-succinyl-L,L-diaminopimelate desuccinylase [Vibrio furnissii CIP
           102972]
 gi|260617239|gb|EEX42423.1| N-succinyl-L,L-diaminopimelate desuccinylase [Vibrio furnissii CIP
           102972]
          Length = 378

 Score =  290 bits (741), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 153/376 (40%), Positives = 216/376 (57%), Gaps = 13/376 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI   SVTP D G   +++  L+ LGF IE   F+        N +AR GT+AP   FAG
Sbjct: 13  LISRQSVTPVDAGCQDLMIERLQALGFEIEMMVFEDTT-----NFWARRGTQAPLFAFAG 67

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVP G    W  PPF  T+ +  ++GRG  DMKGS+AC + AV RFI +Y N  GSI
Sbjct: 68  HTDVVPAGPLTQWHTPPFEPTVIDDHLHGRGAADMKGSLACMVVAVERFIAEYPNHTGSI 127

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           + LIT DEEGP INGT +++  +  + E  D C+VGEP+    +GD +K GRRGS++G++
Sbjct: 128 AFLITSDEEGPFINGTTRVVDTLMARNEIIDMCVVGEPSSTRAVGDVVKNGRRGSITGDL 187

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
           T+ G QGHVAYPHL  NP+   +P L +L +  +D GN  F PT+ +I  +  G  + NV
Sbjct: 188 TVKGVQGHVAYPHLANNPVHQALPALAELASTTWDEGNEYFPPTSFQIPNLQAGTGASNV 247

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IP +  + FN RF+    ++ +K  + S L     +   L + + ++    P FLT    
Sbjct: 248 IPGEFHVQFNFRFSTELTDEDIKRRVHSTL-----DAHGLEYDLKWTLSGHP-FLTDTGA 301

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDL 369
           L   + K++       P L T+GGTSD RFI      V+E G V  T+H +NE  ++ DL
Sbjct: 302 LLDAVVKAVGEVNHQEPQLLTTGGTSDGRFIAQMGAQVVELGPVNATIHKVNECVNIADL 361

Query: 370 EDLTCIYENFLQNWFI 385
           E LT +Y+  L+N  +
Sbjct: 362 EKLTDMYQKTLENLLV 377


>gi|311107249|ref|YP_003980102.1| succinyl-diaminopimelate desuccinylase [Achromobacter xylosoxidans
           A8]
 gi|310761938|gb|ADP17387.1| succinyl-diaminopimelate desuccinylase [Achromobacter xylosoxidans
           A8]
          Length = 377

 Score =  289 bits (740), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 163/388 (42%), Positives = 220/388 (56%), Gaps = 13/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   L+ +  LI  PSVTP D      L   L+ +GF+ E     T     V NL+AR 
Sbjct: 1   MSTAVLDLVKDLIARPSVTPADEDCQATLAARLERIGFTCE-----TIAQGGVTNLWARR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G+ AP  +FAGH DVVPPG    W   PF  T  +G +YGRG  DMK SIA F+ A   F
Sbjct: 56  GSAAPLAVFAGHTDVVPPGPREKWDSDPFVPTERDGYLYGRGAADMKSSIAAFVVAAEEF 115

Query: 121 IPKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  + ++ GSI+LLIT DEEGP+I+GT  +   ++ +GE+ D CIVGEPT   ++GDT K
Sbjct: 116 VAAHPQHGGSIALLITSDEEGPSIDGTAIVCDALKARGEQMDYCIVGEPTSGDVLGDTCK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSLSG++T+ G QGHVAYPHL  NP+  L P L  + NI +D GN  F PT  +++
Sbjct: 176 NGRRGSLSGKLTVKGIQGHVAYPHLARNPVHQLAPALADIVNIEWDQGNEYFPPTTFQVS 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            ++ G  + NV+P +    FN RF+     + L+  +   L +       L +T+ +   
Sbjct: 236 NLNSGTGATNVVPGEAVALFNFRFSTASTPEGLQARVHEVLDRH-----GLEYTLDWELG 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMH 358
             P FLT    LT  L  +I + TG    LST+GGTSD RFI   CP VIEFG    T+H
Sbjct: 291 GEP-FLTPRGSLTDALVSAIRDETGVTAELSTTGGTSDGRFIAKICPQVIEFGPCNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFIT 386
            +NE   +  L+ L  IY   L+N  + 
Sbjct: 350 KVNERVEVASLDPLKNIYRRTLENLLLA 377


>gi|146276106|ref|YP_001166265.1| succinyl-diaminopimelate desuccinylase [Rhodobacter sphaeroides
           ATCC 17025]
 gi|238064804|sp|A4WNJ6|DAPE_RHOS5 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|145554347|gb|ABP68960.1| succinyldiaminopimelate desuccinylase [Rhodobacter sphaeroides ATCC
           17025]
          Length = 380

 Score =  289 bits (740), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 156/377 (41%), Positives = 229/377 (60%), Gaps = 11/377 (2%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            L++CPSVTP++GGA  +L   L   GF     D +  + + V NL+AR+G +  +  F 
Sbjct: 11  DLVRCPSVTPEEGGALVLLERILTEAGF-----DCRRVDRNGVPNLFARWGRKGANRTFG 65

Query: 71  --GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFG 128
             GH DVVP GD   WT  PF   IA+G ++GRG  DMK  +A F+AA   F+ +    G
Sbjct: 66  FNGHTDVVPVGDAAAWTRDPFGGEIADGWLWGRGATDMKSGVAAFVAAAVDFVQETPPDG 125

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           ++ L ITGDEEG +++GT  +L W+  +GE    C+VGEPTC   +G+ +KIGRRGS++ 
Sbjct: 126 AVILTITGDEEGDSVDGTTALLDWMATEGEAMTVCLVGEPTCPERLGEMMKIGRRGSMTA 185

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
             T  G QGH AYPH  +NP+  +  L+ +L +   D G   F P+ + +TTID GNP+ 
Sbjct: 186 FFTARGVQGHSAYPHRAKNPVSAMARLIDRLASHELDKGTGHFDPSTLAVTTIDTGNPAT 245

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS-PVFLTH 307
           NVIPA  + + NIRFND  +  +L   IR    +  +   +    +  S+ +S   FLT 
Sbjct: 246 NVIPALCRATVNIRFNDRHSGASL---IRWLEQEAAEVAAETGVEIGLSAKISGESFLTP 302

Query: 308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQ 367
             +L+ L+++++   TG  P  STSGGTSDARF++ +CPV+EFGLVG+TMH ++E   + 
Sbjct: 303 PGELSELVARAVEAETGLRPEPSTSGGTSDARFVRAHCPVVEFGLVGKTMHQVDERVEVA 362

Query: 368 DLEDLTCIYENFLQNWF 384
            +E L  IY+  L+++F
Sbjct: 363 QIEPLKAIYKRILKDYF 379


>gi|317405181|gb|EFV85522.1| succinyl-diaminopimelate desuccinylase [Achromobacter xylosoxidans
           C54]
          Length = 405

 Score =  289 bits (740), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 164/382 (42%), Positives = 216/382 (56%), Gaps = 13/382 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           L+ +  LI  PSVTP D      L   L  +GF+ E     T     V NL+AR G  AP
Sbjct: 32  LDLVKDLIARPSVTPADADCQATLAARLARIGFTCE-----TIAQGGVTNLWARRGDTAP 86

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY- 124
             +FAGH DVVPPG    W   PF  T  +G +YGRG  DMK SIA F+ A   F+    
Sbjct: 87  LAVFAGHTDVVPPGPREKWESDPFVPTERDGYLYGRGAADMKSSIAAFVVAAEEFVAANP 146

Query: 125 KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           ++ GSI+LLIT DEEGP+I+GT  +   ++ +GE+ D CIVGEPT   ++GDT K GRRG
Sbjct: 147 RHGGSIALLITSDEEGPSIDGTAIVCDTLKARGEQMDYCIVGEPTSGDVLGDTCKNGRRG 206

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG++T+ G QGHVAYPHL  NP+  L P L ++  I +D GN  F PT  +++ ++ G
Sbjct: 207 SLSGKLTVKGIQGHVAYPHLARNPVHQLAPALAEIVAIEWDQGNEYFPPTTFQVSNLNSG 266

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
             + NV+P +    FN RF+     + LK  +   L +       L +T+ +     P F
Sbjct: 267 TGATNVVPGEAVALFNFRFSTASTPEGLKARVHEVLDRH-----GLEYTLDWELGGEP-F 320

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMHALNEN 363
           LT    LT  L K+I + TG    LST+GGTSD RFI   CP VIEFG    T+H +NE 
Sbjct: 321 LTPRGSLTDALVKAIRDETGVTAELSTTGGTSDGRFIAKICPQVIEFGPCNATIHKVNER 380

Query: 364 ASLQDLEDLTCIYENFLQNWFI 385
             L  L+ L  IY   L+N  +
Sbjct: 381 IELASLDPLKNIYRRTLENLLL 402


>gi|237807902|ref|YP_002892342.1| succinyl-diaminopimelate desuccinylase [Tolumonas auensis DSM 9187]
 gi|259595048|sp|C4LDG0|DAPE_TOLAT RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|237500163|gb|ACQ92756.1| succinyl-diaminopimelate desuccinylase [Tolumonas auensis DSM 9187]
          Length = 380

 Score =  289 bits (740), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 165/376 (43%), Positives = 219/376 (58%), Gaps = 13/376 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI  PSVTP D G   ++   L  LGF IE   F         NL+AR GT  P   FAG
Sbjct: 13  LIARPSVTPIDEGCQKMMAEFLAPLGFEIEPMVFHD-----TTNLWARRGTTGPVFCFAG 67

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSI 130
           H DVVP G    W  PPF  TI +G +YGRG  DMKGSIA  +AAV RF   Y  + GSI
Sbjct: 68  HTDVVPSGPAEKWHTPPFEPTIIDGMLYGRGAADMKGSIASMMAAVQRFTTDYPAHQGSI 127

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           + LIT DEEGP INGT K++  +E + EK   C+VGEP+  + +GD +K GRRGSL+G++
Sbjct: 128 AFLITSDEEGPFINGTPKVIETLEARQEKITWCLVGEPSSTNHVGDVVKNGRRGSLTGDL 187

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
           TI+G QGHVAYPHL ENP+   IP L++L +  +D GN  F  T+ +I  I+ G  + NV
Sbjct: 188 TIYGIQGHVAYPHLAENPVHLAIPALNELASKQWDQGNEFFPATSFQIANINSGTGASNV 247

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IP ++++ FN R++    +  +K+++ +     I +   L + + ++    P FLT   K
Sbjct: 248 IPGEMQVQFNFRYSTELTDSQIKQQVAA-----ILDNHGLRYELKWTLSGQP-FLTGSGK 301

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDL 369
           L      +I   TG    LSTSGGTSD RFI      VIE G V  T+H +NE   + DL
Sbjct: 302 LVEATQNAIKAITGQETELSTSGGTSDGRFIAPTGAQVIELGPVNATIHKVNECVRVADL 361

Query: 370 EDLTCIYENFLQNWFI 385
           E L+ IY N +Q   +
Sbjct: 362 ETLSDIYYNMMQQLLV 377


>gi|315633832|ref|ZP_07889121.1| succinyl-diaminopimelate desuccinylase [Aggregatibacter segnis ATCC
           33393]
 gi|315477082|gb|EFU67825.1| succinyl-diaminopimelate desuccinylase [Aggregatibacter segnis ATCC
           33393]
          Length = 377

 Score =  289 bits (740), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 163/381 (42%), Positives = 225/381 (59%), Gaps = 17/381 (4%)

Query: 8   HLIQL----IKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           H+IQL    I+ PS++P D G   ++   L+ LGF IE   F   N ++  NL+A+ G+ 
Sbjct: 4   HIIQLSQSLIRRPSISPNDEGCQQLIAERLEKLGFHIEWMPF---NDTL--NLWAKHGSG 58

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            P + FAGH DVVP GD + WTYPPFSA I +G +YGRG  DMKGS+A  I AV  ++  
Sbjct: 59  EPVIAFAGHTDVVPTGDESQWTYPPFSAEIVDGMLYGRGAADMKGSLAAMIVAVEEYVKA 118

Query: 124 YKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
             N  G+I+LLIT DEE  A +GT +++  +  +GEK   C+VGEP+ + I+GD +K GR
Sbjct: 119 NPNHEGTIALLITSDEEATAKDGTVRVVESLMARGEKITYCMVGEPSSSKILGDVVKNGR 178

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGS++G + I G QGHVAYPHL ENPI    P L +LT   +D GN  F PT+++I  I 
Sbjct: 179 RGSITGNLYIQGVQGHVAYPHLAENPIHKAAPFLQELTTYQWDNGNEFFPPTSLQIANIH 238

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
            G  S NVIP ++ + FN+R+     ++ +K+++   L K       L + + ++    P
Sbjct: 239 AGTGSNNVIPGELYVQFNLRYCTEVTDEIIKQKVAEMLEK-----HGLKYRMEWNLSGKP 293

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALN 361
            FLT   KL   L+ +I  TTG  P   T GGTSD RFI      V+EFG +  T+H +N
Sbjct: 294 -FLTKPGKLLDALTAAIEQTTGITPQAETGGGTSDGRFIALMGAEVVEFGPLNATIHKVN 352

Query: 362 ENASLQDLEDLTCIYENFLQN 382
           E  S+ DL     IY   L N
Sbjct: 353 ECVSVDDLAKCGQIYHQMLVN 373


>gi|227355898|ref|ZP_03840290.1| N-succinyl-diaminopimelate deacylase [Proteus mirabilis ATCC 29906]
 gi|227163886|gb|EEI48788.1| N-succinyl-diaminopimelate deacylase [Proteus mirabilis ATCC 29906]
          Length = 376

 Score =  289 bits (739), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 161/384 (41%), Positives = 224/384 (58%), Gaps = 13/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI  PSV+P D G   +++  L  LGF+IE+  F        +NL+A  
Sbjct: 1   MSCPVIELAQQLISRPSVSPDDQGCQQLIIERLAPLGFTIEKMPFGQ-----TENLWACR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G E   L FAGH DVVPPG    W  PPF  +I +G +YGRG  DMKGS+A  + A  RF
Sbjct: 56  GGEGETLAFAGHTDVVPPGANALWDNPPFEPSIRDGMLYGRGAADMKGSLAAMVVAAERF 115

Query: 121 IPKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  Y ++ G ++ LIT DEE  A +GT K++  +  +GE+ D C+VGEP+  H +GD IK
Sbjct: 116 VHAYPQHRGRLAFLITSDEEADAHDGTVKVVESLISRGERLDYCLVGEPSSQHQLGDMIK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++  +TI+G QGHVAYPHL +NPI    P +H+L N  +D GN  F  T M+I 
Sbjct: 176 NGRRGSITANVTIYGTQGHVAYPHLAQNPIHMASPFIHELVNTVWDNGNEYFPATTMQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  S NVIP ++ + FN RF+    +    EEIR R    +Q   +L + + +S  
Sbjct: 236 NINSGTGSNNVIPGELFIQFNFRFSTAITD----EEIRQRTEALLQKY-QLRYHISWSLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P F+T + KL   +  S+ + T   P LSTSGGTSD RFI      V+E G +  T+H
Sbjct: 291 GQP-FITGEGKLLDAVRYSVKHYTNIEPTLSTSGGTSDGRFIAQMGAQVVELGPINATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  S  DL+ L+ IY+  ++ 
Sbjct: 350 KVNECVSAADLQQLSRIYQRIMEQ 373


>gi|152995295|ref|YP_001340130.1| succinyl-diaminopimelate desuccinylase [Marinomonas sp. MWYL1]
 gi|150836219|gb|ABR70195.1| succinyl-diaminopimelate desuccinylase [Marinomonas sp. MWYL1]
          Length = 380

 Score =  289 bits (739), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 160/381 (41%), Positives = 224/381 (58%), Gaps = 13/381 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           L+  + LI  PSVTP+D G   +++  LK +GF IE   F       VKN YA+ G   P
Sbjct: 8   LKLALDLISRPSVTPEDAGCQDLMIERLKNIGFEIEYMPFGE-----VKNFYAKRGNSGP 62

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
           +L FAGH DVVP G    W  PPF+  I +G +YGRG  DMKGS+A  + AV  F+ K+ 
Sbjct: 63  NLCFAGHTDVVPTGPEAEWKIPPFAPEIVDGVLYGRGAADMKGSLAAMVTAVENFVAKHP 122

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           N  G IS LIT DEEGP ++GT +++  + ++ E+ D CIVGEP+    +GD IK GRRG
Sbjct: 123 NHSGQISFLITSDEEGPFVDGTTRVVDALMERNEQVDWCIVGEPSSTKTLGDIIKNGRRG 182

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           S SG++T++GKQGHVAYPHL ENPI    P L ++ +  +D GN  F PT+ +++ I  G
Sbjct: 183 SFSGDLTVYGKQGHVAYPHLAENPIHLAAPALAEMASSHWDDGNDFFPPTSFQVSNIHSG 242

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
             + NV+P ++   FN RF+   +   LK     R+I+ I +   L + + ++    P F
Sbjct: 243 TGATNVVPGKLNAQFNFRFSSELDFDALK----VRVIE-ILDKHNLRYDIEWTYNGLP-F 296

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFI-KDYCPVIEFGLVGRTMHALNEN 363
           LT   +L   + +++  T    P LSTSGGTSD RFI K    V+E G +  T+H +NE 
Sbjct: 297 LTRPGELVDAIVEAVQATVNITPELSTSGGTSDGRFIAKMGTQVVELGPINATIHQINEC 356

Query: 364 ASLQDLEDLTCIYENFLQNWF 384
              + L  L+ IY   L+N F
Sbjct: 357 VDAESLNQLSEIYARILENLF 377


>gi|145299806|ref|YP_001142647.1| succinyl-diaminopimelate desuccinylase [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|238055201|sp|A4SPS7|DAPE_AERS4 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|142852578|gb|ABO90899.1| succinyl-diaminopimelate desuccinylase [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 375

 Score =  288 bits (738), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 157/381 (41%), Positives = 218/381 (57%), Gaps = 13/381 (3%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +     LI+ PSVTPQD G   ++   L  LGF IE   F+        NL+AR G+E
Sbjct: 3   DVIALAKDLIRRPSVTPQDEGCQTLMSERLARLGFVIEPMVFEDTT-----NLWARRGSE 57

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            P   FAGH DVVP G    W  PPF  TI +G +YGRG  DMKGS+A  + AV RF+ +
Sbjct: 58  GPLFCFAGHTDVVPAGPLEKWHTPPFEPTIQDGVLYGRGAADMKGSLAAMVVAVERFVAE 117

Query: 124 YKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
           + +  GSI+ LIT DEEGP INGT +++  +E + EK   CIVGEP+  H++GD +K GR
Sbjct: 118 HPDHKGSIAFLITSDEEGPFINGTVRVIDTLEARNEKIRWCIVGEPSSTHVVGDVVKNGR 177

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGS++G++ + G QGHVAYPHL +NPI    P L +L    +D GN  F PT+ +I  I 
Sbjct: 178 RGSITGDLLVRGVQGHVAYPHLADNPIHKAAPALTELAATVWDEGNAYFPPTSFQIANIQ 237

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
            G  + NVIP ++++ FN RF+    +  ++E +++ L K       L + + ++    P
Sbjct: 238 AGTGASNVIPGELQVQFNFRFSTQLTDMDIRERVQALLDKH-----GLDYELTWTLSGQP 292

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALN 361
            FLT    L      ++    G  P L T+GGTSD RFI      VIE G V  T+H +N
Sbjct: 293 -FLTDTGALLEATVAAVAAVNGQQPALLTTGGTSDGRFIAPTGAEVIELGPVNATIHKVN 351

Query: 362 ENASLQDLEDLTCIYENFLQN 382
           E    +DL+ L  +Y+  L+ 
Sbjct: 352 ECVKAEDLDLLAEMYQGVLER 372


>gi|269103219|ref|ZP_06155916.1| N-succinyl-L,L-diaminopimelate desuccinylase [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268163117|gb|EEZ41613.1| N-succinyl-L,L-diaminopimelate desuccinylase [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 377

 Score =  288 bits (738), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 159/372 (42%), Positives = 224/372 (60%), Gaps = 13/372 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           L+   SVTP+D G   +++  L+ LGF IE   F         NL+AR GT+AP  +FAG
Sbjct: 13  LLSRRSVTPEDAGCQDVMIERLRQLGFCIETMVFNDTT-----NLWARRGTQAPLFVFAG 67

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVP G    W  PPF  TI +G +YGRG  DMKGS+AC I A+ RFI +  +  GSI
Sbjct: 68  HTDVVPSGPIEQWHTPPFEPTIKDGMLYGRGAADMKGSLACMIVAIERFIAENPDHQGSI 127

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
            LLIT DEEGP INGT +++  +E + EK D CIVGEP+   ++GD +K GRRGS++G++
Sbjct: 128 GLLITSDEEGPFINGTTRVVDTLEARNEKIDLCIVGEPSSTLVVGDVVKNGRRGSITGDL 187

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
           T+ G QGHVAYPHL +NP+   +P L +L    +D GN  F PT+ +I  I+ G  + NV
Sbjct: 188 TVKGIQGHVAYPHLADNPVHRALPALAELAAKTWDNGNDYFPPTSFQIPNINAGTGASNV 247

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           +P + ++ FN RF+    ++ +K ++       I +  +L + ++++    P FLT    
Sbjct: 248 VPGECQVQFNFRFSTELTDEAIKAQVHE-----ILDQHQLDYHLNWTLSGHP-FLTEKGT 301

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFI-KDYCPVIEFGLVGRTMHALNENASLQDL 369
           L   +  +I       P LSTSGGTSD RFI +    VIE G V  T+H +NE   ++DL
Sbjct: 302 LVDAVVAAIEEVAHITPELSTSGGTSDGRFIARTGAQVIELGPVNATIHKVNECVKIEDL 361

Query: 370 EDLTCIYENFLQ 381
           E LT +Y+  L+
Sbjct: 362 ELLTDMYQKVLE 373


>gi|217970598|ref|YP_002355832.1| succinyl-diaminopimelate desuccinylase [Thauera sp. MZ1T]
 gi|217507925|gb|ACK54936.1| succinyl-diaminopimelate desuccinylase [Thauera sp. MZ1T]
          Length = 385

 Score =  288 bits (738), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 157/377 (41%), Positives = 224/377 (59%), Gaps = 13/377 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           +LI  PSVTP+D G   ++ + L  LGF +E  D     +  V NL+AR G  AP L FA
Sbjct: 16  ELIARPSVTPEDAGCLELVASRLAPLGFRLERID-----SGGVCNLWARRGIAAPVLCFA 70

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVPPG  + W+ PPF+ TI +G +YGRG  DMK S+A F+ A+ RF+  + +  GS
Sbjct: 71  GHTDVVPPGPDSAWSSPPFAPTIRDGVLYGRGAADMKSSLAAFVTAIERFVAAHPDHAGS 130

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I+LL+T DEEG A +GT K++  +  +GE+ D C+VGEPT    +GD IK GRRGSLSG 
Sbjct: 131 IALLLTSDEEGIATHGTVKVVEALAARGERLDYCVVGEPTSVQTLGDMIKNGRRGSLSGT 190

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           + + G+QGHVAYP L  NPI    P L +L    +D GN  F PT  +++ I  G  + N
Sbjct: 191 LRVKGQQGHVAYPQLARNPIHLFAPALAELAASDWDQGNEFFPPTTWQVSNIHAGTGANN 250

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP   ++ FN RF  +    +  +E++SR  + + +   L + + +     P F+T   
Sbjct: 251 VIPGVCEVMFNFRFGSV----SSADELKSRTCE-VLDRHGLDYEIDWHLSGKP-FITGRG 304

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMHALNENASLQD 368
           +L   LS +I  T G    LST+GGTSD RFI + C  V+EFG V  ++H ++E+ +   
Sbjct: 305 RLVGALSAAIRETLGVETELSTTGGTSDGRFIAEICAEVVEFGPVNASIHKIDEHIAADA 364

Query: 369 LEDLTCIYENFLQNWFI 385
           +E L+ +YE  L    +
Sbjct: 365 IEPLSVVYERTLTALLV 381


>gi|88812373|ref|ZP_01127623.1| succinyl-diaminopimelate desuccinylase [Nitrococcus mobilis Nb-231]
 gi|88790380|gb|EAR21497.1| succinyl-diaminopimelate desuccinylase [Nitrococcus mobilis Nb-231]
          Length = 378

 Score =  288 bits (737), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 150/373 (40%), Positives = 217/373 (58%), Gaps = 14/373 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           +LI+ PS+TP+D G   +L   L+ LGF  E   F       VKNL+AR+G   P L F 
Sbjct: 12  ELIRRPSLTPEDAGCQTLLATRLEALGFRCEHLAFGE-----VKNLWARYGNSGPLLTFV 66

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKN--FG 128
           GH DVVP G    WT PPF  ++ +G++YGRG  DMKGS+A F+ A  RF+   +    G
Sbjct: 67  GHTDVVPSGPEMQWTTPPFEPSLRQGQLYGRGAADMKGSLAAFVTACERFLGDNRGPLRG 126

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           S++LLIT DEEG AI+GT +++  +  +GE+ D C+VGEP+   +IGDTIKIGRRGSL G
Sbjct: 127 SVALLITSDEEGDAIDGTARVVRALRARGERIDMCLVGEPSSEVVIGDTIKIGRRGSLHG 186

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
            +T+ G QGHVAYP    NPI    P L +LT+  +D GN +F PT M+I+ I  G  + 
Sbjct: 187 HLTVRGIQGHVAYPQRASNPIHQFAPALLELTSRRWDNGNASFPPTTMQISNIHAGTGAT 246

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHD 308
           NVIP  ++   N R+      + ++ E+     +       L + + +     P FLT  
Sbjct: 247 NVIPGSLQADINFRYCTELTAEDIRFEVEHTFER-----HDLEYQIDWRLSAQP-FLTEQ 300

Query: 309 RKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQ 367
             L      ++++ TG     ST+GGTSD RF+      VIE G + +T+H ++E+A + 
Sbjct: 301 GPLLDAALAAVHDVTGRHARTSTAGGTSDGRFVASTGAQVIELGPINQTIHQVDEHAGIA 360

Query: 368 DLEDLTCIYENFL 380
           +L  ++ +YE+ L
Sbjct: 361 ELNTISAVYEHIL 373


>gi|262276456|ref|ZP_06054265.1| N-succinyl-L,L-diaminopimelate desuccinylase [Grimontia hollisae
           CIP 101886]
 gi|262220264|gb|EEY71580.1| N-succinyl-L,L-diaminopimelate desuccinylase [Grimontia hollisae
           CIP 101886]
          Length = 378

 Score =  288 bits (737), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 153/373 (41%), Positives = 220/373 (58%), Gaps = 13/373 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           +LI  PSVTP D G   +++  L+ LGF+IE   F+        NL+AR GTEAP   FA
Sbjct: 12  ELIGRPSVTPDDAGCQELMIKRLEALGFTIERMVFEDTT-----NLWARRGTEAPLFAFA 66

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVP G  + W  PPF  T+ +G ++GRG  DMKGS+A  + A  RFI ++ +  GS
Sbjct: 67  GHTDVVPAGPEDQWHTPPFEPTVIDGYLHGRGAADMKGSLAAMVVATERFIAEHPDHKGS 126

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           ++ LIT DEEGP INGT +++  +  + E  D CIVGEP+  H +GD +K GRRGS++G+
Sbjct: 127 LAFLITSDEEGPFINGTTRVVDTLMARDELIDMCIVGEPSSTHAVGDVVKNGRRGSITGD 186

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +T+ G QGHVAYPHL  NP+   +P L +LT + +D GN  F PT+ +I  +  G  + N
Sbjct: 187 LTVKGIQGHVAYPHLANNPVHQALPALAELTAMQWDQGNEYFPPTSFQIPNVAAGTGASN 246

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP +  + FN+R++       L +E   R    + +   L + + ++    P FLT   
Sbjct: 247 VIPGEFHVQFNLRYS-----TELTDEDIQRRTHSVLDAHGLDYDIKWTFNGKP-FLTDAG 300

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQD 368
            L   + +++ +     P L T+GGTSD RFI      VIE G V  T+H +NE  ++ D
Sbjct: 301 SLLDAVVEAVDDVNHEKPQLLTTGGTSDGRFIAQMGGQVIELGPVNATIHKVNECVNVAD 360

Query: 369 LEDLTCIYENFLQ 381
           LE LT +Y+  L+
Sbjct: 361 LEKLTDMYQKVLE 373


>gi|257455197|ref|ZP_05620432.1| succinyl-diaminopimelate desuccinylase [Enhydrobacter aerosaccus
           SK60]
 gi|257447159|gb|EEV22167.1| succinyl-diaminopimelate desuccinylase [Enhydrobacter aerosaccus
           SK60]
          Length = 412

 Score =  288 bits (737), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 166/391 (42%), Positives = 224/391 (57%), Gaps = 17/391 (4%)

Query: 10  IQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNT----SIVKNLYA----RFG 61
           +QL++ PSVTP D     IL   L  LGF  E   F  K T    + VKNL+A    R  
Sbjct: 23  LQLMREPSVTPTDLDCQNILAERLNHLGFDCEFLYFGEKGTTGREAEVKNLWAIRQGRGQ 82

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
            +AP L FAGH DVVP GD + WTYPPF  TI +G +YGRG  DMK +IA F  AV  F+
Sbjct: 83  AQAPVLCFAGHTDVVPTGDVSQWTYPPFEPTIKDGILYGRGAADMKTAIAAFTVAVENFV 142

Query: 122 PKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
            K+ N  GSI+ LIT DEEGP++NGT K++  ++ + +    C++GEP+  H +GD IK 
Sbjct: 143 AKHPNHHGSIAFLITADEEGPSVNGTIKVVETLQSRNQPITYCLIGEPSSTHTLGDIIKN 202

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGSL   +T+ GKQGHVAYPHL  NPI   +P L +L +  +D GN  F  T ++I+ 
Sbjct: 203 GRRGSLGAVVTVTGKQGHVAYPHLAVNPIHYALPALSELCSQTWDNGNAYFPATTLQISN 262

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV 300
           +  G  + NVIPA +   FN RF+   N++ LK    +   K  Q+    S+ +++    
Sbjct: 263 LHAGTGANNVIPATLSAEFNFRFSTETNDEKLKATTHAIFDKHFQD-GAASYHINWKLSG 321

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-----DYCP-VIEFGLVG 354
           +P FLT    L      +I   TG    LST+GGTSD RFI      +  P V+E G+  
Sbjct: 322 NP-FLTPQGNLVGACQSAIKAVTGTDTELSTTGGTSDGRFIATLNVDNRSPEVVELGVRN 380

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNWFI 385
            T+H ++E   ++DL  L  IYE  LQN  +
Sbjct: 381 ATIHQIDECVEVEDLGKLAAIYEQILQNLLL 411


>gi|255264415|ref|ZP_05343757.1| succinyl-diaminopimelate desuccinylase [Thalassiobium sp. R2A62]
 gi|255106750|gb|EET49424.1| succinyl-diaminopimelate desuccinylase [Thalassiobium sp. R2A62]
          Length = 383

 Score =  288 bits (737), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 155/377 (41%), Positives = 218/377 (57%), Gaps = 11/377 (2%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           +L++CPSVTP++GGA  +L   L   GF     D        + NL+AR+G  A    F 
Sbjct: 14  ELVRCPSVTPEEGGALVLLDTLLSAHGFECTRVD-----RGGISNLFARWGDRADPRTFG 68

Query: 71  --GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFG 128
             GH DVVP GD N WT  PF A I +G +YGRG  DMK  +A F AA   F+      G
Sbjct: 69  FNGHTDVVPIGDINDWTVDPFGAEIKDGFLYGRGSTDMKSGVAAFAAAAIDFVQTTPPNG 128

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           ++ L ITGDEE  A +GT  +L W++  GE+   C+VGEPT  + +G+ IKIGRRGSL+ 
Sbjct: 129 ALILAITGDEEDVAEHGTVALLDWMQANGEQMTDCLVGEPTSPNHMGEMIKIGRRGSLTT 188

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
             T+ GKQGH AYPH   NPI  ++ L+ +L +   D G   F  + + + T+D GNP+ 
Sbjct: 189 YFTVTGKQGHSAYPHRANNPIPAMMRLMDRLASHTLDDGTEHFDASTLAVVTVDTGNPAT 248

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS-PVFLTH 307
           NVIPA+ + + NIRFND      L + +     +  Q   +    +   + +S   F+T 
Sbjct: 249 NVIPAECRATVNIRFNDAHTGAALTDWLDD---QASQIAAEFGVEISTKTKISGESFITP 305

Query: 308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQ 367
              L+ L+S+++   T   P +STSGGTSDARF+K +CPV+E GLVG+TMHA++E   + 
Sbjct: 306 PGALSQLISEAVQTETNRTPEMSTSGGTSDARFVKHHCPVVECGLVGKTMHAVDERVEVA 365

Query: 368 DLEDLTCIYENFLQNWF 384
            +  L  IY   L+ +F
Sbjct: 366 QIHQLKSIYARILERYF 382


>gi|302878940|ref|YP_003847504.1| succinyl-diaminopimelate desuccinylase [Gallionella
           capsiferriformans ES-2]
 gi|302581729|gb|ADL55740.1| succinyl-diaminopimelate desuccinylase [Gallionella
           capsiferriformans ES-2]
          Length = 376

 Score =  288 bits (736), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 160/374 (42%), Positives = 224/374 (59%), Gaps = 15/374 (4%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI   S+TP D G   IL+  L+ LGF+IE   F       V N +AR G  AP ++FAG
Sbjct: 11  LIARRSLTPDDAGCQEILIERLEKLGFTIERMRFGN-----VDNFWARRGINAPVVVFAG 65

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSI 130
           H DVVP G    W  PPF  TI +  ++GRG  DMK SIA FI A+  F+  + ++ GSI
Sbjct: 66  HTDVVPSGPVESWFSPPFEPTIRDEMLFGRGAADMKTSIAAFITAIEAFVEDHPQHDGSI 125

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           +LLIT DEEG A++GT +++  ++ +GE  D CIVGEPT N ++GD IK GRRGSL+G +
Sbjct: 126 ALLITSDEEGVAVDGTVRVVEALQARGETLDYCIVGEPTSNKLVGDMIKNGRRGSLNGTL 185

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
            + G QGH+AYPHL +NPI  + P + +L    +D GN  F PT+ +I+ ++ G  + NV
Sbjct: 186 VVQGVQGHIAYPHLVKNPIHMVSPAIAELATTVWDEGNEYFPPTSWQISNMNGGTGATNV 245

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           +P  V + FN RF+    E  LK  + + L K G++      + + +     P ++T   
Sbjct: 246 VPGTVDILFNFRFSTASTELELKNRVHAILDKHGVK------YDLLWELSGKP-YITPKG 298

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMHALNENASLQD 368
            L   +S++I  + G  P LSTSGGTSD RFI D C  VIEFG +  T+H LNE  ++ D
Sbjct: 299 NLVEAISRAIEQSYGITPELSTSGGTSDGRFIADICAQVIEFGPLNATIHKLNECVAVAD 358

Query: 369 LEDLTCIYENFLQN 382
           +E L   Y+  L+N
Sbjct: 359 IEPLKLTYQRTLEN 372


>gi|221090601|ref|XP_002158805.1| PREDICTED: similar to CG11679 CG11679-PA [Hydra magnipapillata]
          Length = 874

 Score =  288 bits (736), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 159/371 (42%), Positives = 219/371 (59%), Gaps = 12/371 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI   SVTP        +   L+ + F I    F+      V NLYA  G  +PH+++ G
Sbjct: 502 LINFKSVTPLGRDCLDFIAEYLQNIDFKITRLPFED-----VDNLYAVKGQGSPHILYVG 556

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H+DVVP GD   W Y P+SA I    +YGRG VDMKGSIA F+AAVA    K +NF G+I
Sbjct: 557 HVDVVPEGD--GWKYDPYSAIIENEILYGRGAVDMKGSIAAFLAAVA----KLENFQGTI 610

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           S+++T DEEGPA NG  K++ W++ +G K D  + GEPT    +GDTIK GRRGS++ EI
Sbjct: 611 SIMLTTDEEGPAKNGVAKIIPWLQAQGIKPDYALTGEPTSVEKVGDTIKNGRRGSITFEI 670

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
           T++G QGHVAYP L +NP   L+  LH+L  I  D G   F  +N+EI  + + N + NV
Sbjct: 671 TVNGVQGHVAYPKLAKNPATVLVHYLHELKQIKLDEGTIDFDASNLEIVKMHIPNSANNV 730

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           I AQ   S N+RFN   N  +L   ++ +    ++N  +  +    + P +  F+ +   
Sbjct: 731 IAAQALASVNVRFNPSHNFASLTNLLQQKADSVLKNYDRGINITIDAKPSAEPFVNNSAS 790

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDLE 370
            T +L +++   TG +P LSTSGGTSDARF+   CPV+E GL  +T H  NE  +L+DLE
Sbjct: 791 WTKILQEAVLKVTGFMPNLSTSGGTSDARFVYKLCPVLELGLSNKTAHHKNECVALKDLE 850

Query: 371 DLTCIYENFLQ 381
            L  IY   L+
Sbjct: 851 TLEAIYLEILK 861


>gi|156975452|ref|YP_001446359.1| succinyl-diaminopimelate desuccinylase [Vibrio harveyi ATCC
           BAA-1116]
 gi|238055241|sp|A7MY37|DAPE_VIBHB RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|156527046|gb|ABU72132.1| hypothetical protein VIBHAR_03183 [Vibrio harveyi ATCC BAA-1116]
          Length = 378

 Score =  288 bits (736), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 157/376 (41%), Positives = 216/376 (57%), Gaps = 17/376 (4%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            LI   SVTP+D G   +++  LK LGF IE   F+        N +AR GTEAP   FA
Sbjct: 12  DLISRQSVTPEDAGCQDVMIERLKALGFEIEVMVFED-----TTNFWARRGTEAPLFAFA 66

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI---PKYKNF 127
           GH DVVP G    W   PF  TI +G ++GRG  DMKGS+AC + AV RFI   P +K  
Sbjct: 67  GHTDVVPAGKLEQWDTHPFEPTIIDGYLHGRGAADMKGSLACMVVAVERFIAENPDHK-- 124

Query: 128 GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLS 187
           GSI  LIT DEEGP INGT +++  +  +GE  D CIVGEP+   ++GD +K GRRGS++
Sbjct: 125 GSIGFLITSDEEGPFINGTVRVVETLMDRGENIDMCIVGEPSSTEVVGDVVKNGRRGSIT 184

Query: 188 GEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPS 247
           G++T+ G QGHVAYPHL  NP+   +  +H+L    +D GN  F PT+ +I  +  G  +
Sbjct: 185 GDLTVKGTQGHVAYPHLANNPVHQSLMAIHELATTEWDQGNDYFPPTSFQIPNVSAGTGA 244

Query: 248 KNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTH 307
            NVIP +  + FN+RF+   + + + + I   L K      +L + + ++    P FLT 
Sbjct: 245 SNVIPGEFNVQFNLRFSTELSNEVIVQRITETLDK-----HELDYDLKWTFNGDP-FLTD 298

Query: 308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASL 366
              L   +  ++       P L T+GGTSD RFI      V+E G V  T+H +NE   +
Sbjct: 299 TGALLDAVVAAVDEVNSTKPALLTTGGTSDGRFIARMGGQVVELGPVNATIHKVNECVKV 358

Query: 367 QDLEDLTCIYENFLQN 382
            DLE LT +YEN L++
Sbjct: 359 DDLEKLTDMYENTLKH 374


>gi|153834127|ref|ZP_01986794.1| succinyl-diaminopimelate desuccinylase [Vibrio harveyi HY01]
 gi|148869497|gb|EDL68495.1| succinyl-diaminopimelate desuccinylase [Vibrio harveyi HY01]
          Length = 378

 Score =  288 bits (736), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 157/376 (41%), Positives = 216/376 (57%), Gaps = 17/376 (4%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            LI   SVTP+D G   +++  LK LGF IE   F+        N +AR GTEAP   FA
Sbjct: 12  DLISRQSVTPEDAGCQDVMIERLKALGFEIEVMVFED-----TTNFWARRGTEAPLFAFA 66

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI---PKYKNF 127
           GH DVVP G    W   PF  TI +G ++GRG  DMKGS+AC + AV RFI   P +K  
Sbjct: 67  GHTDVVPAGKLEQWDTHPFEPTIIDGYLHGRGAADMKGSLACMVVAVERFIAENPDHK-- 124

Query: 128 GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLS 187
           GSI  LIT DEEGP INGT +++  + ++GE  D CIVGEP+   ++GD +K GRRGS++
Sbjct: 125 GSIGFLITSDEEGPFINGTVRVVETLMERGENIDMCIVGEPSSTEVVGDVVKNGRRGSIT 184

Query: 188 GEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPS 247
           G++T+ G QGHVAYPHL  NP+   +  +H+L    +D GN  F PT+ +I  +  G  +
Sbjct: 185 GDLTVKGTQGHVAYPHLANNPVHQSLMAIHELATTEWDQGNDYFPPTSFQIPNVSAGTGA 244

Query: 248 KNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTH 307
            NVIP +  + FN+RF+   + + + + I   L K       L + + ++    P FLT 
Sbjct: 245 SNVIPGEFNVQFNLRFSTELSNEVIVQRITETLDK-----HDLDYDLKWTFNGDP-FLTD 298

Query: 308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASL 366
              L   +  ++       P L T+GGTSD RFI      V+E G V  T+H +NE   +
Sbjct: 299 TGALLDAVVAAVDEVNSTKPALLTTGGTSDGRFIARMGGQVVELGPVNATIHKVNECVKV 358

Query: 367 QDLEDLTCIYENFLQN 382
            DLE LT +YEN L++
Sbjct: 359 DDLEKLTDMYENTLKH 374


>gi|197285415|ref|YP_002151287.1| succinyl-diaminopimelate desuccinylase [Proteus mirabilis HI4320]
 gi|238064772|sp|B4EY70|DAPE_PROMH RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|194682902|emb|CAR43264.1| N-succinyl-diaminopimelate deacylase [Proteus mirabilis HI4320]
          Length = 376

 Score =  287 bits (735), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 161/384 (41%), Positives = 223/384 (58%), Gaps = 13/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI  PSV+P D G   +++  L  LGF+IE+  F        +NL+A  
Sbjct: 1   MSCPVIELAQQLISRPSVSPDDQGCQQLIIERLTPLGFTIEKMPFGQ-----TENLWACR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G E   L FAGH DVVPPG    W  PPF  +I +G +YGRG  DMKGS+A  + A  RF
Sbjct: 56  GGEGETLAFAGHTDVVPPGANALWDNPPFEPSIRDGMLYGRGAADMKGSLAAMVVAAERF 115

Query: 121 IPKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  Y ++ G ++ LIT DEE  A +GT K++  +  +GE+ D C+VGEP+  H +GD IK
Sbjct: 116 VHAYPQHRGRLAFLITSDEEADAHDGTVKVVESLISRGERLDYCLVGEPSSQHQLGDMIK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++  +TI+G QGHVAYPHL +NPI    P +H+L N  +D GN  F  T M+I 
Sbjct: 176 NGRRGSITANVTIYGTQGHVAYPHLAQNPIHMASPFIHELVNTVWDNGNEYFPATTMQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    +    EEIR R    +Q   +L + + +S  
Sbjct: 236 NIHSGTGSNNVIPGELFIQFNFRFSTAITD----EEIRQRTEALLQKY-QLRYHISWSLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P F+T + KL   +  S+ + T   P LSTSGGTSD RFI      V+E G +  T+H
Sbjct: 291 GQP-FITGEGKLLDAVRYSVKHYTNIEPTLSTSGGTSDGRFIAQMGAQVVELGPINATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  S  DL+ L+ IY+  ++ 
Sbjct: 350 KVNECVSAADLQQLSRIYQRIMEQ 373


>gi|293606182|ref|ZP_06688546.1| succinyl-diaminopimelate desuccinylase [Achromobacter piechaudii
           ATCC 43553]
 gi|292815442|gb|EFF74559.1| succinyl-diaminopimelate desuccinylase [Achromobacter piechaudii
           ATCC 43553]
          Length = 379

 Score =  287 bits (735), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 164/386 (42%), Positives = 221/386 (57%), Gaps = 13/386 (3%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           T   L+ +  LI  PSVTP D      L   L+ +GF+ E     T     V NL+AR G
Sbjct: 3   TSAVLDLVKDLIARPSVTPADEDCQAALAARLERIGFTCE-----TIAQGGVTNLWARRG 57

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
           + AP  +FAGH DVVPPG    W   PF  T  +G +YGRG  DMK SIA F+ A   F+
Sbjct: 58  SAAPLTVFAGHTDVVPPGPREKWDSDPFVPTERDGWLYGRGAADMKSSIAAFVVAAEEFV 117

Query: 122 PKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
             + ++ GSI+LLIT DEEGP+I+GT  +   ++ +GEK D CIVGEPT   ++GDT K 
Sbjct: 118 AAHPQHDGSIALLITSDEEGPSIDGTAIVCDALKARGEKLDYCIVGEPTSGDVLGDTCKN 177

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGSLSG++T+ G QGHVAYPHL  NP+  L P L ++  I +D GN  F PT  +++ 
Sbjct: 178 GRRGSLSGKLTVKGIQGHVAYPHLARNPVHQLSPALAEIVAIEWDQGNEYFPPTTFQVSN 237

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV 300
           ++ G  + NV+P +    FN RF+     ++LK  + + L K       L + + +    
Sbjct: 238 LNSGTGATNVVPGEAVALFNFRFSTASTPESLKARVHAVLDKH-----GLEYELDWDLGG 292

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMHA 359
            P FLT    LT  L ++I+  TG    LST+GGTSD RFI   CP VIEFG    T+H 
Sbjct: 293 EP-FLTPRGSLTDALVQAIHAETGVTAELSTTGGTSDGRFIAKICPQVIEFGPGNATIHK 351

Query: 360 LNENASLQDLEDLTCIYENFLQNWFI 385
           +NE   +  L+ L  IY   L+N  +
Sbjct: 352 VNERIEVASLDPLKNIYRRTLENLLL 377


>gi|307294082|ref|ZP_07573926.1| succinyl-diaminopimelate desuccinylase [Sphingobium
           chlorophenolicum L-1]
 gi|306880233|gb|EFN11450.1| succinyl-diaminopimelate desuccinylase [Sphingobium
           chlorophenolicum L-1]
          Length = 380

 Score =  287 bits (735), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 163/368 (44%), Positives = 215/368 (58%), Gaps = 13/368 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYA-RFGTEAPHLMF 69
           +LI CPSVTP  G  F +L   LK LGF+++           V+NL A R     PH  F
Sbjct: 16  KLIACPSVTPATGDVFTVLEAMLKPLGFTVDRFLTGEAPDGPVENLLAWRTTGPGPHFAF 75

Query: 70  AGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGS 129
           AGH+DVVPPG  N W   PF+  +    +YGRG VDMKG+IA ++AA+ R   +    G+
Sbjct: 76  AGHLDVVPPG--NGWGSDPFTPEVRGDLLYGRGAVDMKGAIAAYVAALHRLPEELP--GT 131

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           ISL+ITGDEEG A+ GT  ++  +   G + D C+VGEPT +  +GD IKIGRRGS++  
Sbjct: 132 ISLIITGDEEGAAVYGTLALMDRMAAHGLRPDLCLVGEPTSSQRLGDVIKIGRRGSVNMW 191

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           I + G QGHVAYPHL +NPI  L+ +L  +  +  D GN  F  +N+EIT +DVGNP+ N
Sbjct: 192 INVDGVQGHVAYPHLADNPIPRLVRILSAIDAVVLDEGNDWFQASNIEITNLDVGNPTTN 251

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIPA  +   +IRFN   NE +  E     L+  I  +         +      FLT   
Sbjct: 252 VIPAAAQARISIRFN---NEHSGAE-----LVDRITAIAAAEGGTVEAKISGEPFLTEPG 303

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDL 369
            L+ L++ +I   TG    LST+GGTSDARF+   CPV+EFGL   TMH L+E  +L DL
Sbjct: 304 ILSGLVAGAIREVTGVEAELSTTGGTSDARFLSRLCPVVEFGLNNATMHKLDEAVALDDL 363

Query: 370 EDLTCIYE 377
             L  IY 
Sbjct: 364 RGLAEIYR 371


>gi|254511423|ref|ZP_05123490.1| succinyl-diaminopimelate desuccinylase [Rhodobacteraceae bacterium
           KLH11]
 gi|221535134|gb|EEE38122.1| succinyl-diaminopimelate desuccinylase [Rhodobacteraceae bacterium
           KLH11]
          Length = 379

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 159/379 (41%), Positives = 221/379 (58%), Gaps = 15/379 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA--PHLM 68
            LI+CPSVTP++GGA  +L   L   GF     D        V NL+AR+G +       
Sbjct: 10  DLIRCPSVTPEEGGALVLLQRVLGEAGFECTRVD-----RGGVCNLFARWGQKGHPRSFG 64

Query: 69  FAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFG 128
           F GH DVVP GD   WT  PF A   +G +YGRG  DMK  +A F AA   F+      G
Sbjct: 65  FNGHTDVVPIGDEAAWTMRPFGAETRDGVMYGRGTTDMKSGVAAFAAAAIDFVRDTPPDG 124

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           ++ L ITGDEEG A++GT  +L  ++   E+   C+VGEPTC   +G+ +KIGRRGS++ 
Sbjct: 125 AVILTITGDEEGDALHGTVALLDHMDNADERMSVCLVGEPTCPDKMGEMMKIGRRGSMTA 184

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
             T+ G QGH AYPH  +NP+  +  L+ +L +   D G+  F  + + + TID GN + 
Sbjct: 185 WFTVVGVQGHSAYPHRAKNPLPAMARLMDRLASHELDQGSDHFDASTLAVVTIDTGNAAT 244

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV---SPVFL 305
           NVIPAQ   + NIRFNDL +  +L + +R    K    V +  + V   + +      FL
Sbjct: 245 NVIPAQCVGTVNIRFNDLHSGASLSDWLR----KAADQVAQ-EYGVEVDTKIKISGESFL 299

Query: 306 THDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENAS 365
           T    L+ L+S+++ N TG  P LST+GGTSDARFIK++CPV+EFGLVGRTMH ++E   
Sbjct: 300 TPPGPLSDLVSQAVANETGVTPELSTTGGTSDARFIKNHCPVVEFGLVGRTMHQVDECVE 359

Query: 366 LQDLEDLTCIYENFLQNWF 384
           ++ +  L  IY   L ++F
Sbjct: 360 VEQIRQLKAIYTRILTDYF 378


>gi|89073183|ref|ZP_01159722.1| putative succinyl-diaminopimelate desuccinylase [Photobacterium sp.
           SKA34]
 gi|89051136|gb|EAR56593.1| putative succinyl-diaminopimelate desuccinylase [Photobacterium sp.
           SKA34]
          Length = 376

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 161/374 (43%), Positives = 221/374 (59%), Gaps = 17/374 (4%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           L+  PSVTP+D G   +++  L+ LGF IE   F+        NL+AR GT+AP  +FAG
Sbjct: 13  LMSRPSVTPEDAGCQDVMIARLEQLGFIIETMVFEDTT-----NLWARRGTQAPLFVFAG 67

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI---PKYKNFG 128
           H DVVP G    W  PPF  TI +G ++GRG  DMKGS+AC I A+ RFI   P +K  G
Sbjct: 68  HTDVVPSGPLEQWHTPPFEPTIIDGYLHGRGAADMKGSLACMIVAIERFIAENPDHK--G 125

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           SI+LLIT DEEGP INGT +++  +E + EK D CIVGEP+  H +GD +K GRRGS++G
Sbjct: 126 SIALLITSDEEGPFINGTTRVIDTLEARNEKIDMCIVGEPSSTHHVGDVVKNGRRGSITG 185

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
           ++T+ G QGHVAYPHL  NPI   +P L +L    +D GN  F PT+ +I  +  G  + 
Sbjct: 186 DLTVKGIQGHVAYPHLANNPIHKALPALAELAATTWDNGNAYFPPTSFQIPNVAAGTGAS 245

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHD 308
           NVIP + ++ FN RF+    +  +K  + S L     +   L + + ++    P FLT  
Sbjct: 246 NVIPGEFEVQFNFRFSTELTDAEIKRRVHSVL-----DAHGLDYDLKWTLSGHP-FLTDK 299

Query: 309 RKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFI-KDYCPVIEFGLVGRTMHALNENASLQ 367
             L   +  +I       P L T+GGTSD RFI +    V+E G V  T+H +NE   + 
Sbjct: 300 GTLVKAVVGAIEEVNHQQPELLTTGGTSDGRFIARTGAQVVELGPVNATIHKVNECVKVA 359

Query: 368 DLEDLTCIYENFLQ 381
           DLE LT +Y+  L+
Sbjct: 360 DLEKLTDMYQKVLE 373


>gi|197334990|ref|YP_002156742.1| succinyl-diaminopimelate desuccinylase [Vibrio fischeri MJ11]
 gi|238055240|sp|B5FGX0|DAPE_VIBFM RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|197316480|gb|ACH65927.1| succinyl-diaminopimelate desuccinylase [Vibrio fischeri MJ11]
          Length = 377

 Score =  286 bits (733), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 158/373 (42%), Positives = 222/373 (59%), Gaps = 13/373 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           L+   S+TP+D G   +++  L+ LGF+IE   F+        N +AR G EAP   FAG
Sbjct: 13  LLSRQSITPEDAGCQELMIKRLEALGFTIEIMVFED-----TTNFWARRGNEAPLFTFAG 67

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVP GD  HW   PF  TI +G +Y RG  DMKGS+AC + AV RF+ ++ N  GSI
Sbjct: 68  HTDVVPTGDLTHWNTNPFEPTIIDGMLYARGAADMKGSLACMVVAVERFVGEHPNHKGSI 127

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           S LIT DEEGP INGT +++  ++++ E  D CIVGEP+    +GD +K GRRGSL+G +
Sbjct: 128 SFLITSDEEGPFINGTTRVVDTLQERNEIIDMCIVGEPSSTSHVGDVVKNGRRGSLTGNL 187

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
           T+ G QGHVAYPH+  NPI   +P L +L    +D GN  F PT+ +I  ++ G  + NV
Sbjct: 188 TVKGIQGHVAYPHIARNPIHQAMPALSELATTVWDNGNDYFPPTSFQIPNMNGGTGASNV 247

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IP  V + FN RF+    E T+ +E++ R+++ I +   L + + +     P FLT    
Sbjct: 248 IPGTVDIMFNFRFS---TESTV-DELQQRVVE-ILDKHDLEYDLDWIINGLP-FLTDTGD 301

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDL 369
           L + +  ++       P L T+GGTSD RFI      VIE G V  T+H +NE  +++DL
Sbjct: 302 LLTAVVNAVDTVNQQKPQLLTTGGTSDGRFIAQMGSQVIELGPVNATIHKVNECVNVEDL 361

Query: 370 EDLTCIYENFLQN 382
           E LT +Y+  L N
Sbjct: 362 EKLTDMYQEVLNN 374


>gi|254506858|ref|ZP_05118997.1| succinyl-diaminopimelate desuccinylase [Vibrio parahaemolyticus 16]
 gi|219550143|gb|EED27129.1| succinyl-diaminopimelate desuccinylase [Vibrio parahaemolyticus 16]
          Length = 377

 Score =  286 bits (733), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 155/373 (41%), Positives = 213/373 (57%), Gaps = 13/373 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI   SVTP+D G    ++  LK LGF IE   F+        N +AR GTEAP   FAG
Sbjct: 13  LISRQSVTPEDAGCQDAMIERLKALGFEIEVMVFED-----TTNFWARRGTEAPLFAFAG 67

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVP G+ + W  PPF  T  +G ++GRG  DMKGS+A  I AV +FI    N  GSI
Sbjct: 68  HTDVVPAGNLDQWHTPPFEPTEIDGYLHGRGAADMKGSLASMIVAVEQFIADNPNHKGSI 127

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
             LIT DEEGP INGT +++  +  +GE  D CIVGEP+   ++GD +K GRRGS++G++
Sbjct: 128 GFLITSDEEGPFINGTVRVVETLMARGENIDMCIVGEPSSTEVVGDVVKNGRRGSITGDL 187

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
           T+ G QGHVAYPHL  NP+   +  +H+L    +D GN  F PT+ +I  +  G  + NV
Sbjct: 188 TVKGTQGHVAYPHLANNPVHQSLMAIHELATTEWDQGNAYFPPTSFQIPNVHAGTGASNV 247

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IP +  + FN+RF+   N   +   +   L K      +L + + ++    P FLT    
Sbjct: 248 IPGEFNVQFNLRFSTELNNDMIVNRVVETLDKH-----ELDYDLKWTFNGDP-FLTDTGA 301

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDL 369
           L   +  ++ +     P L T+GGTSD RFI    C V+E G V  T+H +NE   + DL
Sbjct: 302 LLDAVVDAVDSVNQTKPALLTTGGTSDGRFIARMDCQVVELGPVNATIHKVNECVKIDDL 361

Query: 370 EDLTCIYENFLQN 382
           E LT +Y+  L+N
Sbjct: 362 EKLTQMYQKTLEN 374


>gi|313200715|ref|YP_004039373.1| succinyl-diaminopimelate desuccinylase [Methylovorus sp. MP688]
 gi|312440031|gb|ADQ84137.1| succinyl-diaminopimelate desuccinylase [Methylovorus sp. MP688]
          Length = 375

 Score =  286 bits (733), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 158/368 (42%), Positives = 221/368 (60%), Gaps = 13/368 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI   SVTP+D G   +L++ L+ LGF IE   F       V N +AR GT +P L+FAG
Sbjct: 11  LIARRSVTPEDLGCQELLISRLEPLGFKIERMRFGD-----VDNFFARRGTASPLLVFAG 65

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVP G  + W  PPF  TI +G +YGRG  DMK S+A FI ++  F+ ++ +  GSI
Sbjct: 66  HTDVVPTGPVDQWHTPPFEPTIKDGMLYGRGAADMKTSLAAFITSIEEFVARHPDHQGSI 125

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
            LLIT DEEG A +GT K++  ++ +GE  D CIVGEPT + ++GD IK GRRGSLSG++
Sbjct: 126 GLLITSDEEGIATHGTVKVVEALKARGELIDYCIVGEPTSSKVVGDMIKNGRRGSLSGKL 185

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
            + G QGH+AYPHL +NPI  + P + +L +  +D+GN  F PT+ +I+ ++ G  + NV
Sbjct: 186 VVKGVQGHIAYPHLVKNPIHLVAPAIKELADTVWDSGNEYFPPTSWQISNMNGGTGATNV 245

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           +P +V + FN RF+     + L+E + + L K       L + + +     P FLT    
Sbjct: 246 VPGEVTIQFNFRFSTASTAEGLREGVHAILDKH-----ALEYDLQWELSGKP-FLTPKGT 299

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMHALNENASLQDL 369
           L   +S +I    G  P LSTSGGTSD RFI D    ++EFG +  T+H LNE   + D+
Sbjct: 300 LVEAISAAIETAFGVTPELSTSGGTSDGRFIADIASQIVEFGPLNATIHKLNECVGVADI 359

Query: 370 EDLTCIYE 377
           E L   Y 
Sbjct: 360 EPLKDAYR 367


>gi|254262184|emb|CAZ90512.1| Succinyl-diaminopimelate desuccinylase dapE [Enterobacter
           turicensis]
          Length = 392

 Score =  286 bits (733), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 153/384 (39%), Positives = 222/384 (57%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF        +N +A  
Sbjct: 18  MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLRAIGFTVEPMDFGD-----TQNFWAWR 72

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVPPGD N W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 73  G-QGETLAFAGHTDVVPPGDANRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 131

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+ + ++GD +K
Sbjct: 132 VAQHPNHKGRLAFLITSDEEASAQNGTVKVVEALMARNERLDYCLVGEPSSSEVVGDVVK 191

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P+L +L NI +D GN  F  T+M+I 
Sbjct: 192 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMLDELVNIEWDEGNAFFPATSMQIA 251

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP  + + FN RF+    +  +K  + + L K      +L +T+ +   
Sbjct: 252 NIQAGTGSNNVIPGDLHVQFNFRFSTELTDAAIKARVEALLQKH-----QLRYTLDWWLS 306

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 307 GQP-FLTARGKLVDAVVNAVAHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 365

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 366 KINECVNAADLQLLARMYQRIMEQ 389


>gi|163744976|ref|ZP_02152336.1| succinyl-diaminopimelate desuccinylase [Oceanibulbus indolifex
           HEL-45]
 gi|161381794|gb|EDQ06203.1| succinyl-diaminopimelate desuccinylase [Oceanibulbus indolifex
           HEL-45]
          Length = 381

 Score =  286 bits (732), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 158/384 (41%), Positives = 226/384 (58%), Gaps = 11/384 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D ++   +L++C SVTP + GA  +L   L   GF     D    +   V NL+ R+G++
Sbjct: 5   DPVDLTAKLVRCASVTPVNDGALEVLEEVLGAAGF-----DCTRVDRGGVCNLFVRWGSK 59

Query: 64  A--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
                  F GH DVVP GD   W+ PPF A I +G +YGRG  DMK  +A F+AA   F+
Sbjct: 60  GNGKSFGFNGHTDVVPIGDEADWSMPPFGAEIKDGIMYGRGTTDMKSGVAAFVAAAVDFV 119

Query: 122 PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
                 GSI L ITGDEEG A++GT  +L ++ + GE+ D C+VGEPTC   +GD IKIG
Sbjct: 120 KDTPPDGSIVLAITGDEEGDALDGTTALLDYMAENGERMDVCLVGEPTCPERMGDMIKIG 179

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGS++    + GKQGH AYPH   NP+  ++ L+ +L +   D G+  F  + + + T+
Sbjct: 180 RRGSMNAHFKVTGKQGHAAYPHRANNPLPAMMRLMDRLASHELDQGSDHFDASTLAVVTV 239

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
           D GN + NVIPAQ   + NIRFND  +   L E +R    K      + S  V     +S
Sbjct: 240 DTGNKATNVIPAQCLGAVNIRFNDHHSGAALSELLRGEADK---IASEFSLQVDVDITIS 296

Query: 302 -PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL 360
              F+T    L+ L++ ++   TG  P LST+GGTSDARF+K +CPV+EFGLVG++MH +
Sbjct: 297 GESFITPPGALSDLVAGAVEAETGVKPELSTTGGTSDARFVKAHCPVVEFGLVGQSMHQV 356

Query: 361 NENASLQDLEDLTCIYENFLQNWF 384
           +E+  ++ +E L  IY   L+++F
Sbjct: 357 DEHVRIEHIEQLKSIYARVLRDYF 380


>gi|126463549|ref|YP_001044663.1| succinyl-diaminopimelate desuccinylase [Rhodobacter sphaeroides
           ATCC 17029]
 gi|238064803|sp|A3PNH5|DAPE_RHOS1 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|126105213|gb|ABN77891.1| succinyldiaminopimelate desuccinylase [Rhodobacter sphaeroides ATCC
           17029]
          Length = 380

 Score =  286 bits (732), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 157/379 (41%), Positives = 224/379 (59%), Gaps = 15/379 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            L++CPSVTP++GGA  ++   L   GF     D    + + V NL+AR+G +  +  F 
Sbjct: 11  DLVRCPSVTPEEGGALDLIERILSGAGF-----DCTRVDRNGVPNLFARWGRKGANRTFG 65

Query: 71  --GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFG 128
             GH DVVP GD   WT  PF   IA+G ++GRG  DMK  +A F+AA   F+ +    G
Sbjct: 66  FNGHTDVVPVGDAAAWTRDPFGGEIADGWLWGRGATDMKSGVAAFVAAAVDFVQETPPDG 125

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           ++ L ITGDEEG A +GT  +L W+  +GE    C+VGEPTC   +G+ +KIGRRGS++ 
Sbjct: 126 AVVLTITGDEEGDATDGTVALLDWMAAEGEAMSVCLVGEPTCPERLGEMMKIGRRGSMTA 185

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
             T  G QGH AYPH  +NP+  L  L+ +L++   D G   F  + + +TT D GNP+ 
Sbjct: 186 FFTARGVQGHSAYPHRAKNPVAALARLIDRLSSHDLDQGTEHFDASTLAVTTFDTGNPAT 245

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLK---EEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFL 305
           NVIPA  + + NIRFND  +  +L    EE  +R+         LS  +   S     FL
Sbjct: 246 NVIPALCRATVNIRFNDAHSGASLASWLEEEAARVTAETGVEIALSAKISGES-----FL 300

Query: 306 THDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENAS 365
           T   +L+ L+++++   TG  P  STSGGTSDARF++ +CPV+EFGLVG+TMH ++E   
Sbjct: 301 TPPGELSELVARAVEAETGLRPEPSTSGGTSDARFVRAHCPVVEFGLVGKTMHQVDERVE 360

Query: 366 LQDLEDLTCIYENFLQNWF 384
           +  +E L  IY   L+++F
Sbjct: 361 VAQIEPLKAIYLRILKDYF 379


>gi|332978021|gb|EGK14763.1| succinyl-diaminopimelate desuccinylase [Psychrobacter sp.
           1501(2011)]
          Length = 448

 Score =  286 bits (731), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 164/388 (42%), Positives = 224/388 (57%), Gaps = 15/388 (3%)

Query: 10  IQLIKCPSVTPQDGGAFFILVNTLKLLGFSIE----------EKDFQTKNTSIVKNLYAR 59
           I L++  SVTP+D     +LV  LK L F+ E            DF  KN + VKNL+AR
Sbjct: 63  IDLMRRDSVTPEDKHCQDVLVERLKPLDFNFEFMYFGDKETTAPDFD-KNNAEVKNLWAR 121

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT  P + FAGH DVVP G+ ++W  PPF  T+ +G ++GRG  DMK  IA F  A   
Sbjct: 122 RGTADPVVCFAGHTDVVPTGNVDNWKIPPFEPTVKDGFLWGRGAADMKTGIAAFTVAAEN 181

Query: 120 FIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ K+ N  GSI++LIT DEEGP+INGT K++  +E + EK   C+VGEP+    +GD I
Sbjct: 182 FVKKHPNHNGSIAMLITSDEEGPSINGTVKVVEALEARNEKITYCLVGEPSSTDTLGDII 241

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSL G +T+ GKQGHVAYPHL  NPI  L+P L + T   +D GN  F  T+M+I
Sbjct: 242 KNGRRGSLGGILTVTGKQGHVAYPHLAVNPIHALLPALAEFTRTQWDNGNDFFPATSMQI 301

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP  V++ FN RF+    EK L+ +    L +   +  + ++ + +  
Sbjct: 302 SNINGGTGANNVIPETVEVVFNFRFSTETTEKELRAKTHEILDRHFADT-EATYDIDWKL 360

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTM 357
              P FLT + KL      +I   TG    LSTSGGTSD RFI      V+E G+   T+
Sbjct: 361 SGHP-FLTAEGKLVDACKVAIKEVTGIDTTLSTSGGTSDGRFIAPTGAQVVELGVRNATI 419

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H ++E   + D+  L  IYE  L+   +
Sbjct: 420 HQVDERVEIDDIGKLAQIYERMLEELLL 447


>gi|29654004|ref|NP_819696.1| succinyl-diaminopimelate desuccinylase [Coxiella burnetii RSA 493]
 gi|153207360|ref|ZP_01946097.1| succinyl-diaminopimelate desuccinylase [Coxiella burnetii 'MSU Goat
           Q177']
 gi|154707315|ref|YP_001424080.1| succinyl-diaminopimelate desuccinylase [Coxiella burnetii Dugway
           5J108-111]
 gi|165918447|ref|ZP_02218533.1| succinyl-diaminopimelate desuccinylase [Coxiella burnetii RSA 334]
 gi|212212857|ref|YP_002303793.1| succinyl-diaminopimelate desuccinylase [Coxiella burnetii
           CbuG_Q212]
 gi|212219103|ref|YP_002305890.1| succinyl-diaminopimelate desuccinylase [Coxiella burnetii
           CbuK_Q154]
 gi|81629258|sp|Q83DN2|DAPE_COXBU RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064725|sp|B6J929|DAPE_COXB1 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064726|sp|B6J120|DAPE_COXB2 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064727|sp|A9KC82|DAPE_COXBN RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|29541270|gb|AAO90210.1| succinyl-diaminopimelate desuccinylase [Coxiella burnetii RSA 493]
 gi|120576669|gb|EAX33293.1| succinyl-diaminopimelate desuccinylase [Coxiella burnetii 'MSU Goat
           Q177']
 gi|154356601|gb|ABS78063.1| succinyl-diaminopimelate desuccinylase [Coxiella burnetii Dugway
           5J108-111]
 gi|165917815|gb|EDR36419.1| succinyl-diaminopimelate desuccinylase [Coxiella burnetii RSA 334]
 gi|212011267|gb|ACJ18648.1| succinyl-diaminopimelate desuccinylase [Coxiella burnetii
           CbuG_Q212]
 gi|212013365|gb|ACJ20745.1| succinyl-diaminopimelate desuccinylase [Coxiella burnetii
           CbuK_Q154]
          Length = 374

 Score =  286 bits (731), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 156/380 (41%), Positives = 220/380 (57%), Gaps = 13/380 (3%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           + L  L QLI+ PS+TP D G   IL++ LK +GF  E   F       V N +A  G +
Sbjct: 3   ETLNLLKQLIERPSITPNDAGCQTILIDRLKSVGFQCEHLPFGE-----VHNFWAWHGHQ 57

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
           +P ++FAGH DVVPPGD   W  PPF+ T   G IYGRG  DMK  +A  + A   F+ +
Sbjct: 58  SPFIIFAGHTDVVPPGDETQWHSPPFTPTEKNGYIYGRGAADMKSGLAAMVVAAENFVKQ 117

Query: 124 YKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
             +  G+I  ++T DEEGPA NGT+K++ ++++K  K D CIVGE + N  +GD IKIGR
Sbjct: 118 NPDHNGTIGFIVTSDEEGPAENGTQKVVDYLQQKNIKLDYCIVGEASSNEKLGDAIKIGR 177

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGS+ GE+TI GKQGH+AYPHL +NPI         L    +D GN  F+PT+ +   ++
Sbjct: 178 RGSMHGELTIIGKQGHIAYPHLADNPIHRSFQAFEALAKTKWDEGNEHFTPTSFQFYNVE 237

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
            G  + NVIPA +K  FN RF  +   + L++++       I N  +L++ + ++    P
Sbjct: 238 AGAGAANVIPATLKAKFNFRFAPIHTTQQLQQKVER-----ILNYYQLNYDIQWNVSSQP 292

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALN 361
            F + + +L + + ++I          +T GGTSD RFI    C VIE G V +T H +N
Sbjct: 293 -FFSGNGRLATFVRQAIQEICHLNTEPNTYGGTSDGRFIATTGCEVIELGPVNKTAHHVN 351

Query: 362 ENASLQDLEDLTCIYENFLQ 381
           EN  + DLE LT IY   LQ
Sbjct: 352 ENICIADLEKLTDIYFRTLQ 371


>gi|33151825|ref|NP_873178.1| succinyl-diaminopimelate desuccinylase [Haemophilus ducreyi
           35000HP]
 gi|81423718|sp|Q7VNB3|DAPE_HAEDU RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|33148046|gb|AAP95567.1| succinyl-diaminopimelate desuccinylase [Haemophilus ducreyi
           35000HP]
          Length = 376

 Score =  286 bits (731), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 156/384 (40%), Positives = 225/384 (58%), Gaps = 13/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  + +E   QLI+ PS++PQD G   I+   L  +GF++E   F         NL+A  
Sbjct: 1   MKHNIIELAQQLIRNPSISPQDKGCQQIISQRLAAVGFTLEWMPFGD-----TLNLWATH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   P ++FAGH D+VP GD   W YPPFSA I +  ++GRG  DMKGS+A  + A   F
Sbjct: 56  GNGDPCIVFAGHTDIVPTGDPAQWQYPPFSAIIVDEMLHGRGAADMKGSLAALVIAAENF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + KY N  G I+LLIT DEE  A +GT K++  +  + EK D  ++GEP+C+  +GD IK
Sbjct: 116 VRKYPNHSGKIALLITSDEEATAKDGTAKVVETLMARHEKIDYAVIGEPSCSKYLGDIIK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++ E+ I G QGHVAYPHL +NPI   +  L++LT   +D GNT F PT+++I 
Sbjct: 176 NGRRGSITAELYIEGVQGHVAYPHLAQNPIHTSLAFLNELTTYQWDNGNTFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  + NVIP ++ + FN+R+    N++ +K+ + + L K       L + +H+   
Sbjct: 236 NIKAGTGNNNVIPGELYLQFNLRYCTEINDQIIKQTVATMLAK-----YGLQYRIHWHLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FL+ + KL +   +++ N T + P L TSGGTSD RFI      V+EFG +  T+H
Sbjct: 291 GKP-FLSSEGKLVNATIQAVENITKHTPRLDTSGGTSDGRFIALMGAEVVEFGPLNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  S +DL     IY   L+ 
Sbjct: 350 KVNECVSTEDLAKCGQIYYQILEQ 373


>gi|59712521|ref|YP_205297.1| succinyl-diaminopimelate desuccinylase [Vibrio fischeri ES114]
 gi|75353565|sp|Q5E3I7|DAPE_VIBF1 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|59480622|gb|AAW86409.1| N-succinyl-diaminopimelate deacylase [Vibrio fischeri ES114]
          Length = 377

 Score =  286 bits (731), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 222/373 (59%), Gaps = 13/373 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           L+   S+TP+D G   +++  L+ LGF+IE   F+        N +AR G +AP   FAG
Sbjct: 13  LLSRQSITPEDAGCQELMIKQLEALGFTIEIMVFED-----TTNFWARRGNKAPLFTFAG 67

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVP GD  HW   PF  TI +G +Y RG  DMKGS+AC + AV RF+ ++ N  GSI
Sbjct: 68  HTDVVPTGDLTHWNTNPFEPTIIDGMLYARGAADMKGSLACMVVAVERFVAEHPNHKGSI 127

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           S LIT DEEGP INGT +++  ++++ E  D CIVGEP+    +GD +K GRRGSL+G +
Sbjct: 128 SFLITSDEEGPFINGTTRVVDTLQERNEIIDMCIVGEPSSTAHVGDVVKNGRRGSLTGNL 187

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
           T+ G QGHVAYPH+  NPI   +P L +L    +D GN  F PT+ +I  ++ G  + NV
Sbjct: 188 TVKGIQGHVAYPHIARNPIHQAMPALSELATTVWDNGNDYFPPTSFQIPNMNGGTGASNV 247

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IP  V + FN RF+    E T+ +E++ R+++ I +   L + + +     P FLT    
Sbjct: 248 IPGTVDIMFNFRFS---TESTV-DELQQRVVE-ILDKHDLEYELDWIINGLP-FLTDTGD 301

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDL 369
           L + +  ++       P L T+GGTSD RFI      VIE G V  T+H +NE  +++DL
Sbjct: 302 LLTAVVNAVDTVNQQKPQLLTTGGTSDGRFIAQMGSQVIELGPVNATIHKVNECVNVEDL 361

Query: 370 EDLTCIYENFLQN 382
           E LT +Y+  L N
Sbjct: 362 EKLTDMYQEVLNN 374


>gi|90579868|ref|ZP_01235676.1| succinyl-diaminopimelate desuccinylase [Vibrio angustum S14]
 gi|90438753|gb|EAS63936.1| succinyl-diaminopimelate desuccinylase [Vibrio angustum S14]
          Length = 376

 Score =  286 bits (731), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 160/374 (42%), Positives = 221/374 (59%), Gaps = 17/374 (4%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           L+  PSVTP+D G   +++  L+ LGF IE   F+        NL+AR GT+AP  +FAG
Sbjct: 13  LMSRPSVTPEDAGCQDVMIARLEQLGFIIETMVFEDTT-----NLWARRGTQAPLFVFAG 67

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI---PKYKNFG 128
           H DVVP G    W  PPF  TI +G ++GRG  DMKGS+AC + A+ RFI   P +K  G
Sbjct: 68  HTDVVPSGPVEQWHTPPFEPTIIDGYLHGRGAADMKGSLACMVVAIERFIAENPDHK--G 125

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           SI+LLIT DEEGP INGT +++  +E + EK D CIVGEP+  H +GD +K GRRGS++G
Sbjct: 126 SIALLITSDEEGPFINGTTRVVDTLEARNEKIDMCIVGEPSSTHHVGDVVKNGRRGSITG 185

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
           ++T+ G QGHVAYPHL  NPI   +P L +L    +D GN  F PT+ +I  +  G  + 
Sbjct: 186 DLTVKGIQGHVAYPHLANNPIHKALPALAELAATTWDNGNAYFPPTSFQIPNVAAGTGAS 245

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHD 308
           NVIP + ++ FN RF+    +  +K  + S L     +   L + + ++    P FLT  
Sbjct: 246 NVIPGEFEVQFNFRFSTELTDVEIKRRVHSVL-----DAHGLDYDLKWTLSGHP-FLTDK 299

Query: 309 RKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFI-KDYCPVIEFGLVGRTMHALNENASLQ 367
             L   +  +I       P L T+GGTSD RFI +    V+E G V  T+H +NE   + 
Sbjct: 300 GTLVEAVVAAIEEVNHQQPELLTTGGTSDGRFIARTGAQVVELGPVNATIHKVNECVKVA 359

Query: 368 DLEDLTCIYENFLQ 381
           DLE LT +Y+  L+
Sbjct: 360 DLEKLTDMYQKVLE 373


>gi|149913276|ref|ZP_01901810.1| succinyl-diaminopimelate desuccinylase [Roseobacter sp. AzwK-3b]
 gi|149813682|gb|EDM73508.1| succinyl-diaminopimelate desuccinylase [Roseobacter sp. AzwK-3b]
          Length = 381

 Score =  286 bits (731), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 166/391 (42%), Positives = 227/391 (58%), Gaps = 18/391 (4%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFS---IEEKDFQTKNTSIVKNLY 57
           M  D +E    L++CPS+TP +GGA  +L   L   GF+   IE           V NL+
Sbjct: 1   MPVDPVELTADLVRCPSITPAEGGALQLLETLLTEAGFACTWIERGG--------VSNLF 52

Query: 58  ARFGTE--APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMK-GSIACFI 114
           AR+G +  A    F GH DVVP GD   W+ PPF A   +G ++GRG  DMK G  A   
Sbjct: 53  ARWGDKGAARTFGFNGHTDVVPLGDEAAWSIPPFGAEQKDGFLWGRGATDMKSGVAAFVA 112

Query: 115 AAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHII 174
           AAV          G++ + +TGDEEG A++GT  +L W+ + GE+ D C+VGEPTC   +
Sbjct: 113 AAVDFVRDTPPEDGAVIVTVTGDEEGDAVDGTTAILDWMAQHGERMDVCLVGEPTCPDRL 172

Query: 175 GDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPT 234
           G+ IKIGRRGSLS   TI G+QGH AYPH   NP+  +  L+ +L++   D G   F P+
Sbjct: 173 GEMIKIGRRGSLSAWFTITGEQGHSAYPHRARNPLPAMARLMDRLSSHVLDEGTEHFDPS 232

Query: 235 NMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSH-T 293
            + + TID GNP+ NVIPAQ + + NIRFND  +  +L   ++S L    +        T
Sbjct: 233 TLAVVTIDTGNPATNVIPAQCRATVNIRFNDAHDSASLIGWLQSELDDVAEAFGVAGEMT 292

Query: 294 VHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLV 353
           V  S      FLT    L+ L++ ++   TG  P+LST+GGTSDARF+K +CPV+EFGLV
Sbjct: 293 VKVS---GESFLTPPGPLSDLVAAAVEAETGIAPVLSTTGGTSDARFVKTHCPVVEFGLV 349

Query: 354 GRTMHALNENASLQDLEDLTCIYENFLQNWF 384
           GRTMH ++E   L  +  L  IY   L+++F
Sbjct: 350 GRTMHQVDERVELALIPQLKDIYGRILRDYF 380


>gi|161830189|ref|YP_001596589.1| succinyl-diaminopimelate desuccinylase [Coxiella burnetii RSA 331]
 gi|238064728|sp|A9NCE9|DAPE_COXBR RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|161762056|gb|ABX77698.1| succinyl-diaminopimelate desuccinylase [Coxiella burnetii RSA 331]
          Length = 374

 Score =  286 bits (731), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 156/380 (41%), Positives = 220/380 (57%), Gaps = 13/380 (3%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           + L  L QLI+ PS+TP D G   IL++ LK +GF  E   F       V N +A  G +
Sbjct: 3   ETLNLLKQLIERPSITPNDAGCQTILIDRLKSVGFQCEHLPFGE-----VHNFWAWHGHQ 57

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
           +P ++FAGH DVVPPGD   W  PPF+ T   G IYGRG  DMK  +A  + A   F+ +
Sbjct: 58  SPFIIFAGHTDVVPPGDETQWHSPPFTPTEKNGYIYGRGAADMKSGLAAMVVAAENFVKQ 117

Query: 124 YKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
             +  G+I  ++T DEEGPA NGT+K++ ++++K  K D CIVGE + N  +GD IKIGR
Sbjct: 118 NPDHNGTIGFIVTSDEEGPAENGTQKVVDYLQQKNIKLDYCIVGEASSNEKLGDAIKIGR 177

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGS+ GE+TI GKQGH+AYPHL +NPI         L    +D GN  F+PT+ +   ++
Sbjct: 178 RGSMHGELTIIGKQGHIAYPHLADNPIHRSFQAFEALAKTKWDEGNEHFTPTSFQFYNVE 237

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
            G  + NVIPA +K  FN RF  +   + L++++       I N  +L++ + ++    P
Sbjct: 238 AGAGAANVIPATLKAKFNFRFAPIHTTQQLQQKVER-----ILNYYQLNYDIQWNVSSQP 292

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALN 361
            F + + +L + + ++I          +T GGTSD RFI    C VIE G V +T H +N
Sbjct: 293 -FFSGNGRLATFVRQAIQEICHLNTEPNTYGGTSDGRFIATTGCEVIELGPVNKTAHHVN 351

Query: 362 ENASLQDLEDLTCIYENFLQ 381
           EN  + DLE LT IY   LQ
Sbjct: 352 ENICIADLEKLTDIYFRTLQ 371


>gi|253998642|ref|YP_003050705.1| succinyl-diaminopimelate desuccinylase [Methylovorus sp. SIP3-4]
 gi|253985321|gb|ACT50178.1| succinyl-diaminopimelate desuccinylase [Methylovorus sp. SIP3-4]
          Length = 375

 Score =  285 bits (730), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 159/368 (43%), Positives = 220/368 (59%), Gaps = 13/368 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            LI   SVTP D G   +L++ L+ LGF IE   F       V N +AR GT +P L+FA
Sbjct: 10  DLIARRSVTPDDLGCQELLISRLEPLGFKIERMRFGD-----VDNFFARRGTASPLLVFA 64

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVP G  + W  PPF  TI +G +YGRG  DMK S+A FI ++  F+ ++ +  GS
Sbjct: 65  GHTDVVPTGPVDQWHTPPFEPTIKDGMLYGRGAADMKTSLAAFITSIEEFVAEHPDHQGS 124

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I LLIT DEEG A +GT K++  ++ +GE  D CIVGEPT + ++GD IK GRRGSLSG+
Sbjct: 125 IGLLITSDEEGIATHGTVKVVEALKARGELIDYCIVGEPTSSKVVGDMIKNGRRGSLSGK 184

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           + + G QGH+AYPHL +NPI  + P + +L +  +D+GN  F PT+ +I+ ++ G  + N
Sbjct: 185 LVVKGVQGHIAYPHLVKNPIHLVAPAIKELADTVWDSGNEYFPPTSWQISNMNGGTGATN 244

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           V+P +V + FN RF+     + L+E + + L K       L + + +     P FLT   
Sbjct: 245 VVPGEVTILFNFRFSTASTAEGLRERVHAILDKH-----ALEYDLQWELSGKP-FLTPKG 298

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMHALNENASLQD 368
            L   +S +I    G  P LSTSGGTSD RFI D    V+EFG +  T+H LNE   + D
Sbjct: 299 TLVEAISAAIETAFGVTPELSTSGGTSDGRFIADIASQVVEFGPLNATIHKLNECVGVAD 358

Query: 369 LEDLTCIY 376
           +E L   Y
Sbjct: 359 IEPLKDAY 366


>gi|82702973|ref|YP_412539.1| succinyl-diaminopimelate desuccinylase [Nitrosospira multiformis
           ATCC 25196]
 gi|123544266|sp|Q2Y7X4|DAPE_NITMU RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|82411038|gb|ABB75147.1| succinyldiaminopimelate desuccinylase [Nitrosospira multiformis
           ATCC 25196]
          Length = 378

 Score =  285 bits (730), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 163/387 (42%), Positives = 224/387 (57%), Gaps = 13/387 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D L     LI   S TP D G   IL++ L+ +GF IE           V NL+AR 
Sbjct: 1   MLNDTLALAQMLIARRSPTPFDNGCQEILIDRLEKMGFDIERI-----RCGEVDNLWARR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GTEAP + FAGH DVVP G    W   PF      G++YGRG  DMKGSIA FI ++  F
Sbjct: 56  GTEAPLICFAGHTDVVPTGPLEKWESSPFDPVTRNGRLYGRGAADMKGSIAAFITSIEAF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ +  GSI+LLIT DEEG A++GT +++  ++ + E  D CIVGEPT    +GD IK
Sbjct: 116 VAEHPDHNGSIALLITSDEEGIAVDGTVRVVEVLKARNELIDYCIVGEPTSVDKLGDMIK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSLSG +T+ G QGH+AYPHL +NPI    P + +L N  +D GN  F PT  +I+
Sbjct: 176 NGRRGSLSGTLTVKGIQGHIAYPHLAKNPIHLAAPAIAELANTEWDEGNEYFPPTTWQIS 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NVIP +V + FN RF+     ++LK  +      GI +   L + + + + 
Sbjct: 236 NINGGTGATNVIPGEVTVLFNFRFSTASTIESLKARVH-----GILDRHNLEYDLQWENS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMH 358
             P +LT    L   ++ +I+  TG  P LSTSGGTSD RFI D CP V+E G    T+H
Sbjct: 291 GKP-YLTPRGDLVDAVNAAIHTVTGIEPELSTSGGTSDGRFIADICPQVVELGPRNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            +NE   + DL+ L  IY+  +++  +
Sbjct: 350 KINEYVEVSDLDQLPRIYQLTMESLLL 376


>gi|170767336|ref|ZP_02901789.1| succinyl-diaminopimelate desuccinylase [Escherichia albertii
           TW07627]
 gi|170123670|gb|EDS92601.1| succinyl-diaminopimelate desuccinylase [Escherichia albertii
           TW07627]
          Length = 375

 Score =  285 bits (730), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 154/384 (40%), Positives = 224/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+CPS++P D G   I++  L+ LGF+IE  DF     +  +N +A  
Sbjct: 1   MSCPVIELTQQLIRCPSLSPDDAGCQAIMIERLRALGFTIERMDF-----ADTQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVPPGD + W  PPF   I +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVPPGDTDRWINPPFEPAIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHKGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDKGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKTQVLALLEKH-----QLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFITRMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|221640623|ref|YP_002526885.1| succinyl-diaminopimelate desuccinylase [Rhodobacter sphaeroides
           KD131]
 gi|238064805|sp|B9KP62|DAPE_RHOSK RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|221161404|gb|ACM02384.1| Succinyldiaminopimelate desuccinylase [Rhodobacter sphaeroides
           KD131]
          Length = 380

 Score =  285 bits (730), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 157/379 (41%), Positives = 224/379 (59%), Gaps = 15/379 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            L++CPSVTP++GGA  ++   L   GF     D    + + V NL+AR+G +  +  F 
Sbjct: 11  DLVRCPSVTPEEGGALDLIERILSGAGF-----DCTRVDRNGVPNLFARWGRKGANRTFG 65

Query: 71  --GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFG 128
             GH DVVP GD   WT  PF   IA+G ++GRG  DMK  +A F+AA   F+ +    G
Sbjct: 66  FNGHTDVVPVGDAAAWTRDPFGGEIADGWLWGRGATDMKSGVAAFVAAAVDFVQETPPDG 125

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           ++ L ITGDEEG A +GT  +L W+  +GE    C+VGEPTC   +G+ +KIGRRGS++ 
Sbjct: 126 AVVLTITGDEEGDAADGTVALLDWMAAEGEAMSVCLVGEPTCPERLGEMMKIGRRGSMTA 185

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
             T  G QGH AYPH  +NP+  L  L+ +L++   D G   F  + + +TT D GNP+ 
Sbjct: 186 FFTARGVQGHSAYPHRAKNPVAALARLIDRLSSHDLDRGTEHFDASTLAVTTFDTGNPAT 245

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLK---EEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFL 305
           NVIPA  + + NIRFND  +  +L    EE  +R+         LS  +   S     FL
Sbjct: 246 NVIPALCRATVNIRFNDAHSGASLTRWLEEEAARVTAETGVEIALSAKISGES-----FL 300

Query: 306 THDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENAS 365
           T   +L+ L+++++   TG  P  STSGGTSDARF++ +CPV+EFGLVG+TMH ++E   
Sbjct: 301 TPPGELSELVARAVEAETGLRPEPSTSGGTSDARFVRAHCPVVEFGLVGKTMHQVDERVE 360

Query: 366 LQDLEDLTCIYENFLQNWF 384
           +  +E L  IY   L+++F
Sbjct: 361 VGQIEPLKAIYLRILKDYF 379


>gi|94500610|ref|ZP_01307140.1| succinyl-diaminopimelate desuccinylase [Oceanobacter sp. RED65]
 gi|94427165|gb|EAT12145.1| succinyl-diaminopimelate desuccinylase [Oceanobacter sp. RED65]
          Length = 381

 Score =  285 bits (729), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 166/375 (44%), Positives = 222/375 (59%), Gaps = 13/375 (3%)

Query: 10  IQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMF 69
           I LI+  SVTP D     ++ + L+ LGF  E   F+      VKNL+AR GTE P + F
Sbjct: 11  IALIEQASVTPDDAECQPMMCDILEPLGFECETMQFEE-----VKNLWARKGTEGPLVCF 65

Query: 70  AGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-G 128
           AGH DVVP G  ++W +PPF ATI +G +YGRG  DMKGSIA F+AA  RF+  + +  G
Sbjct: 66  AGHTDVVPTGPESNWQHPPFDATIKDGMLYGRGAADMKGSIAAFLAATERFVKNHPDHKG 125

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           SI+ LIT DEEGPA NGT+K++  +E++ EK D CIVGEP+     GD IK GRRGSL  
Sbjct: 126 SIAYLITSDEEGPAKNGTRKVIKTLEERNEKIDMCIVGEPSSTKRCGDVIKNGRRGSLGA 185

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
            + + GKQGHVAYPHL +NPI    P L +L    +D GN  F  T+ +I+ I  G  + 
Sbjct: 186 VMKVKGKQGHVAYPHLAKNPIHLAAPALAELAQEEWDQGNDFFPATSFQISNIQGGTGAT 245

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHD 308
           NVIP  V++ FN RF+       LK   ++ L K       L + + ++    P FLT  
Sbjct: 246 NVIPGVVEIVFNFRFSTELTADDLKYRTQAILDK-----HGLDYEIEWNLSGEP-FLTDH 299

Query: 309 RKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQ 367
             L     ++I + T     LST+GGTSD RFI      V+E G +  T+H +NE+ S+ 
Sbjct: 300 GSLVDAAVEAIKHVTDIETELSTAGGTSDGRFIAPTGAQVVELGPINATIHQVNEHVSIH 359

Query: 368 DLEDLTCIYENFLQN 382
           DLE L+ +YE  L+N
Sbjct: 360 DLEQLSLVYERILEN 374


>gi|261856825|ref|YP_003264108.1| succinyl-diaminopimelate desuccinylase [Halothiobacillus
           neapolitanus c2]
 gi|261837294|gb|ACX97061.1| succinyl-diaminopimelate desuccinylase [Halothiobacillus
           neapolitanus c2]
          Length = 383

 Score =  285 bits (729), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 158/391 (40%), Positives = 223/391 (57%), Gaps = 22/391 (5%)

Query: 3   PDCLEHLIQ-LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           PD    L Q LI+  SVTP+D G   +L   L  + F+I    F       V NL+A  G
Sbjct: 7   PDPTIALAQDLIRRASVTPEDAGCQPLLAERLAAMDFTITPLRF-----GAVDNLWAVRG 61

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
           +  P   FAGH DVVP GD   W+ PPF+A I +  + GRG  DMKGSIA  + A+ RF+
Sbjct: 62  SSGPLFCFAGHTDVVPTGDATAWSQPPFAANIVDDVLIGRGSADMKGSIAAMVTAIERFV 121

Query: 122 -----PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGD 176
                P ++    ++ LIT DEEG A++GT K++ W+  + EK D C+VGEP+    +GD
Sbjct: 122 QTTPEPPFR----MAFLITSDEEGVAVDGTVKVIEWLNARDEKIDWCLVGEPSSRERLGD 177

Query: 177 TIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNM 236
             KIGRRGS++G + +HGKQGHVAYPHL +NP+    P L +LT I +D GN  F P+ +
Sbjct: 178 EYKIGRRGSITGNLVVHGKQGHVAYPHLADNPVHRAAPFLAELTAIEWDQGNAHFPPSTL 237

Query: 237 EITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHF 296
           +I  I  G  + NVIP  + + FN+RF    N ++  E+I++R ++ +    +L HT+++
Sbjct: 238 QIANIQAGTGANNVIPGALHVQFNLRF----NTESSVEKIQAR-VEALLEKHQLRHTLNW 292

Query: 297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGR 355
           S    P FLT        +  ++   TG  PL ST+GGTSD RFI      V+E G +  
Sbjct: 293 SVSGQP-FLTKQGAFVQAVEAAVAQVTGVKPLPSTAGGTSDGRFIAPTGAEVVELGPLNA 351

Query: 356 TMHALNENASLQDLEDLTCIYENFLQNWFIT 386
           T+H ++E   +  L DL+ IYE  L     T
Sbjct: 352 TIHQIDERVPVAHLIDLSRIYEALLNQLAAT 382


>gi|307609678|emb|CBW99186.1| succinyl-diaminopimelate desuccinylase [Legionella pneumophila
           130b]
          Length = 377

 Score =  285 bits (729), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 165/385 (42%), Positives = 227/385 (58%), Gaps = 14/385 (3%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D  + L  LI  PS+TP+D G    ++  L+ LGF+      Q  N   V N +A +G  
Sbjct: 3   DITQILTDLIGFPSITPEDAGCQKYMIQFLEQLGFTC-----QQLNNGPVSNFFACYGKI 57

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            P L+FAGH DVVP G+ + W   PFS     G +YGRG+ DMKGS+AC +    RFI  
Sbjct: 58  GPLLVFAGHTDVVPVGEVSKWDTDPFSLEEKNGMLYGRGVADMKGSLACMLHMARRFIKT 117

Query: 124 YKNF-GSISLLITGDEEGPAIN-GTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
           Y +F G +  LIT  EEG   N GT  ++  +E++G   D CIVGEP+ +   GD IKIG
Sbjct: 118 YPSFPGRLGFLITSGEEGDEFNLGTPYVMQKLEQQGIVIDYCIVGEPSSSLKTGDVIKIG 177

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSLS +I + GKQGHVAYPHL +NPI  + P+L +LT++ +D GN  F PT+M+IT I
Sbjct: 178 RRGSLSAKIHLSGKQGHVAYPHLADNPIHRISPVLAELTSMQWDNGNAYFPPTSMQITYI 237

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
             G  + N+IP ++ +  N R++    E+T  E +++R+I    +  KL+ T+ +     
Sbjct: 238 HCGGHAGNIIPGELNLHLNFRYS---TEQT-DESLKTRVINAFTH-HKLNPTIEWRFNGE 292

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHAL 360
           P FLT+   L     +++    G +P LSTSGGTSD RFI  Y   VIE GLV  T+H +
Sbjct: 293 P-FLTNKGILLESCKQTVLEHIGTLPELSTSGGTSDGRFIAPYGVEVIELGLVNATIHQV 351

Query: 361 NENASLQDLEDLTCIYENFLQNWFI 385
           NE  SLQDL  L  +Y +  +  FI
Sbjct: 352 NECTSLQDLNTLETMYFSICEKLFI 376


>gi|292492781|ref|YP_003528220.1| succinyl-diaminopimelate desuccinylase [Nitrosococcus halophilus
           Nc4]
 gi|291581376|gb|ADE15833.1| succinyl-diaminopimelate desuccinylase [Nitrosococcus halophilus
           Nc4]
          Length = 376

 Score =  285 bits (729), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 157/378 (41%), Positives = 223/378 (58%), Gaps = 13/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE   +LI C S+TPQD G   +L   LK LGF  E   F       V+N++ R G + P
Sbjct: 5   LELAKKLIACASITPQDAGCQPLLAERLKALGFRGERLPFGE-----VENIWLRRGQKPP 59

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
             +FAGH DVVPPG    W   PF+  + +  +YGRG  DMKGS+A  + A  RFI  + 
Sbjct: 60  LFVFAGHTDVVPPGPAEQWLSDPFTPELRDEMLYGRGAADMKGSLAAMVTASERFISAHP 119

Query: 126 N-FGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+ L+T DEEG A+NGT K++  +E +GEK D C+VGEPT    +GD +K GRRG
Sbjct: 120 DHLGSIAFLLTSDEEGRAVNGTVKVVETLEARGEKIDYCLVGEPTSRERVGDMVKNGRRG 179

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG + + G QGHVAYPHL +NPI  L P+L  L    +D GN  F PT  +++ I  G
Sbjct: 180 SLSGRLLVRGTQGHVAYPHLADNPIHSLAPVLVTLCTKEWDRGNEDFPPTTFQVSNIHGG 239

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
             + NVIP +V++ FN R++     + L++++ + L +  QN   L++ + ++    P F
Sbjct: 240 TGATNVIPGEVEVLFNFRYSTEVTHQQLQQQVEAILSQ--QN---LNYELEWTLSGKP-F 293

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNEN 363
            T    L + +S++I + TG     ST+GGTSD RFI      V+E G V  T+H +NE 
Sbjct: 294 RTAPGNLMTAVSQAIGDITGLETEFSTTGGTSDGRFIAPTGAQVVELGPVNATIHKVNEC 353

Query: 364 ASLQDLEDLTCIYENFLQ 381
            ++ DLE L+ +Y   L+
Sbjct: 354 VAVADLEKLSQVYSRLLE 371


>gi|27365262|ref|NP_760790.1| succinyl-diaminopimelate desuccinylase [Vibrio vulnificus CMCP6]
 gi|320155646|ref|YP_004188025.1| N-succinyl-L,L-diaminopimelate desuccinylase [Vibrio vulnificus
           MO6-24/O]
 gi|81448456|sp|Q8DBA6|DAPE_VIBVU RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|27361409|gb|AAO10317.1| succinyl-diaminopimelate desuccinylase [Vibrio vulnificus CMCP6]
 gi|319930958|gb|ADV85822.1| N-succinyl-L,L-diaminopimelate desuccinylase [Vibrio vulnificus
           MO6-24/O]
          Length = 377

 Score =  285 bits (728), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 155/374 (41%), Positives = 218/374 (58%), Gaps = 15/374 (4%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI   SVTP+D G   +++  L+ LGF+IE   F+        N +AR GT+AP   FAG
Sbjct: 13  LISRQSVTPEDAGCQDVMIARLEALGFTIERMVFED-----TTNFWARRGTQAPLFAFAG 67

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVP G   HW  PPF  T  EG +YGRG  DMKGS+A  I A  RFI ++ +  GSI
Sbjct: 68  HTDVVPAGKLEHWHTPPFEPTEKEGYLYGRGAADMKGSLAAMIVATERFIAEHPDHQGSI 127

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
             LIT DEEGP INGT +++  +  + E  D CIVGEP+   ++GD +K GRRGS++G++
Sbjct: 128 GFLITSDEEGPFINGTVRVVETLMARDENIDMCIVGEPSSTEVVGDVVKNGRRGSITGDL 187

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
           T+ G QGHVAYPHL +NP+   +  +H L    +D GN  F PT+ +I  +  G  + NV
Sbjct: 188 TVKGTQGHVAYPHLADNPVHKSLLAIHALATTEWDKGNEYFPPTSFQIPNVQAGTGASNV 247

Query: 251 IPAQVKMSFNIRFN-DLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           IP +  + FN+RF+ +L NE+     I  R+ + +     L++ + ++    P FLT   
Sbjct: 248 IPGEFHVQFNLRFSTELCNER-----IVERVTQTLDQ-HDLNYDLKWTYNGDP-FLTDTG 300

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQD 368
            L   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H +NE   + D
Sbjct: 301 ALLDAVVDAVDSVNQTKPALLTTGGTSDGRFIARMGGQVVELGPVNATIHKVNECVKIDD 360

Query: 369 LEDLTCIYENFLQN 382
           LE LT +Y+  L+N
Sbjct: 361 LEKLTDMYQKTLEN 374


>gi|293391369|ref|ZP_06635703.1| succinyl-diaminopimelate desuccinylase [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290951903|gb|EFE02022.1| succinyl-diaminopimelate desuccinylase [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 377

 Score =  285 bits (728), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 156/373 (41%), Positives = 219/373 (58%), Gaps = 13/373 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+ PS++P D G   ++   L+ LGF IE   F   N ++  NL+A+ G+  P + FAG
Sbjct: 12  LIRRPSISPNDEGCQQLIAERLEKLGFQIEWLPF---NDTL--NLWAKHGSGDPVIAFAG 66

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVP GD + WTYPPF A I +  +YGRG  DMKGS+A  + A   ++  ++N  G+I
Sbjct: 67  HTDVVPTGDESQWTYPPFDAKIVDDMLYGRGAADMKGSLAAMVVAAEEYVKAHRNHQGTI 126

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           +LLIT DEE  A +GT +++  +  +GEK   C+VGEP+ + I+GD +K GRRGS++G +
Sbjct: 127 ALLITSDEEAAAKDGTVRVVETLMARGEKITYCMVGEPSTSQILGDVVKNGRRGSITGNL 186

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
            I G QGHVAYPHL ENPI    P L +LT   +D GN  F PT+++I  I  G  S NV
Sbjct: 187 YIQGIQGHVAYPHLAENPIHNAAPFLQELTTYQWDNGNDFFPPTSLQIANIHAGTGSNNV 246

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IP ++ + FN+R+     +  +K+++   L K       L + + ++    P FLT   K
Sbjct: 247 IPGELYVQFNLRYCTEVTDGMIKQKVAEMLEK-----HGLKYRIEWNLSGKP-FLTKPGK 300

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDL 369
           L S L  S+    G  P L T GGTSD RFI      V+EFG +  T+H +NE  S++DL
Sbjct: 301 LVSALVDSLQQIAGITPKLETGGGTSDGRFIALMGAEVVEFGPLNATIHKVNECVSVEDL 360

Query: 370 EDLTCIYENFLQN 382
                IY   L N
Sbjct: 361 GKCGQIYHQMLVN 373


>gi|163801827|ref|ZP_02195724.1| succinyl-diaminopimelate desuccinylase [Vibrio sp. AND4]
 gi|159174335|gb|EDP59139.1| succinyl-diaminopimelate desuccinylase [Vibrio sp. AND4]
          Length = 378

 Score =  285 bits (728), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 158/376 (42%), Positives = 215/376 (57%), Gaps = 17/376 (4%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            LI   SVTP+D G   +++  LK LGF IE   F+        N +AR G EAP   FA
Sbjct: 12  DLISRQSVTPEDAGCQDVMIERLKALGFEIEVMVFED-----TTNFWARRGDEAPLFAFA 66

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI---PKYKNF 127
           GH DVVP G    W  PPF  TI +G ++GRG  DMKGS+AC + AV RFI   P +K  
Sbjct: 67  GHTDVVPAGKREQWDTPPFEPTIIDGYLHGRGAADMKGSLACMVVAVERFIAENPDHK-- 124

Query: 128 GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLS 187
           GSI  LIT DEEGP INGT +++  +  +GE  D CIVGEP+    +GD +K GRRGS++
Sbjct: 125 GSIGFLITSDEEGPFINGTVRVVETLMARGENIDMCIVGEPSSTKEVGDVVKNGRRGSIT 184

Query: 188 GEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPS 247
           G++T+ G QGHVAYPHL  NPI   +  +H+LT   +D GN  F PT+ +I  +  G  +
Sbjct: 185 GDLTVKGTQGHVAYPHLANNPINQSLVAIHELTTTEWDQGNDYFPPTSFQIPNVSAGTGA 244

Query: 248 KNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTH 307
            NVIP +  + FN+RF+     + + + I   L K      +L + + ++    P FLT 
Sbjct: 245 SNVIPGEFNVQFNLRFSTELTSEIIVQRITETLDK-----HELDYDLKWTFNGDP-FLTD 298

Query: 308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASL 366
              L   +  ++       P L T+GGTSD RFI      V+E G V  T+H +NE   +
Sbjct: 299 TGALLDAVVLAVDEVNSTKPALLTTGGTSDGRFIARMGGQVVELGPVNATIHKVNECVKV 358

Query: 367 QDLEDLTCIYENFLQN 382
            DLE LT +Y+N L++
Sbjct: 359 DDLEKLTDMYKNTLKH 374


>gi|329119159|ref|ZP_08247849.1| succinyl-diaminopimelate desuccinylase [Neisseria bacilliformis
           ATCC BAA-1200]
 gi|327464718|gb|EGF11013.1| succinyl-diaminopimelate desuccinylase [Neisseria bacilliformis
           ATCC BAA-1200]
          Length = 377

 Score =  285 bits (728), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 161/384 (41%), Positives = 221/384 (57%), Gaps = 13/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT   L    +LI  PSVTP D G   ++   L  LGF+ EE +F        KNL+ R 
Sbjct: 1   MTHPALALAKELIARPSVTPDDQGCQRLIAERLAPLGFTAEEMNFGD-----TKNLWLRR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT  P L FAGH DVVPPG    WT PPF     +G++YGRG  DMK SIA F+AA   F
Sbjct: 56  GTSGPLLCFAGHTDVVPPGPAEQWTSPPFEPAERDGRLYGRGAADMKSSIAAFVAACEAF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ +  GSI+LLIT DEEG A +GT +++  ++ +GE  D CIVGEPT    +GDT+K
Sbjct: 116 VAEHPHHKGSIALLITSDEEGDARDGTVRVVETLKARGETIDYCIVGEPTAVSELGDTVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSLSG +T++GKQGH+AYPHL +NP+      L +L    +D GN  F PT  +I+
Sbjct: 176 NGRRGSLSGHLTVYGKQGHIAYPHLADNPVHRAAAALAELAAEQWDAGNEYFPPTGFQIS 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  + NVIP ++ + FN R++   +   LK     R +  I +  +L + + ++  
Sbjct: 236 NIAAGTGATNVIPGELSVKFNFRYSTESDADGLK-----RRVHAILDRHRLPYRIDWTLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMH 358
             P FLT   +LT     +     G    LST+GGTSD RFIKD    +IE G V  T+H
Sbjct: 291 GLP-FLTEAGRLTECAQAATEKVCGIKAALSTTGGTSDGRFIKDIARELIELGPVNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            ++E+ +  D+  L  IY+  L +
Sbjct: 350 QIDEHIAAADIPRLARIYQTMLAD 373


>gi|77464709|ref|YP_354213.1| succinyl-diaminopimelate desuccinylase [Rhodobacter sphaeroides
           2.4.1]
 gi|123590846|sp|Q3IYS2|DAPE_RHOS4 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|77389127|gb|ABA80312.1| succinyldiaminopimelate desuccinylase [Rhodobacter sphaeroides
           2.4.1]
          Length = 380

 Score =  284 bits (727), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 156/379 (41%), Positives = 224/379 (59%), Gaps = 15/379 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            L++CPSVTP++GGA  ++   L   GF     D    + + V NL+AR+G +  +  F 
Sbjct: 11  DLVRCPSVTPEEGGALDLIERILSGAGF-----DCTRVDRNGVPNLFARWGRKGANRTFG 65

Query: 71  --GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFG 128
             GH DVVP GD   WT  PF   IA+G ++GRG  DMK  +A F+AA   F+ +    G
Sbjct: 66  FNGHTDVVPVGDAAAWTRDPFGGEIADGWLWGRGATDMKSGVAAFVAAAVDFVQETPPDG 125

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           ++ L ITGDEEG + +GT  +L W+  +GE    C+VGEPTC   +G+ +KIGRRGS++ 
Sbjct: 126 AVVLTITGDEEGDSTDGTVALLDWMAAEGEAMSVCLVGEPTCPERLGEMMKIGRRGSMTA 185

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
             T  G QGH AYPH  +NP+  L  L+ +L++   D G   F  + + +TT D GNP+ 
Sbjct: 186 FFTARGVQGHSAYPHRAKNPVAALARLIDRLSSHDLDYGTEHFDASTLAVTTFDTGNPAT 245

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLK---EEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFL 305
           NVIPA  + + NIRFND  +  +L    EE  +R+         LS  +   S     FL
Sbjct: 246 NVIPALCRATVNIRFNDAHSGASLTRWLEEEAARVAADTGVEIALSAKISGES-----FL 300

Query: 306 THDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENAS 365
           T   +L+ L+++++   TG  P  STSGGTSDARF++ +CPV+EFGLVG+TMH ++E   
Sbjct: 301 TPPGELSELVARAVEAETGLRPEPSTSGGTSDARFVRAHCPVVEFGLVGKTMHQVDERVE 360

Query: 366 LQDLEDLTCIYENFLQNWF 384
           +  +E L  IY   L+++F
Sbjct: 361 VAQIEPLKAIYLRILKDYF 379


>gi|157144596|ref|YP_001451915.1| succinyl-diaminopimelate desuccinylase [Citrobacter koseri ATCC
           BAA-895]
 gi|238064719|sp|A8ADB6|DAPE_CITK8 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|157081801|gb|ABV11479.1| hypothetical protein CKO_00316 [Citrobacter koseri ATCC BAA-895]
          Length = 375

 Score =  284 bits (727), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 154/384 (40%), Positives = 224/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF++E  DF        +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRAIGFTVEHMDFGD-----TQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ +  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   I+GD +K
Sbjct: 115 VAQHPDHQGRLAFLITSDEEASAKNGTVKVVETLMARNERLDYCLVGEPSSTEIVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P+L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++TLKE + + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFIQFNFRFSTELTDETLKERVHALLDK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|251792039|ref|YP_003006759.1| succinyl-diaminopimelate desuccinylase [Aggregatibacter aphrophilus
           NJ8700]
 gi|247533426|gb|ACS96672.1| succinyl-diaminopimelate desuccinylase [Aggregatibacter aphrophilus
           NJ8700]
          Length = 377

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 160/382 (41%), Positives = 223/382 (58%), Gaps = 17/382 (4%)

Query: 7   EHLIQL----IKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT 62
           +H+IQL    I+ PS++P D G   ++   L+ LGF IE   F   N ++  NL+A+ G+
Sbjct: 3   QHIIQLSQSLIRRPSISPNDEGCQQLIAERLEKLGFHIEWMPF---NDTL--NLWAKHGS 57

Query: 63  EAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIP 122
             P + FAGH DVVP GD   WTYPPFSA I +G +YGRG  DMKGS+A  I A   ++ 
Sbjct: 58  GEPVIAFAGHTDVVPTGDERQWTYPPFSAEIVDGMLYGRGAADMKGSLAAMIVAAEAYVK 117

Query: 123 KYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
              N  G+I+LLIT DEE  A +GT +++  +   GEK   C+VGEP+ +  +GD +K G
Sbjct: 118 VNPNHAGTIALLITSDEEAAAKDGTVRVVESLMACGEKITYCMVGEPSSSKTLGDVVKNG 177

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGS++G + + G QGHVAYPHL ENPI    P L +LT   +D GN  F PT+++I  I
Sbjct: 178 RRGSITGNLYVQGVQGHVAYPHLAENPIHKAAPFLQELTTYQWDNGNEFFPPTSLQIANI 237

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
             G  S NVIP ++ + FN+R+     ++ +K+++   L K       L + + ++    
Sbjct: 238 HAGTGSNNVIPGELYVQFNLRYCTEVTDEIIKQKVAEMLEK-----HGLKYRIEWNLSGK 292

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHAL 360
           P FLT   KL   L+ +I  TTG  P   T GGTSD RFI      V+EFG +  T+H +
Sbjct: 293 P-FLTKPGKLLDALTAAIEQTTGITPQAETGGGTSDGRFIALMGAEVVEFGPLNVTIHKV 351

Query: 361 NENASLQDLEDLTCIYENFLQN 382
           NE  S++DL     IY   L N
Sbjct: 352 NECVSVEDLAKCGQIYHQMLVN 373


>gi|114332195|ref|YP_748417.1| succinyl-diaminopimelate desuccinylase [Nitrosomonas eutropha C91]
 gi|122313129|sp|Q0ADY0|DAPE_NITEC RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|114309209|gb|ABI60452.1| succinyldiaminopimelate desuccinylase [Nitrosomonas eutropha C91]
          Length = 378

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 164/378 (43%), Positives = 217/378 (57%), Gaps = 17/378 (4%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI   S+TP D G   ILV+ L  LGF+ E  +F       V+NL+ R G + P + F G
Sbjct: 12  LIARRSLTPDDDGCQKILVHRLAGLGFNSEAMNFGE-----VENLWTRKGIDGPLVCFVG 66

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI---PKYKNFG 128
           H DVVP G    W   PF+ T+ +G +YGRG  DMK SIA F+ A+  F+   P +K  G
Sbjct: 67  HTDVVPTGPVAQWDSDPFTPTVRDGFLYGRGAADMKSSIAAFVTAIEEFVELHPDHK--G 124

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           SI+LLIT DEEGPA+ GT K++  ++ +GE  D CIVGEPTC   +GDTIK GRRGSLSG
Sbjct: 125 SIALLITSDEEGPAVEGTVKVVETLQARGEVIDYCIVGEPTCTDRLGDTIKNGRRGSLSG 184

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
            +T+ G QGH+AYPHL  NPI    P + +L    +D GN  F  T   I+ I  G  + 
Sbjct: 185 NLTVKGIQGHIAYPHLARNPIHTAAPAIAELAQTVWDDGNEYFPATTWHISNIRGGTGAT 244

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHD 308
           NVIP +V + FN RF+     ++LK  +       I +   L + + +     P +LT  
Sbjct: 245 NVIPGEVNLLFNFRFSTASTVESLKTRVHE-----ILDRHGLEYELVWELSGKP-YLTPK 298

Query: 309 RKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMHALNENASLQ 367
             L   LS +I   TG  P LSTSGGTSD RFI D C  V+EFG    T+H +NE+  + 
Sbjct: 299 GILADALSAAIREVTGVEPELSTSGGTSDGRFIADICSQVVEFGPRNATIHKINESVEVA 358

Query: 368 DLEDLTCIYENFLQNWFI 385
           D+E L+ IY   L+   +
Sbjct: 359 DIERLSRIYRLTLEKLLL 376


>gi|148979877|ref|ZP_01815755.1| succinyl-diaminopimelate desuccinylase [Vibrionales bacterium
           SWAT-3]
 gi|145961569|gb|EDK26870.1| succinyl-diaminopimelate desuccinylase [Vibrionales bacterium
           SWAT-3]
          Length = 378

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 157/376 (41%), Positives = 213/376 (56%), Gaps = 13/376 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            LI   SVTP+D G   +++N LK LGF IE   F+        N +AR GTEAP   FA
Sbjct: 12  DLISRQSVTPEDAGCQELMINRLKALGFEIEVMVFED-----TTNFWARRGTEAPLFAFA 66

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVP G    W   PF  TI +G ++GRG  DMKGS+A  I AV +FI KY +  GS
Sbjct: 67  GHTDVVPAGPIEQWNTKPFEPTIVDGYLHGRGAADMKGSLASMIVAVEQFIEKYPDHSGS 126

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I  LIT DEEGP INGT +++  +  +GE  D CIVGEP+    +GD +K GRRGS++G+
Sbjct: 127 IGFLITSDEEGPFINGTVRVVEALMARGENIDMCIVGEPSSTEFVGDVVKNGRRGSITGD 186

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +TI G QGHVAYPHL  NP+   +  +++L    +D GN  F PT+ +I  +  G  + N
Sbjct: 187 LTIKGTQGHVAYPHLANNPVHSSLLAINELATTEWDQGNNYFPPTSFQIPNVSAGTGASN 246

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP +  + FN+RF+   +   + E + + L K         + + ++    P FLT   
Sbjct: 247 VIPGEFNVQFNLRFSTELSNDIIVERVTTTLDK-----YDFEYDLKWTFNGDP-FLTDAG 300

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQD 368
            L   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H +NE   + D
Sbjct: 301 SLLDAIVDAVGHVNDVKPALLTTGGTSDGRFIARMGGQVVELGPVNATIHKVNECVKVAD 360

Query: 369 LEDLTCIYENFLQNWF 384
           LE LT +YE  L N F
Sbjct: 361 LEKLTDMYERTLVNLF 376


>gi|238055336|sp|A3M8H2|DAPE_ACIBT RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|193078256|gb|ABO13216.2| succinyl-diaminopimelate desuccinylase [Acinetobacter baumannii
           ATCC 17978]
          Length = 378

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 159/369 (43%), Positives = 216/369 (58%), Gaps = 13/369 (3%)

Query: 16  PSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDV 75
           PSVTP D     I+ + L  +GF IE   F       V NL+AR GTE P   FAGH DV
Sbjct: 17  PSVTPIDHTCQTIMADRLAKVGFHIEPMRFGD-----VDNLWARRGTEGPVFCFAGHTDV 71

Query: 76  VPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSISLLI 134
           VP G  + W   PF+  I +GK+YGRG  DMK ++A  + A  RF+ K+ N  GSI+ LI
Sbjct: 72  VPTGRLDAWNSDPFAPEIRDGKLYGRGSADMKTALAAMVVASERFVAKHPNHKGSIAFLI 131

Query: 135 TGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHG 194
           T DEEGPA+NGT K++  +EK+ EK   C+VGEP+  H +GD +K GRRGSL+  + + G
Sbjct: 132 TSDEEGPAVNGTVKVIETLEKRNEKITWCLVGEPSSTHKLGDIVKNGRRGSLNAVLKVQG 191

Query: 195 KQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQ 254
           KQGHVAYPHL  NPI    P L +L    +D GN  F  T+ +I+ I  G  + NVIP  
Sbjct: 192 KQGHVAYPHLARNPIHEASPALAELCQTVWDNGNEYFPATSFQISNIHAGTGATNVIPGA 251

Query: 255 VKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSL 314
           ++++FN R++     + LK+ +   L K       L + + ++    P FLT   +L + 
Sbjct: 252 LEVTFNFRYSTEVTAEQLKQRVHEILDKH-----GLQYEIVWNLSGLP-FLTPVGELVNA 305

Query: 315 LSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDLEDLT 373
              +I N TG    LSTSGGTSD RFI      V+E G++  T+H +NE+  + DL+ LT
Sbjct: 306 AQTAILNVTGTETELSTSGGTSDGRFIAPTGAQVLELGVLNATIHQINEHVDVHDLDPLT 365

Query: 374 CIYENFLQN 382
            IYE  L+N
Sbjct: 366 DIYEQILEN 374


>gi|169794850|ref|YP_001712643.1| succinyl-diaminopimelate desuccinylase [Acinetobacter baumannii
           AYE]
 gi|213157823|ref|YP_002320621.1| succinyl-diaminopimelate desuccinylase [Acinetobacter baumannii
           AB0057]
 gi|301348077|ref|ZP_07228818.1| succinyl-diaminopimelate desuccinylase [Acinetobacter baumannii
           AB056]
 gi|301513346|ref|ZP_07238583.1| succinyl-diaminopimelate desuccinylase [Acinetobacter baumannii
           AB058]
 gi|301597641|ref|ZP_07242649.1| succinyl-diaminopimelate desuccinylase [Acinetobacter baumannii
           AB059]
 gi|238055166|sp|B7I842|DAPE_ACIB5 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238055191|sp|B0V4V8|DAPE_ACIBY RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|169147777|emb|CAM85640.1| succinyl-diaminopimelate desuccinylase [Acinetobacter baumannii
           AYE]
 gi|213056983|gb|ACJ41885.1| succinyl-diaminopimelate desuccinylase [Acinetobacter baumannii
           AB0057]
          Length = 377

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 159/369 (43%), Positives = 216/369 (58%), Gaps = 13/369 (3%)

Query: 16  PSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDV 75
           PSVTP D     I+ + L  +GF IE   F       V NL+AR GTE P   FAGH DV
Sbjct: 17  PSVTPIDHTCQTIMADRLAKVGFHIEPMRFGD-----VDNLWARRGTEGPVFCFAGHTDV 71

Query: 76  VPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSISLLI 134
           VP G  + W   PF+  I +GK+YGRG  DMK ++A  + A  RF+ K+ N  GSI+ LI
Sbjct: 72  VPTGRLDAWNSDPFAPEIRDGKLYGRGSADMKTALAAMVVASERFVAKHPNHKGSIAFLI 131

Query: 135 TGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHG 194
           T DEEGPA+NGT K++  +EK+ EK   C+VGEP+  H +GD +K GRRGSL+  + + G
Sbjct: 132 TSDEEGPAVNGTVKVIETLEKRNEKITWCLVGEPSSTHKLGDIVKNGRRGSLNAVLKVQG 191

Query: 195 KQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQ 254
           KQGHVAYPHL  NPI    P L +L    +D GN  F  T+ +I+ I  G  + NVIP  
Sbjct: 192 KQGHVAYPHLARNPIHEASPALAELCQTVWDNGNEYFPATSFQISNIHAGTGATNVIPGA 251

Query: 255 VKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSL 314
           ++++FN R++     + LK+ +   L K       L + + ++    P FLT   +L + 
Sbjct: 252 LEVTFNFRYSTEVTAEQLKQRVHEILDKH-----GLQYEIVWNLSGLP-FLTPVGELVNA 305

Query: 315 LSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDLEDLT 373
              +I N TG    LSTSGGTSD RFI      V+E G++  T+H +NE+  + DL+ LT
Sbjct: 306 AQTAILNVTGTETELSTSGGTSDGRFIAPTGAQVLELGVLNATIHQINEHVDVHDLDPLT 365

Query: 374 CIYENFLQN 382
            IYE  L+N
Sbjct: 366 DIYEQILEN 374


>gi|293611004|ref|ZP_06693303.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826656|gb|EFF85022.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 378

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 160/369 (43%), Positives = 215/369 (58%), Gaps = 13/369 (3%)

Query: 16  PSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDV 75
           PSVTP D     I+ + L  +GF IE   F       V NL+AR GTE P   FAGH DV
Sbjct: 17  PSVTPIDHTCQTIMADRLAKIGFHIEPMRFGE-----VDNLWARRGTEEPVFCFAGHTDV 71

Query: 76  VPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSISLLI 134
           VP G    W   PF   I +GK+YGRG  DMK ++A  + A  RF+ K+ +  GSI+ LI
Sbjct: 72  VPTGKLEAWNSDPFVPEIRDGKLYGRGSADMKTALAAMVVASERFVAKHPDHKGSIAFLI 131

Query: 135 TGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHG 194
           T DEEGPAINGT K++  +EK+ EK   C+VGEP+  H +GD +K GRRGSL+  + + G
Sbjct: 132 TSDEEGPAINGTVKVIETLEKRNEKMTWCLVGEPSSTHKLGDIVKNGRRGSLNAVLKVQG 191

Query: 195 KQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQ 254
           KQGHVAYPHL  NPI    P L +L    +D GN  F  T+ +I+ I  G  + NVIP  
Sbjct: 192 KQGHVAYPHLARNPIHEASPALAELCQTVWDNGNEYFPATSFQISNIHAGTGATNVIPGA 251

Query: 255 VKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSL 314
           ++++FN R++     + LK+ +   L K       L + + ++    P FLT   +L + 
Sbjct: 252 LEVTFNFRYSTEVTAEQLKQRVHEILDKH-----GLQYEIVWNLSGLP-FLTPVGELVNA 305

Query: 315 LSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDLEDLT 373
              +I N TG    LSTSGGTSD RFI      V+E G++  T+H +NE+  +QDL+ LT
Sbjct: 306 AQTAILNVTGTETELSTSGGTSDGRFIAPTGAQVLELGVLNATIHQINEHVDVQDLDPLT 365

Query: 374 CIYENFLQN 382
            IYE  L+N
Sbjct: 366 DIYEQILEN 374


>gi|37680684|ref|NP_935293.1| succinyl-diaminopimelate desuccinylase [Vibrio vulnificus YJ016]
 gi|37199433|dbj|BAC95264.1| succinyl-diaminopimelate desuccinylase [Vibrio vulnificus YJ016]
          Length = 401

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 155/374 (41%), Positives = 218/374 (58%), Gaps = 15/374 (4%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI   SVTP+D G   +++  L+ LGF+IE   F+        N +AR GT+AP   FAG
Sbjct: 37  LISRQSVTPEDAGCQDVMIARLEALGFTIERMVFED-----TTNFWARRGTQAPLFAFAG 91

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVP G   HW  PPF  T  EG +YGRG  DMKGS+A  I A  RFI ++ +  GSI
Sbjct: 92  HTDVVPAGKLEHWHTPPFEPTEKEGYLYGRGAADMKGSLAAMIVATERFIAEHPDHQGSI 151

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
             LIT DEEGP INGT +++  +  + E  D CIVGEP+   ++GD +K GRRGS++G++
Sbjct: 152 GFLITSDEEGPFINGTVRVVETLMARDENIDMCIVGEPSSTEVVGDVVKNGRRGSITGDL 211

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
           T+ G QGHVAYPHL +NP+   +  +H L    +D GN  F PT+ +I  +  G  + NV
Sbjct: 212 TVIGTQGHVAYPHLADNPVHKSLLAIHALATTEWDKGNEYFPPTSFQIPNVQAGTGASNV 271

Query: 251 IPAQVKMSFNIRFN-DLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           IP +  + FN+RF+ +L NE+     I  R+ + +     L++ + ++    P FLT   
Sbjct: 272 IPGEFHVQFNLRFSTELCNER-----IVERVTQTLDQ-HDLNYDLKWTYNGDP-FLTDTG 324

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQD 368
            L   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H +NE   + D
Sbjct: 325 ALLDAVVDAVDSVNQTKPALLTTGGTSDGRFIARMGGQVVELGPVNATIHKVNECVKIDD 384

Query: 369 LEDLTCIYENFLQN 382
           LE LT +Y+  L+N
Sbjct: 385 LEKLTDMYQKTLEN 398


>gi|294635444|ref|ZP_06713932.1| succinyl-diaminopimelate desuccinylase [Edwardsiella tarda ATCC
           23685]
 gi|291091177|gb|EFE23738.1| succinyl-diaminopimelate desuccinylase [Edwardsiella tarda ATCC
           23685]
          Length = 377

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 147/374 (39%), Positives = 222/374 (59%), Gaps = 13/374 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           QLI+CPS++P D G   IL+  L+ L F IE            +NL+A  G E P L FA
Sbjct: 12  QLIRCPSLSPDDAGCQEILMARLRALDFHIEAMPHGE-----TRNLWAWRGGEGPVLAFA 66

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGS 129
           GH DVVPPGD   W +PPF+ T+ +G +YGRG  DMKGS+A  I A  RF+  +  + G 
Sbjct: 67  GHTDVVPPGDERQWRHPPFTPTLEDGLLYGRGAADMKGSLAAMIVAAERFVAAHPTHAGR 126

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           ++ LIT DEE  A +GT +++  +  +GE+ D C+VGEP+    +GD +K GRRGS++ +
Sbjct: 127 LAFLITSDEEASARDGTVRVVETLMARGERLDYCLVGEPSSEQRLGDVVKNGRRGSITAD 186

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +T+HG QGHVAYPHL +NP+    P+L +L  I +D GN  F PT+++I  +  G  S N
Sbjct: 187 LTVHGIQGHVAYPHLADNPVHRAAPMLAELVAIEWDRGNDFFPPTSLQIANLAAGTGSNN 246

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP ++ + FN+RF+   + +++++ + + L +       L +T+++S    P FLT   
Sbjct: 247 VIPGELYVQFNLRFSTESSVESIQQRVTALLERH-----GLRYTLNWSLSGLP-FLTPGG 300

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQD 368
            L   +  ++    G  P L T+GGTSD RFI      V+E G +  T+H ++E  S  D
Sbjct: 301 ALVEAVVDAVNCYAGQAPRLLTTGGTSDGRFIARMGAQVVELGPLNATIHKVDECVSAAD 360

Query: 369 LEDLTCIYENFLQN 382
           L+ L  +Y+  ++ 
Sbjct: 361 LQRLCRMYQRIMER 374


>gi|262368838|ref|ZP_06062167.1| succinyl-diaminopimelate desuccinylase [Acinetobacter johnsonii
           SH046]
 gi|262316516|gb|EEY97554.1| succinyl-diaminopimelate desuccinylase [Acinetobacter johnsonii
           SH046]
          Length = 377

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 156/378 (41%), Positives = 229/378 (60%), Gaps = 13/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           L+  +QL++ PSVTP D     I+   LK +GF+IE   F       V NL+AR GTE+P
Sbjct: 7   LDLSLQLLRQPSVTPVDHNCQNIMAERLKKIGFNIESMRFDD-----VDNLWARKGTESP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
              FAGH DVVP G+ + W   PF+  I +GK+YGRG  DMK ++A  + A  RF+ K+ 
Sbjct: 62  VFCFAGHTDVVPTGNLDAWNSDPFAPEIRDGKLYGRGSADMKTALAAMVVASERFVAKHP 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           N  GSI+ LIT DEEGP+INGT K++  +E + EK   C+VGEP+  H +GD +K GRRG
Sbjct: 122 NHKGSIAFLITSDEEGPSINGTVKVIETLEARNEKMKWCLVGEPSSTHQLGDIVKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SL+  +T+ GKQGHVAYPHL  NPI      + +L +  +D GN  F  T+ +++ I  G
Sbjct: 182 SLNAVLTVKGKQGHVAYPHLAINPIHMASKAVSELCDTVWDQGNEYFPATSFQVSNIQAG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
             + NV+P  + ++FN R+    + +   EE+++R+++ I +   L + + ++    P F
Sbjct: 242 TGATNVVPGTMTVTFNFRY----STELTAEELKARVLE-ILDRHGLVYDIKWTHSGLP-F 295

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNEN 363
           LT   +L +    +I N TG    LSTSGGTSD RFI      V+E G++  ++H ++E+
Sbjct: 296 LTPVGELVNAAKNAIRNVTGVETELSTSGGTSDGRFIAPTGAQVLELGVLNASIHQIDEH 355

Query: 364 ASLQDLEDLTCIYENFLQ 381
            ++ DLE L  IYE  L+
Sbjct: 356 VNVADLEPLAEIYEQILE 373


>gi|330445308|ref|ZP_08308960.1| succinyl-diaminopimelate desuccinylase [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328489499|dbj|GAA03457.1| succinyl-diaminopimelate desuccinylase [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 376

 Score =  283 bits (725), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 158/372 (42%), Positives = 220/372 (59%), Gaps = 13/372 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           L+  PSVTP+D G   +++  L+ LGF+IE   F+        NL+AR GT+AP  +FAG
Sbjct: 13  LMSRPSVTPEDAGCQDVMIARLEQLGFTIETMVFEDTT-----NLWARRGTQAPLFVFAG 67

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVP G    W  PPF  TI +G ++GRG  DMKGS+AC I A+ RFI +  +  GSI
Sbjct: 68  HTDVVPSGPVEQWHTPPFEPTIIDGYLHGRGAADMKGSLACMIVAIERFIAENPDHNGSI 127

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           +LLIT DEEGP INGT +++  +E + EK D CIVGEP+    +GD +K GRRGS++G++
Sbjct: 128 ALLITSDEEGPFINGTTRVVDTLEARNEKIDMCIVGEPSSTLNVGDVVKNGRRGSITGDL 187

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
           T+ G QGHVAYPHL  NP+   +P L +L    +D GN  F PT+ +I  I  G  + NV
Sbjct: 188 TVKGIQGHVAYPHLANNPVHKALPALAELAATTWDNGNEYFPPTSFQIPNIAAGTGASNV 247

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IP + ++ FN RF+    +  +K  + S L     +   L + + ++    P FLT    
Sbjct: 248 IPGEFQVQFNFRFSTELTDTEIKRRVHSVL-----DAHGLDYDLKWTLSGHP-FLTDKGT 301

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFI-KDYCPVIEFGLVGRTMHALNENASLQDL 369
           L   +  +I       P L T+GGTSD RFI +    V+E G V  T+H +NE   + DL
Sbjct: 302 LVEAVVAAIEEVNHQQPELLTTGGTSDGRFIARTGAQVVELGPVNATIHKVNECVKVADL 361

Query: 370 EDLTCIYENFLQ 381
           E LT +Y+  L+
Sbjct: 362 EKLTDMYQKVLE 373


>gi|119774783|ref|YP_927523.1| succinyl-diaminopimelate desuccinylase [Shewanella amazonensis
           SB2B]
 gi|238055218|sp|A1S647|DAPE_SHEAM RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|119767283|gb|ABL99853.1| succinyldiaminopimelate desuccinylase [Shewanella amazonensis SB2B]
          Length = 382

 Score =  283 bits (725), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 160/380 (42%), Positives = 222/380 (58%), Gaps = 13/380 (3%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +E   +LI  PSVTP D G   ++   L  +GF+IE   F+        NL+AR GTE
Sbjct: 9   DVIELTRELISRPSVTPLDEGCQDLMAKRLAAIGFTIEPMVFEDTT-----NLWARRGTE 63

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            P   FAGH DVVP GD N W  PPF   + +G I+GRG  DMKGS+A  + A  RF+ +
Sbjct: 64  GPVFCFAGHTDVVPVGDLNRWHTPPFDPVVIDGYIHGRGAADMKGSLAAMVVAAERFVAE 123

Query: 124 YKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
           + +  GSI+ LIT DEEGP INGT +++  +E + EK    +VGEP+  H++GD +K GR
Sbjct: 124 HPDHQGSIAFLITSDEEGPFINGTVRVVETLEARHEKITWALVGEPSSTHLLGDVVKNGR 183

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSL+G +T+ G QGHVAYPHL +NPI    P L +L+ I +D GN  F PT+ +I  I+
Sbjct: 184 RGSLTGNLTVKGIQGHVAYPHLADNPIHRAAPALAELSRIEWDKGNEFFPPTSFQIANIN 243

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
            G  + NVIP ++K+ FN R+    + +   E + +R++ GI +   L + + +     P
Sbjct: 244 GGTGASNVIPGELKVMFNFRY----STEVTAETLIARVL-GILDAHGLDYDIDWVFNGLP 298

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALN 361
            FLT +  L     ++I+  TG      T+GGTSD RFI      VIE G V  T+H +N
Sbjct: 299 -FLTGEGPLLDATREAIFEVTGTHTDPQTTGGTSDGRFIAPTGAQVIELGPVNATIHKVN 357

Query: 362 ENASLQDLEDLTCIYENFLQ 381
           E     DLE LT  Y+  L+
Sbjct: 358 ECVKASDLELLTGCYQRILE 377


>gi|215482397|ref|YP_002324579.1| succinyl-diaminopimelate desuccinylase [Acinetobacter baumannii
           AB307-0294]
 gi|332852304|ref|ZP_08434109.1| succinyl-diaminopimelate desuccinylase [Acinetobacter baumannii
           6013150]
 gi|332870527|ref|ZP_08439291.1| succinyl-diaminopimelate desuccinylase [Acinetobacter baumannii
           6013113]
 gi|238055165|sp|B7GXA3|DAPE_ACIB3 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|213988451|gb|ACJ58750.1| succinyl-diaminopimelate desuccinylase [Acinetobacter baumannii
           AB307-0294]
 gi|332729434|gb|EGJ60774.1| succinyl-diaminopimelate desuccinylase [Acinetobacter baumannii
           6013150]
 gi|332732264|gb|EGJ63532.1| succinyl-diaminopimelate desuccinylase [Acinetobacter baumannii
           6013113]
          Length = 377

 Score =  283 bits (725), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 159/369 (43%), Positives = 216/369 (58%), Gaps = 13/369 (3%)

Query: 16  PSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDV 75
           PSVTP D     I+ + L  +GF IE   F       V NL+AR GTE P   FAGH DV
Sbjct: 17  PSVTPIDHTCQTIMADRLAKVGFHIEPMRFGD-----VDNLWARRGTEGPVFCFAGHTDV 71

Query: 76  VPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSISLLI 134
           VP G  + W   PF+  I +GK+YGRG  DMK ++A  + A  RF+ K+ N  GSI+ LI
Sbjct: 72  VPTGRLDAWNSDPFAPEIRDGKLYGRGSADMKTALAAMVVASERFVAKHPNHKGSIAFLI 131

Query: 135 TGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHG 194
           T DEEGPA+NGT K++  +EK+ EK   C+VGEP+  H +GD +K GRRGSL+  + + G
Sbjct: 132 TSDEEGPAVNGTVKVIETLEKRNEKITWCLVGEPSSTHKLGDIVKNGRRGSLNAVLKVQG 191

Query: 195 KQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQ 254
           KQGHVAYPHL  NPI    P L +L    +D GN  F  T+ +I+ I  G  + NVIP  
Sbjct: 192 KQGHVAYPHLARNPIHEASPALAELCQTVWDNGNEYFPATSFQISNIHAGTGATNVIPGA 251

Query: 255 VKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSL 314
           ++++FN R++     + LK+ +   L K       L + + ++    P FLT   +L + 
Sbjct: 252 LEVTFNFRYSTEVTAEQLKQRVHEILDKH-----GLQYEIVWNLSGLP-FLTPVGELVNA 305

Query: 315 LSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDLEDLT 373
              +I N TG    LSTSGGTSD RFI      V+E G++  T+H +NE+  + DL+ LT
Sbjct: 306 AQTAILNVTGTETELSTSGGTSDGRFIAPTGAQVLELGVLNATIHQINEHVDVHDLDPLT 365

Query: 374 CIYENFLQN 382
            IYE  L+N
Sbjct: 366 DIYEQILEN 374


>gi|238055329|sp|Q7MIL6|DAPE_VIBVY RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 377

 Score =  283 bits (725), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 155/374 (41%), Positives = 218/374 (58%), Gaps = 15/374 (4%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI   SVTP+D G   +++  L+ LGF+IE   F+        N +AR GT+AP   FAG
Sbjct: 13  LISRQSVTPEDAGCQDVMIARLEALGFTIERMVFEDTT-----NFWARRGTQAPLFAFAG 67

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVP G   HW  PPF  T  EG +YGRG  DMKGS+A  I A  RFI ++ +  GSI
Sbjct: 68  HTDVVPAGKLEHWHTPPFEPTEKEGYLYGRGAADMKGSLAAMIVATERFIAEHPDHQGSI 127

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
             LIT DEEGP INGT +++  +  + E  D CIVGEP+   ++GD +K GRRGS++G++
Sbjct: 128 GFLITSDEEGPFINGTVRVVETLMARDENIDMCIVGEPSSTEVVGDVVKNGRRGSITGDL 187

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
           T+ G QGHVAYPHL +NP+   +  +H L    +D GN  F PT+ +I  +  G  + NV
Sbjct: 188 TVIGTQGHVAYPHLADNPVHKSLLAIHALATTEWDKGNEYFPPTSFQIPNVQAGTGASNV 247

Query: 251 IPAQVKMSFNIRFN-DLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           IP +  + FN+RF+ +L NE+     I  R+ + +     L++ + ++    P FLT   
Sbjct: 248 IPGEFHVQFNLRFSTELCNER-----IVERVTQTLDQ-HDLNYDLKWTYNGDP-FLTDTG 300

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQD 368
            L   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H +NE   + D
Sbjct: 301 ALLDAVVDAVDSVNQTKPALLTTGGTSDGRFIARMGGQVVELGPVNATIHKVNECVKIDD 360

Query: 369 LEDLTCIYENFLQN 382
           LE LT +Y+  L+N
Sbjct: 361 LEKLTDMYQKTLEN 374


>gi|169632524|ref|YP_001706260.1| succinyl-diaminopimelate desuccinylase [Acinetobacter baumannii
           SDF]
 gi|260557215|ref|ZP_05829431.1| succinyl-diaminopimelate desuccinylase [Acinetobacter baumannii
           ATCC 19606]
 gi|238055168|sp|B0VRY3|DAPE_ACIBS RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|169151316|emb|CAP00024.1| succinyl-diaminopimelate desuccinylase [Acinetobacter baumannii]
 gi|260409321|gb|EEX02623.1| succinyl-diaminopimelate desuccinylase [Acinetobacter baumannii
           ATCC 19606]
          Length = 377

 Score =  283 bits (725), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 159/369 (43%), Positives = 216/369 (58%), Gaps = 13/369 (3%)

Query: 16  PSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDV 75
           PSVTP D     I+ + L  +GF IE   F       V NL+AR GTE P   FAGH DV
Sbjct: 17  PSVTPIDHTCQTIMADRLAKVGFHIEPMRFGD-----VDNLWARRGTEGPVFCFAGHTDV 71

Query: 76  VPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSISLLI 134
           VP G  + W   PF+  I +GK+YGRG  DMK ++A  + A  RF+ K+ N  GSI+ LI
Sbjct: 72  VPTGRLDAWNSDPFAPEIRDGKLYGRGSADMKTALAAMVVASERFVAKHPNHKGSIAFLI 131

Query: 135 TGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHG 194
           T DEEGPA+NGT K++  +EK+ EK   C+VGEP+  H +GD +K GRRGSL+  + + G
Sbjct: 132 TSDEEGPAVNGTVKVIETLEKRNEKITWCLVGEPSSTHKLGDIVKNGRRGSLNAVLKVQG 191

Query: 195 KQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQ 254
           KQGHVAYPHL  NPI    P L +L    +D GN  F  T+ +I+ I  G  + NVIP  
Sbjct: 192 KQGHVAYPHLARNPIHEASPALAELCQTVWDNGNEYFPATSFQISNIHAGTGATNVIPGT 251

Query: 255 VKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSL 314
           ++++FN R++     + LK+ +   L K       L + + ++    P FLT   +L + 
Sbjct: 252 LEVTFNFRYSTEVTAEQLKQRVHEILDKH-----GLQYEIVWNLSGLP-FLTPVGELVNA 305

Query: 315 LSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDLEDLT 373
              +I N TG    LSTSGGTSD RFI      V+E G++  T+H +NE+  + DL+ LT
Sbjct: 306 AQTAILNVTGTETELSTSGGTSDGRFIAPTGAQVLELGVLNATIHQINEHVDVHDLDPLT 365

Query: 374 CIYENFLQN 382
            IYE  L+N
Sbjct: 366 DIYEQILEN 374


>gi|332559602|ref|ZP_08413924.1| succinyl-diaminopimelate desuccinylase [Rhodobacter sphaeroides
           WS8N]
 gi|332277314|gb|EGJ22629.1| succinyl-diaminopimelate desuccinylase [Rhodobacter sphaeroides
           WS8N]
          Length = 380

 Score =  283 bits (725), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 154/377 (40%), Positives = 224/377 (59%), Gaps = 11/377 (2%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            L++CPSVTP++GGA  ++   L   GF     D    + + V NL+AR+G +  +  F 
Sbjct: 11  DLVRCPSVTPEEGGALDLIERILSGAGF-----DCTRVDRNGVPNLFARWGRKGANRTFG 65

Query: 71  --GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFG 128
             GH DVVP GD   WT  PF   IA+G ++GRG  DMK  +A F+AA   F+ +    G
Sbjct: 66  FNGHTDVVPVGDAAAWTRDPFGGEIADGWLWGRGATDMKSGVAAFVAAAVDFVQETPPDG 125

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           ++ L ITGDEEG A +GT  +L W+  +GE    C+VGEPTC   +G+ +KIGRRGS++ 
Sbjct: 126 AVVLTITGDEEGDATDGTVALLDWMAAEGEAMSVCLVGEPTCPERLGEMMKIGRRGSMTA 185

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
             T  G QGH AYPH  +NP+  L  L+ +L++   D G   F  + + +TT D GNP+ 
Sbjct: 186 FFTARGVQGHSAYPHRAKNPVAALARLIDRLSSHDLDQGTEHFDASTLAVTTFDTGNPAT 245

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS-PVFLTH 307
           NVIPA  + + NIRFND  +  +L   +      G+    +    +  S+ +S   FLT 
Sbjct: 246 NVIPALCRATVNIRFNDAHSGASLTRWLEEE-AAGV--TAETGVEIALSAKISGESFLTP 302

Query: 308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQ 367
             +L+ L+++++   TG  P  STSGGTSDARF++ +CPV+EFGLVG+TMH ++E   + 
Sbjct: 303 PGELSELVARAVEAETGLRPEPSTSGGTSDARFVRAHCPVVEFGLVGKTMHQVDERVEVA 362

Query: 368 DLEDLTCIYENFLQNWF 384
            +E L  IY   L+++F
Sbjct: 363 QIEPLKAIYLRILKDYF 379


>gi|184159377|ref|YP_001847716.1| succinyl-diaminopimelate desuccinylase [Acinetobacter baumannii
           ACICU]
 gi|332876217|ref|ZP_08443992.1| succinyl-diaminopimelate desuccinylase [Acinetobacter baumannii
           6014059]
 gi|238055167|sp|B2HY23|DAPE_ACIBC RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|183210971|gb|ACC58369.1| Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase
           [Acinetobacter baumannii ACICU]
 gi|322509289|gb|ADX04743.1| dapE [Acinetobacter baumannii 1656-2]
 gi|323519316|gb|ADX93697.1| succinyl-diaminopimelate desuccinylase [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332735489|gb|EGJ66541.1| succinyl-diaminopimelate desuccinylase [Acinetobacter baumannii
           6014059]
          Length = 378

 Score =  283 bits (725), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 160/369 (43%), Positives = 215/369 (58%), Gaps = 13/369 (3%)

Query: 16  PSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDV 75
           PSVTP D     I+   L  +GF IE   F       V NL+AR GTE P   FAGH DV
Sbjct: 17  PSVTPIDHTCQTIIAERLAKVGFHIEPMRFGD-----VDNLWARRGTEGPVFCFAGHTDV 71

Query: 76  VPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSISLLI 134
           VP G  + W   PF+  I +GK+YGRG  DMK ++A  + A  RFI K+ N  GSI+ LI
Sbjct: 72  VPTGRLDAWNSDPFAPEIRDGKLYGRGSADMKTALAAMVVASERFIAKHPNHKGSIAFLI 131

Query: 135 TGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHG 194
           T DEEGPA+NGT K++  +EK+ EK   C+VGEP+  H +GD +K GRRGSL+  + + G
Sbjct: 132 TSDEEGPAVNGTVKVIETLEKRNEKITWCLVGEPSSTHKLGDIVKNGRRGSLNAVLKVQG 191

Query: 195 KQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQ 254
           KQGHVAYPHL  NPI    P L +L    +D GN  F  T+ +I+ I  G  + NVIP  
Sbjct: 192 KQGHVAYPHLARNPIHEASPALAELCQTVWDNGNEYFPATSFQISNIHAGTGATNVIPGA 251

Query: 255 VKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSL 314
           ++++FN R++     + LK+ +   L K       L + + ++    P FLT   +L + 
Sbjct: 252 LEVTFNFRYSTEVTAEQLKQRVHEILDKH-----GLQYEIVWNLSGLP-FLTPVGELVNA 305

Query: 315 LSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDLEDLT 373
              +I N TG    LSTSGGTSD RFI      V+E G++  T+H +NE+  + DL+ LT
Sbjct: 306 AQTAILNVTGTETELSTSGGTSDGRFIAPTGAQVLELGVLNATIHQINEHVDVHDLDPLT 365

Query: 374 CIYENFLQN 382
            IYE  L+N
Sbjct: 366 DIYEQILEN 374


>gi|239501777|ref|ZP_04661087.1| succinyl-diaminopimelate desuccinylase [Acinetobacter baumannii
           AB900]
          Length = 378

 Score =  283 bits (724), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 159/369 (43%), Positives = 215/369 (58%), Gaps = 13/369 (3%)

Query: 16  PSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDV 75
           PSVTP D     I+   L  +GF IE   F       V NL+AR GTE P   FAGH DV
Sbjct: 17  PSVTPIDHTCQTIMAERLAKVGFHIEPMRFGD-----VDNLWARRGTEGPVFCFAGHTDV 71

Query: 76  VPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSISLLI 134
           VP G  + W   PF+  I +GK+YGRG  DMK ++A  + A  RF+ K+ N  GSI+ LI
Sbjct: 72  VPTGRLDAWNSDPFAPEIRDGKLYGRGSADMKTALAAMVVASERFVAKHPNHKGSIAFLI 131

Query: 135 TGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHG 194
           T DEEGPA+NGT K++  +EK+ EK   C+VGEP+  H +GD +K GRRGSL+  + + G
Sbjct: 132 TSDEEGPAVNGTVKVIETLEKRNEKITWCLVGEPSSTHKLGDIVKNGRRGSLNAVLKVQG 191

Query: 195 KQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQ 254
           KQGHVAYPHL  NPI    P L +L    +D GN  F  T+ +I+ I  G  + NVIP  
Sbjct: 192 KQGHVAYPHLARNPIHEASPALAELCQTVWDNGNEYFPATSFQISNIHAGTGATNVIPGA 251

Query: 255 VKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSL 314
           ++++FN R++     + LK+ +   L K       L + + ++    P FLT   +L + 
Sbjct: 252 LEVTFNFRYSTEVTAEQLKQRVHEILDKH-----GLQYEIVWNLSGLP-FLTPVGELVNA 305

Query: 315 LSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDLEDLT 373
              +I N TG    LSTSGGTSD RFI      V+E G++  T+H +NE+  + DL+ LT
Sbjct: 306 AQTAILNVTGTETELSTSGGTSDGRFIAPTGAQVLELGVLNATIHQINEHVDVHDLDPLT 365

Query: 374 CIYENFLQN 382
            IYE  L+N
Sbjct: 366 DIYEQILEN 374


>gi|325578775|ref|ZP_08148822.1| succinyl-diaminopimelate desuccinylase [Haemophilus parainfluenzae
           ATCC 33392]
 gi|325159599|gb|EGC71731.1| succinyl-diaminopimelate desuccinylase [Haemophilus parainfluenzae
           ATCC 33392]
          Length = 377

 Score =  283 bits (723), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 159/384 (41%), Positives = 220/384 (57%), Gaps = 13/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +E    LI+ PS++P D G   ++   L+ LGF IE   F   N ++  NL+A+ 
Sbjct: 1   MKQKTIELAQALIRRPSISPNDEGCQQLIAERLEKLGFQIEWMPF---NDTL--NLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   P + FAGH DVVP GD  HWTYPPFSA I +  +YGRG  DMKGS+A  I A   +
Sbjct: 56  GAGEPVIAFAGHTDVVPTGDEAHWTYPPFSAEIVDDVLYGRGAADMKGSLAAMIVAAEEY 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G+I+LLIT DEE  A +GT +++  +  +GEK   C+VGEP+ +  +GD +K
Sbjct: 116 VKANLNHKGTIALLITSDEEAAAKDGTVRVVETLMARGEKITYCMVGEPSSSKTLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++G + I G QGHVAYPHL ENPI    P L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITGNLYIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDNGNEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN+R+     ++ +K+++   L K       L + + ++  
Sbjct: 236 NIHAGTGSNNVIPGELYVQFNLRYCTEVTDEGIKQKVAEMLEK-----HDLKYRIDWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   L+ +I  TTG  P   T GGTSD RFI      V+EFG +  T+H
Sbjct: 291 GKP-FLTKPGKLLDALTTAIEQTTGIAPQAETGGGTSDGRFIALMGAEVVEFGPLNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  ++ DL     IY   L N
Sbjct: 350 KVNECVNVDDLAKCGQIYHQMLVN 373


>gi|148652454|ref|YP_001279547.1| succinyl-diaminopimelate desuccinylase [Psychrobacter sp. PRwf-1]
 gi|238064781|sp|A5WD56|DAPE_PSYWF RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|148571538|gb|ABQ93597.1| succinyldiaminopimelate desuccinylase [Psychrobacter sp. PRwf-1]
          Length = 402

 Score =  283 bits (723), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 162/386 (41%), Positives = 224/386 (58%), Gaps = 8/386 (2%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTS----IVKNLYARFG 61
           LE  I+L++  SVTP D G   +LV  L  LGF  E   F  +  S     VKNL+AR G
Sbjct: 18  LELSIELMRRDSVTPHDKGCQEVLVERLSPLGFVHEFMYFGDEQASGRDAQVKNLWARRG 77

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
            + P + FAGH DVVP G+ ++W   PF A + +G ++GRG  DMK  IA F  A  RF+
Sbjct: 78  NQDPVVCFAGHTDVVPTGNPDNWRIAPFDAKVHDGYLWGRGAADMKTGIAAFTVATERFV 137

Query: 122 PKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
             + +  GSI++LIT DEEGP+INGT K++  +E + EK   C+VGEP+    +GD IK 
Sbjct: 138 KNHPDHNGSIAMLITSDEEGPSINGTVKVIEVLEARNEKITYCLVGEPSSTDSLGDVIKN 197

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGSL G +T+ GKQGHVAYPHL  NPI  L+P L + +   +D GN  F  T+M+I+ 
Sbjct: 198 GRRGSLGGILTVTGKQGHVAYPHLAVNPIHALLPALAEFSVTEWDKGNDFFPATSMQISN 257

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV 300
           I+ G  + NVIP  V++ FN RF+    E+ L+ +    L K   N  + ++ + +    
Sbjct: 258 INGGTGANNVIPETVEVVFNFRFSTETTEEELRAKTHEILDKHFANT-EATYEIDWKLSG 316

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHA 359
            P FLT + KL      +I + TG    LSTSGGTSD RFI      V+E G+   T+H 
Sbjct: 317 HP-FLTAEGKLVDACKVAIKDITGTDTQLSTSGGTSDGRFIAPTGAQVVELGVRNATIHQ 375

Query: 360 LNENASLQDLEDLTCIYENFLQNWFI 385
           ++E   + D+  L  IYE  L+   +
Sbjct: 376 VDERVEIDDIGKLAQIYERMLEELLL 401


>gi|91223526|ref|ZP_01258791.1| succinyl-diaminopimelate desuccinylase [Vibrio alginolyticus 12G01]
 gi|91191612|gb|EAS77876.1| succinyl-diaminopimelate desuccinylase [Vibrio alginolyticus 12G01]
          Length = 378

 Score =  283 bits (723), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 156/376 (41%), Positives = 216/376 (57%), Gaps = 17/376 (4%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            LI   SVTP+D G   +++  LK LGF IE   F+        N +AR G+EAP   FA
Sbjct: 12  DLISRQSVTPEDAGCQDLMIERLKALGFEIEVMVFED-----TTNFWARRGSEAPLFAFA 66

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI---PKYKNF 127
           GH DVVP G   HW   PF  TI +G ++GRG  DMKGS+A  + AV RFI   P +K  
Sbjct: 67  GHTDVVPAGKLEHWNTHPFEPTIIDGYLHGRGAADMKGSLAAMVVAVERFIEENPDHK-- 124

Query: 128 GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLS 187
           GSI  LIT DEEGP INGT +++  + ++GE  D CIVGEP+   ++GD +K GRRGS++
Sbjct: 125 GSIGFLITSDEEGPFINGTVRVVETLMERGENIDMCIVGEPSSTDVVGDVVKNGRRGSIT 184

Query: 188 GEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPS 247
           G++T+ G QGHVAYPHL  NP+   +  +H+L    +D GN  F PT+ +I  +  G  +
Sbjct: 185 GDLTVKGTQGHVAYPHLASNPVHESLLAIHELATTEWDKGNDYFPPTSFQIPNVSAGTGA 244

Query: 248 KNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTH 307
            NVIP +  + FN+RF+   N   + + +   L K      +L + + ++    P FLT 
Sbjct: 245 SNVIPGEFHVQFNLRFSTELNNDAIVQRVTETLDK-----HELDYDLKWTFNGDP-FLTD 298

Query: 308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASL 366
              L   +  ++       P L T+GGTSD RFI      V+E G V  T+H +NE   +
Sbjct: 299 TGALLDAVVAAVAEVNDTKPALLTTGGTSDGRFIARMGGQVVELGPVNATIHKVNECVKV 358

Query: 367 QDLEDLTCIYENFLQN 382
            DLE LT +YEN L++
Sbjct: 359 DDLEKLTDMYENTLKH 374


>gi|163857112|ref|YP_001631410.1| succinyl-diaminopimelate desuccinylase [Bordetella petrii DSM
           12804]
 gi|238055173|sp|A9IR81|DAPE_BORPD RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|163260840|emb|CAP43142.1| succinyl-diaminopimelate desuccinylase [Bordetella petrii]
          Length = 380

 Score =  283 bits (723), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 164/389 (42%), Positives = 214/389 (55%), Gaps = 15/389 (3%)

Query: 1   MTPD--CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYA 58
           MT D   L  + +LI  PSVTP D     +L   L+  GF  E     T     V NL+A
Sbjct: 1   MTADSAVLALVRELIARPSVTPDDVDCQLLLAQRLEHAGFRCE-----TIARGDVTNLWA 55

Query: 59  RFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
           R G   P ++FAGH DVVPPG  + W   PF  T  +G +YGRG  DMK SIA F+ A  
Sbjct: 56  RRGNAGPLVVFAGHTDVVPPGPRDKWDSDPFVPTERDGYLYGRGAADMKSSIAAFVVAAE 115

Query: 119 RFIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDT 177
            F   +    GSI+LL+T DEEGPA++GT  +   +  +GE+ D CIVGEPT   ++GDT
Sbjct: 116 EFTAAHPGHDGSIALLLTSDEEGPAVDGTVIVCDELRARGEQPDYCIVGEPTSGDVLGDT 175

Query: 178 IKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNME 237
            K GRRGSLSG +T+ G QGHVAYPHL  NP+  L P L ++    +D GN  F PT  +
Sbjct: 176 CKNGRRGSLSGRLTVKGIQGHVAYPHLARNPVHQLAPALAEMAATEWDRGNEYFPPTTFQ 235

Query: 238 ITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFS 297
           ++ +  G  + NV+P +  + FN RF+     + LK+ + + L K       L + + + 
Sbjct: 236 VSNLRAGTGATNVVPGEAVVLFNFRFSTASTPEGLKQRVHALLDKH-----GLEYELDWE 290

Query: 298 SPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRT 356
               P FLT    LT  L  +I   TG    LST+GGTSD RFI   CP VIEFG    T
Sbjct: 291 LGGEP-FLTPRGPLTDALVAAIRAETGVAAELSTTGGTSDGRFIAKICPQVIEFGPCNAT 349

Query: 357 MHALNENASLQDLEDLTCIYENFLQNWFI 385
           +H +NE   L  LE L  IY   L+N  +
Sbjct: 350 IHKVNERIELASLEPLKNIYRRTLENLLL 378


>gi|294010820|ref|YP_003544280.1| succinyl-diaminopimelate desuccinylase [Sphingobium japonicum
           UT26S]
 gi|292674150|dbj|BAI95668.1| succinyl-diaminopimelate desuccinylase [Sphingobium japonicum
           UT26S]
          Length = 380

 Score =  283 bits (723), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 164/369 (44%), Positives = 216/369 (58%), Gaps = 15/369 (4%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYA-RFGTEAPHLMF 69
           +LI CPSVTP  G  F +L   LK LGF+++           V+NL A R      H  F
Sbjct: 16  KLIACPSVTPATGEVFAVLEAMLKPLGFTVDRFLAGEAPDGPVENLLAWRTTGPGRHFAF 75

Query: 70  AGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGS 129
           AGH+DVVPPG  N W   PF   I    +YGRG VDMKG+IA ++AA+          G+
Sbjct: 76  AGHLDVVPPG--NGWASDPFRPEIRGELLYGRGAVDMKGAIAAYVAALHDLPEDLP--GT 131

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           ISL+ITGDEEG A++GT  ++  +   G + D C+VGEPT +  +GD IKIGRRGS++  
Sbjct: 132 ISLIITGDEEGAAVHGTLALMERMAAHGLRPDLCLVGEPTSSRRLGDVIKIGRRGSVNMW 191

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           I + G QGHVAYPHL  NPI  LI +L  +  +  D GN  F  +N+EIT +DVGNP+ N
Sbjct: 192 IHVDGVQGHVAYPHLANNPIPRLIRILSAIDALVLDEGNDWFQASNIEITNLDVGNPTTN 251

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRS-RLIKGIQNVPKLSHTVHFSSPVSPVFLTHD 308
           VIPA  +   +IRFN+      L + I +    +G +   K+S       P    FLT  
Sbjct: 252 VIPAAAQARISIRFNNEHGGTELVDRITAIAAAEGGRVEAKIS-----GEP----FLTEP 302

Query: 309 RKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQD 368
             L+ +++ +I + TG    LST+GGTSDARF+   CPV+EFGL   TMH L+E  +L D
Sbjct: 303 GMLSDMVAGAIRDVTGVEAELSTTGGTSDARFLSRLCPVVEFGLNNATMHKLDEAVALAD 362

Query: 369 LEDLTCIYE 377
           L DL  IY 
Sbjct: 363 LRDLAEIYR 371


>gi|293415734|ref|ZP_06658377.1| succinyl-diaminopimelate desuccinylase [Escherichia coli B185]
 gi|291433382|gb|EFF06361.1| succinyl-diaminopimelate desuccinylase [Escherichia coli B185]
          Length = 375

 Score =  282 bits (722), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 153/384 (39%), Positives = 225/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF     +  +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDF-----ADTQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGASDMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++T+K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDETIKAQVLALLEKH-----QLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|149374443|ref|ZP_01892217.1| succinyl-diaminopimelate desuccinylase [Marinobacter algicola
           DG893]
 gi|149361146|gb|EDM49596.1| succinyl-diaminopimelate desuccinylase [Marinobacter algicola
           DG893]
          Length = 382

 Score =  282 bits (722), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 161/377 (42%), Positives = 219/377 (58%), Gaps = 14/377 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           L+  + LI+ PSVTP D G   ++++ L  LGF  E   F   +     NL+AR G++ P
Sbjct: 13  LKLAVDLIRRPSVTPDDAGCQELMMSRLAALGFKGEALRFGETD-----NLWARKGSDGP 67

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            L FAGH DVVP G   +W +PPF A I +G ++GRG  DMKGS+A FI A  RF+  + 
Sbjct: 68  LLAFAGHTDVVPTGPEKNWRHPPFEAVIDDGFLHGRGAADMKGSLAAFITACERFVTSHP 127

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEGPA +GT K++  +E + EK D C++GEP+    +GD IK GRRG
Sbjct: 128 DHRGSIALLITSDEEGPAQDGTVKVVETLEARNEKIDWCLIGEPSSTREVGDVIKNGRRG 187

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SL G +T+ G QGHVAYPHL ENP+  + P L  L    +D GN  F PT  +IT I+ G
Sbjct: 188 SLHGYLTVQGTQGHVAYPHLAENPVHTVAPALDALAKEFWDDGNDFFPPTTFQITKIEAG 247

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
             S N+IP +  + FN R+      ++L+E + +     I +  +L + + +     P F
Sbjct: 248 TGS-NIIPGECLVHFNFRYCTENTAESLEERVVA-----ILDRHELKYDLQWHLSGRP-F 300

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNEN 363
           LT    L S    +I + TG    LSTSGGTSD RFI      V+E G +  T+H +NE 
Sbjct: 301 LTDSGSLVSAAQSAIRSVTGRETELSTSGGTSDGRFIAPTGAQVLELGPINATIHKVNEC 360

Query: 364 ASLQDLEDLTCIYENFL 380
               DL  L+ IYE  L
Sbjct: 361 VKAADLNTLSEIYEQVL 377


>gi|291613906|ref|YP_003524063.1| succinyl-diaminopimelate desuccinylase [Sideroxydans lithotrophicus
           ES-1]
 gi|291584018|gb|ADE11676.1| succinyl-diaminopimelate desuccinylase [Sideroxydans lithotrophicus
           ES-1]
          Length = 376

 Score =  282 bits (722), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 162/375 (43%), Positives = 224/375 (59%), Gaps = 13/375 (3%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D LE   QLI   S+TP D G   I+   L  L FS+E+        S V NL+AR G  
Sbjct: 3   DTLELTKQLIARHSLTPMDDGCIDIIGARLAPLDFSLEKM-----RHSEVDNLWARRGDA 57

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
           +P + FAGH DVVP G  N W   PF+ T+ +G +YGRG  DMKGS+A F+ A+ +F+ +
Sbjct: 58  SPLVCFAGHTDVVPTGPVNKWDSDPFTPTVRDGMLYGRGAADMKGSLAAFVTAIEKFVAE 117

Query: 124 Y-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
           + ++ GSI+LL+T DEEG A++GT +++  ++++ EK D CIVGEPT     GDTIK GR
Sbjct: 118 HPRHRGSIALLLTSDEEGIAVDGTVRVVEALQERDEKLDYCIVGEPTSVTKTGDTIKNGR 177

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSLSG +T+ G QGH+AYPHL +NPI  + P + +L    +D GN  F PT+ +I+ I 
Sbjct: 178 RGSLSGTLTVKGVQGHIAYPHLVKNPIHMVAPTIAELAATEWDKGNEYFPPTSWQISNIH 237

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
            G  + NV+P  V++ FN RF+       LK ++ S L K       L + + +     P
Sbjct: 238 GGTGATNVVPGTVEILFNFRFSTASTVDGLKTKVHSILDK-----HGLEYDLAWELSGKP 292

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMHALN 361
            +LT    L   ++ +I    G    LSTSGGTSD RFI D CP VIE G +  T+H LN
Sbjct: 293 -YLTPRGGLVDAVAAAIKQVQGLETELSTSGGTSDGRFIADICPQVIELGPLNATIHKLN 351

Query: 362 ENASLQDLEDLTCIY 376
           E  ++ DL+ L+ IY
Sbjct: 352 ECVAVDDLDALSEIY 366


>gi|90410942|ref|ZP_01218956.1| succinyl-diaminopimelate desuccinylase [Photobacterium profundum
           3TCK]
 gi|90328155|gb|EAS44466.1| succinyl-diaminopimelate desuccinylase [Photobacterium profundum
           3TCK]
          Length = 377

 Score =  282 bits (722), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 155/377 (41%), Positives = 222/377 (58%), Gaps = 13/377 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            L+   SVTP+D G   +++  L+ LGF IE   F         NL+AR GT+AP  +FA
Sbjct: 12  DLMSRNSVTPEDAGCQDVMIARLEKLGFVIETMVFDDTT-----NLWARRGTQAPLFVFA 66

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVP G    W  PPF  TI +G ++GRG  DMKGS+AC I ++ RF+ ++ +  GS
Sbjct: 67  GHTDVVPAGPLEQWHTPPFEPTIIDGYLHGRGAADMKGSLACMIVSIERFLTEHPDHAGS 126

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I+LLIT DEEGP INGT +++  +E + EK D CIVGEP+  H +GD +K GRRGS++G+
Sbjct: 127 IALLITSDEEGPFINGTTRVIDTLEARNEKIDMCIVGEPSSTHAVGDVVKNGRRGSITGD 186

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +T+ G QGHVAYPHL +NP+   +P L +L    +D GNT F  T+ +I  +  G  + N
Sbjct: 187 LTVKGIQGHVAYPHLADNPVHKALPALAELAATTWDNGNTYFPATSFQIANLASGTGASN 246

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP +  + FN RF+    +  +K  + S     I +   L++ + ++    P FLT + 
Sbjct: 247 VIPGKFDVQFNFRFSTELTDGEIKRRVHS-----ILDAHGLNYDLKWTLSGHP-FLTDEG 300

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFI-KDYCPVIEFGLVGRTMHALNENASLQD 368
            L   +  ++ +     P L T+GGTSD RFI +    V+E G V  T+H +NE     D
Sbjct: 301 TLVEAVVAAVEDVNHTKPALLTTGGTSDGRFIARTGAQVVELGPVNATIHKVNECVKAAD 360

Query: 369 LEDLTCIYENFLQNWFI 385
           LE LT +Y+  L+   I
Sbjct: 361 LEKLTDMYQKVLEKSLI 377


>gi|54293862|ref|YP_126277.1| succinyl-diaminopimelate desuccinylase [Legionella pneumophila str.
           Lens]
 gi|81601445|sp|Q5WY21|DAPE_LEGPL RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|53753694|emb|CAH15152.1| Succinyl-diaminopimelate desuccinylase [Legionella pneumophila str.
           Lens]
          Length = 377

 Score =  282 bits (722), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 164/385 (42%), Positives = 225/385 (58%), Gaps = 14/385 (3%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D  + L  LI  PS+TP+D G    ++  L+ LGF+      Q  N   V N +A +G  
Sbjct: 3   DITQILTDLIGFPSITPEDAGCQKYMIQFLEQLGFTC-----QQLNNGPVSNFFACYGKI 57

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            P L+FAGH DVVP G+ + W   PFS     G +YGRG+ DMKGS+AC +    RFI  
Sbjct: 58  GPLLVFAGHTDVVPVGEVSKWDTDPFSLEEKNGMLYGRGVADMKGSLACMLHMARRFIKT 117

Query: 124 YKNF-GSISLLITGDEEGPAIN-GTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
           Y +F G +  LIT  EEG   N GT   +  +E++G   D CIVGEP+ +   GD IKIG
Sbjct: 118 YPSFPGRLGFLITSGEEGDEFNLGTPYAMQKLEQQGIVIDYCIVGEPSSSLKTGDVIKIG 177

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSLS +I + GKQGHVAYPHL +NPI  + P+L +LT++ +D GN  F PT+M+IT I
Sbjct: 178 RRGSLSAKIHLSGKQGHVAYPHLADNPIHRISPVLAELTSMQWDNGNAYFPPTSMQITYI 237

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
             G  + N+IP ++ +  N R++    E+T  E +++R+I    +  KL+ T+ +     
Sbjct: 238 HCGGHAGNIIPGELNLHLNFRYS---TEQT-DESLKTRVINAFTH-HKLNPTIEWRLNGE 292

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHAL 360
           P FLT+   L     +++    G +P LSTSGGTSD RFI  Y   VIE GLV  T+H +
Sbjct: 293 P-FLTNKGILLESCKQTVLEHIGTLPELSTSGGTSDGRFIAPYGVEVIELGLVNATIHQV 351

Query: 361 NENASLQDLEDLTCIYENFLQNWFI 385
           NE  SLQDL  L  +Y +  +   I
Sbjct: 352 NECTSLQDLNTLETMYFSICEKLLI 376


>gi|254228426|ref|ZP_04921852.1| succinyl-diaminopimelate desuccinylase [Vibrio sp. Ex25]
 gi|262393570|ref|YP_003285424.1| N-succinyl-L,L-diaminopimelate desuccinylase [Vibrio sp. Ex25]
 gi|151939014|gb|EDN57846.1| succinyl-diaminopimelate desuccinylase [Vibrio sp. Ex25]
 gi|262337164|gb|ACY50959.1| N-succinyl-L,L-diaminopimelate desuccinylase [Vibrio sp. Ex25]
          Length = 378

 Score =  282 bits (722), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 156/376 (41%), Positives = 215/376 (57%), Gaps = 17/376 (4%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            LI   SVTP+D G   +++  LK LGF IE   F+        N +AR G+EAP   FA
Sbjct: 12  DLISRQSVTPEDAGCQDLMIERLKALGFEIEVMVFED-----TTNFWARRGSEAPLFAFA 66

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI---PKYKNF 127
           GH DVVP G   HW   PF  TI +G ++GRG  DMKGS+A  + AV RFI   P +K  
Sbjct: 67  GHTDVVPAGKLEHWDTHPFEPTIIDGYLHGRGAADMKGSLAAMVVAVERFIAENPDHK-- 124

Query: 128 GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLS 187
           GSI  LIT DEEGP INGT +++  +  +GE  D CIVGEP+   ++GD +K GRRGS++
Sbjct: 125 GSIGFLITSDEEGPFINGTVRVVETLMARGENIDMCIVGEPSSTEVVGDVVKNGRRGSIT 184

Query: 188 GEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPS 247
           G++T+ G QGHVAYPHL  NP+   +  +H+L    +D GN  F PT+ +I  +  G  +
Sbjct: 185 GDLTVKGTQGHVAYPHLANNPVHESLLAIHELATTEWDKGNDYFPPTSFQIPNVSAGTGA 244

Query: 248 KNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTH 307
            NVIP +  + FN+RF+   N   + + +   L K      +L + + ++    P FLT 
Sbjct: 245 SNVIPGEFHVQFNLRFSTELNNDAIVQRVTETLDK-----HELDYDLKWTFNGDP-FLTD 298

Query: 308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASL 366
              L   +  ++       P L T+GGTSD RFI      V+E G V  T+H +NE   +
Sbjct: 299 TGALLDAVVAAVAEVNDTKPALLTTGGTSDGRFIARMGGQVVELGPVNATIHKVNECVKV 358

Query: 367 QDLEDLTCIYENFLQN 382
            DLE LT +YEN L++
Sbjct: 359 DDLEKLTDMYENTLKH 374


>gi|110642645|ref|YP_670375.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 536]
 gi|191172942|ref|ZP_03034477.1| succinyl-diaminopimelate desuccinylase [Escherichia coli F11]
 gi|300997927|ref|ZP_07181893.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 200-1]
 gi|123343760|sp|Q0TF05|DAPE_ECOL5 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|110344237|gb|ABG70474.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 536]
 gi|190906806|gb|EDV66410.1| succinyl-diaminopimelate desuccinylase [Escherichia coli F11]
 gi|300304098|gb|EFJ58618.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 200-1]
 gi|324011183|gb|EGB80402.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 60-1]
          Length = 375

 Score =  282 bits (722), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 152/384 (39%), Positives = 225/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF     +  +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDF-----ADTQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P +++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFINELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +KE++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKEQVLALLEKH-----QLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|311694050|gb|ADP96923.1| succinyl-diaminopimelate desuccinylase [marine bacterium HP15]
          Length = 378

 Score =  282 bits (722), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 161/377 (42%), Positives = 218/377 (57%), Gaps = 14/377 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE  + LI+ PSVTP D G   ++++ L  LGF+ E   F   +     NL+AR G+E P
Sbjct: 9   LELAVDLIRRPSVTPDDAGCQELMMSRLAPLGFTGENLRFGDTD-----NLWARKGSEGP 63

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            L FAGH DVVP G   +W++PPF   I +G + GRG  DMKGS+A F+ A  RF+  Y 
Sbjct: 64  VLAFAGHTDVVPTGPEKNWSHPPFDPVIRDGYLLGRGAADMKGSLAAFVTACERFVASYP 123

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEGPA +GT K++  +E + EK D C++GEP+    +GD IK GRRG
Sbjct: 124 DHRGSIALLITSDEEGPAQHGTVKVVETLEARNEKIDWCLIGEPSSTREVGDVIKNGRRG 183

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SL G +T+HG QGHVAYPHL ENP+  + P L  L    +D GN  F PT  +IT ++ G
Sbjct: 184 SLHGYLTVHGVQGHVAYPHLAENPVHLVAPALDALAKEFWDNGNDFFPPTTFQITKLEAG 243

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
             S N+IP +  + FN R+      ++L+E + +     I +   L + + +     P F
Sbjct: 244 TGS-NIIPGECLVHFNFRYCTENTAESLEERVVA-----ILDRHNLKYDLQWHLSGRP-F 296

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNEN 363
           LT    L S    +I   TG    LSTSGGTSD RFI      V+E G +  T+H ++E 
Sbjct: 297 LTDKGALVSASQSAIRTVTGRETELSTSGGTSDGRFIAPTGAQVVELGPINATIHKVDEC 356

Query: 364 ASLQDLEDLTCIYENFL 380
               DL  L+ IYE  L
Sbjct: 357 VKADDLNTLSEIYEQIL 373


>gi|238895931|ref|YP_002920667.1| succinyl-diaminopimelate desuccinylase [Klebsiella pneumoniae
           NTUH-K2044]
 gi|238548249|dbj|BAH64600.1| succinyl-diaminopimelate desuccinylase [Klebsiella pneumoniae
           subsp. pneumoniae NTUH-K2044]
          Length = 375

 Score =  282 bits (722), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 155/384 (40%), Positives = 223/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF+IE  DF        +N +A  
Sbjct: 1   MSCPVIELAQQLIRRPSLSPDDAGCQALMIERLRAIGFTIEPMDFGD-----TQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-HGETLAFAGHTDVVPAGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + +Y N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQYPNHRGRLAFLITSDEEASAKNGTVKVVETLMARNERLDYCLVGEPSSTEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P+L +L NI +D GN  F PT+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMLAELVNIEWDKGNEFFPPTSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            +  G  S NVIP  + + FN RF    + +   E I+SR+I  ++   +L ++V +   
Sbjct: 235 NVQSGTGSNNVIPGDMFVQFNFRF----STELTDEMIKSRVIALLEKY-QLRYSVEWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTGRGKLVDAVVNAIEHYNEIKPQLLTNGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRVMEQ 372


>gi|221135284|ref|ZP_03561587.1| succinyl-diaminopimelate desuccinylase [Glaciecola sp. HTCC2999]
          Length = 377

 Score =  282 bits (721), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 159/381 (41%), Positives = 221/381 (58%), Gaps = 13/381 (3%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +     LI+ PSVTP+D     ++   L+ LGFSIE   F         N++AR GTE
Sbjct: 3   DVITFCQALIQEPSVTPEDKACQPMMAKRLEPLGFSIETMVFHDTT-----NMWARKGTE 57

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
           +P   FAGH DVVP G    W +PPF A I +G I+GRG  DMKGS+A  + A  +F+  
Sbjct: 58  SPVFCFAGHTDVVPTGPEEKWQHPPFGAEIHDGYIWGRGAADMKGSLAAMVIATEQFVTD 117

Query: 124 YKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
           Y N  GSI+ LIT DEEGP INGT K++  +E + EK D C+VGEP+   ++GD +K GR
Sbjct: 118 YPNHKGSIAYLITSDEEGPFINGTTKVIDTLEARNEKIDYCVVGEPSSTSVVGDVVKYGR 177

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSL+G++ + GKQGHVAYPHL +NPI  +   L +L+N  +D GN  F  +  +++ I 
Sbjct: 178 RGSLTGDLVVKGKQGHVAYPHLAKNPIHDVAAALDELSNTQWDEGNDAFPASTFQVSNIH 237

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
            G  + NVIP +  + FN RF     E+T    ++SR+I+ I +   L + ++++    P
Sbjct: 238 AGTGAGNVIPGECHICFNFRF---CTEQTFA-SLQSRVIE-ILDKHHLDYDINWTFNGLP 292

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALN 361
            FLT    L      +I   +G    LST+GGTSD RFI      VIE G +  T+H ++
Sbjct: 293 -FLTDSGTLVDATVTAIKEVSGIDTELSTAGGTSDGRFIAPTGAQVIELGPINATIHQID 351

Query: 362 ENASLQDLEDLTCIYENFLQN 382
           E     DLE L  +Y + L N
Sbjct: 352 ERVKASDLETLAQMYYHILVN 372


>gi|269967568|ref|ZP_06181620.1| succinyl-diaminopimelate desuccinylase [Vibrio alginolyticus 40B]
 gi|269827806|gb|EEZ82088.1| succinyl-diaminopimelate desuccinylase [Vibrio alginolyticus 40B]
          Length = 378

 Score =  282 bits (721), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 156/376 (41%), Positives = 215/376 (57%), Gaps = 17/376 (4%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            LI   SVTP+D G   +++  LK LGF IE   F+        N +AR G+EAP   FA
Sbjct: 12  DLISRQSVTPEDAGCQDLMIERLKALGFEIEVMVFED-----TTNFWARRGSEAPLFAFA 66

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI---PKYKNF 127
           GH DVVP G   HW   PF  TI +G ++GRG  DMKGS+A  + AV RFI   P +K  
Sbjct: 67  GHTDVVPAGKLEHWNTHPFEPTIIDGYLHGRGAADMKGSLAAMVVAVERFIAENPDHK-- 124

Query: 128 GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLS 187
           GSI  LIT DEEGP INGT +++  + ++GE  D CIVGEP+   ++GD +K GRRGS++
Sbjct: 125 GSIGFLITSDEEGPFINGTVRVVETLMERGENIDMCIVGEPSSTEVVGDVVKNGRRGSIT 184

Query: 188 GEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPS 247
           G++T+ G QGHVAYPHL  NP+   +  +H+L    +D GN  F PT+ +I  +  G  +
Sbjct: 185 GDLTVKGTQGHVAYPHLASNPVHESLLAIHELATTEWDKGNDYFPPTSFQIPNVSAGTGA 244

Query: 248 KNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTH 307
            NVIP +  + FN+RF+   N   + + +   L K       L + + ++    P FLT 
Sbjct: 245 SNVIPGEFHVQFNLRFSTELNNDAIVQRVTETLDK-----HGLDYDLKWTFNGDP-FLTD 298

Query: 308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASL 366
              L   +  ++       P L T+GGTSD RFI      V+E G V  T+H +NE   +
Sbjct: 299 TGALLDAVVAAVAEVNDTKPALLTTGGTSDGRFIARMGGQVVELGPVNATIHKVNECVKV 358

Query: 367 QDLEDLTCIYENFLQN 382
            DLE LT +YEN L++
Sbjct: 359 DDLEKLTDMYENTLKH 374


>gi|262042090|ref|ZP_06015266.1| succinyl-diaminopimelate desuccinylase [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
 gi|330013587|ref|ZP_08307675.1| succinyl-diaminopimelate desuccinylase [Klebsiella sp. MS 92-3]
 gi|259040571|gb|EEW41666.1| succinyl-diaminopimelate desuccinylase [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
 gi|328533466|gb|EGF60199.1| succinyl-diaminopimelate desuccinylase [Klebsiella sp. MS 92-3]
          Length = 375

 Score =  282 bits (721), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 154/384 (40%), Positives = 223/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF++E  DF        +N +A  
Sbjct: 1   MSCPVIELAQQLIRRPSLSPDDAGCQALMIERLRAIGFTVEPMDFGD-----TQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-HGETLAFAGHTDVVPAGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + +Y N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQYPNHRGRLAFLITSDEEASAKNGTVKVVETLMARNERLDYCLVGEPSSTEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P+L +L NI +D GN  F PT+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMLAELVNIEWDKGNEFFPPTSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            +  G  S NVIP  + + FN RF    + +   E I+SR+I  ++   +L ++V +   
Sbjct: 235 NVQSGTGSNNVIPGDMFVQFNFRF----STELTDEMIKSRVIALLEKY-QLRYSVEWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTGRGKLVDAVVNAIEHYNEIKPQLLTNGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRVMEQ 372


>gi|116515001|ref|YP_802630.1| succinyl-diaminopimelate desuccinylase [Buchnera aphidicola str. Cc
           (Cinara cedri)]
 gi|122285603|sp|Q058B2|DAPE_BUCCC RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|116256855|gb|ABJ90537.1| succinyl-diaminopimelate desuccinylase [Buchnera aphidicola str. Cc
           (Cinara cedri)]
          Length = 376

 Score =  282 bits (721), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 162/378 (42%), Positives = 228/378 (60%), Gaps = 15/378 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           +LI   S++P+D G   IL+  L+LLGF IE  + +       KN +A  G +   + F 
Sbjct: 11  KLINISSISPRDLGCQEILIKRLQLLGFFIERINLKD-----TKNFWAYRG-KGKTVTFL 64

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVP G    W   PF ATI +GK++GRG  DMKGSIA  + AV  FI K+ N  G 
Sbjct: 65  GHTDVVPAGSTRKWKTSPFVATIKDGKLFGRGSADMKGSIAAMLIAVENFIKKFPNHKGR 124

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           IS LIT DEE    NG +K++S +++K E  D C+VGEPT   I+GD +K GRRGSLS +
Sbjct: 125 ISFLITSDEETSGKNGIRKVVSILKEKKEVIDFCLVGEPTSEKILGDCVKNGRRGSLSAD 184

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI-DVGNPSK 248
           + I+G QGH+AYP L  NPI   IP L  L+N+ FD GN  F PT+++I+ I    N + 
Sbjct: 185 LMIYGTQGHIAYPKLFLNPIHNSIPFLLDLSNLIFDKGNLFFEPTSIQISKIFSEKNCTL 244

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHD 308
           N+IP ++++ FNIRFN L N+K +      R+++ + N   + +++ ++    P FL+  
Sbjct: 245 NMIPGELRVFFNIRFNTLVNKKKI-----IRIVENLLNKYLIKYSIFWTYHAKP-FLSSS 298

Query: 309 RKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNENASLQ 367
             L +LL+K IY  T  IP +  +GGTSDARFI +    +IEFGL   T+H +NE   + 
Sbjct: 299 NFLLNLLTKCIYKHTNIIPKIKNNGGTSDARFIFNLTDKIIEFGLPNLTIHKVNEYVYIN 358

Query: 368 DLEDLTCIYENFLQNWFI 385
           DL  L  IY +FL+   +
Sbjct: 359 DLLKLQNIYYSFLEKLLL 376


>gi|89095175|ref|ZP_01168099.1| succinyl-diaminopimelate desuccinylase [Oceanospirillum sp. MED92]
 gi|89080533|gb|EAR59781.1| succinyl-diaminopimelate desuccinylase [Oceanospirillum sp. MED92]
          Length = 381

 Score =  282 bits (721), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 160/382 (41%), Positives = 222/382 (58%), Gaps = 13/382 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           +E    LI   SVTP+D G   +++  L+ +GF IE   F+      VKN +AR G   P
Sbjct: 9   IELAKDLISRRSVTPEDAGCQDLMIERLEAMGFKIERLQFED-----VKNFWARRGDSGP 63

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
              FAGH DVVPPG    W +PPF ATI +G + GRG  DMKG +A F+ A+ RFI  + 
Sbjct: 64  VFCFAGHTDVVPPGPEERWEFPPFEATIDQGMLCGRGAADMKGGLAAFMTALERFIANHP 123

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+LLIT DEEGP +NGT +++  +E + EK   CIVGEP+    +GD IK GRRG
Sbjct: 124 DHDGSIALLITSDEEGPWVNGTTRVVDHLEARDEKITWCIVGEPSSTKHVGDAIKNGRRG 183

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SL   +T+ G QGHVAYPHL +NPI    P L +L    +D GN  F PT+ +I+ I+ G
Sbjct: 184 SLGATLTVRGIQGHVAYPHLVKNPIHMAAPALAELAAEVWDEGNDFFPPTSFQISNINGG 243

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
               N++P  V + FN RF    + +   +E+++R ++ I N   L   + ++   +P F
Sbjct: 244 TGVTNIVPGHVDIMFNFRF----STEVTADELKTR-VRDILNKHNLDWDIDWTLSGNP-F 297

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNEN 363
           LT +  L     ++I   TG    LSTSGGTSD RFI      V+E G +  T+H +NE 
Sbjct: 298 LTAEGDLVDACQQAIKAITGQDTELSTSGGTSDGRFIAPTGAQVVELGPINATIHKVNER 357

Query: 364 ASLQDLEDLTCIYENFLQNWFI 385
            S QDL+ L+ +YEN +    +
Sbjct: 358 VSCQDLDTLSDLYENVMARLLV 379


>gi|74312997|ref|YP_311416.1| succinyl-diaminopimelate desuccinylase [Shigella sonnei Ss046]
 gi|123616553|sp|Q3YZ81|DAPE_SHISS RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|73856474|gb|AAZ89181.1| N-succinyl-diaminopimelate deacylase [Shigella sonnei Ss046]
 gi|323169091|gb|EFZ54768.1| succinyl-diaminopimelate desuccinylase [Shigella sonnei 53G]
          Length = 375

 Score =  282 bits (721), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 152/384 (39%), Positives = 225/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L++ L+ +GF++E  DF     +  +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIDRLQAIGFTVERMDF-----ADTQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKH-----QLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|218705970|ref|YP_002413489.1| succinyl-diaminopimelate desuccinylase [Escherichia coli UMN026]
 gi|293405907|ref|ZP_06649899.1| succinyl-diaminopimelate desuccinylase [Escherichia coli FVEC1412]
 gi|298381655|ref|ZP_06991254.1| succinyl-diaminopimelate desuccinylase [Escherichia coli FVEC1302]
 gi|300897653|ref|ZP_07116055.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 198-1]
 gi|301024672|ref|ZP_07188318.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 69-1]
 gi|331664028|ref|ZP_08364938.1| succinyl-diaminopimelate desuccinylase [Escherichia coli TA143]
 gi|331673929|ref|ZP_08374692.1| succinyl-diaminopimelate desuccinylase [Escherichia coli TA280]
 gi|238064744|sp|B7N653|DAPE_ECOLU RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|218433067|emb|CAR13962.1| N-succinyl-diaminopimelate deacylase [Escherichia coli UMN026]
 gi|291428115|gb|EFF01142.1| succinyl-diaminopimelate desuccinylase [Escherichia coli FVEC1412]
 gi|298279097|gb|EFI20611.1| succinyl-diaminopimelate desuccinylase [Escherichia coli FVEC1302]
 gi|300358602|gb|EFJ74472.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 198-1]
 gi|300396453|gb|EFJ79991.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 69-1]
 gi|331059827|gb|EGI31804.1| succinyl-diaminopimelate desuccinylase [Escherichia coli TA143]
 gi|331069202|gb|EGI40594.1| succinyl-diaminopimelate desuccinylase [Escherichia coli TA280]
          Length = 375

 Score =  282 bits (721), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 152/384 (39%), Positives = 224/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF     +  +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDF-----ADTQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHAGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKH-----QLRYTVEWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|300820869|ref|ZP_07101019.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 119-7]
 gi|300526622|gb|EFK47691.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 119-7]
          Length = 375

 Score =  282 bits (721), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 152/384 (39%), Positives = 225/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF     +  +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDF-----ADTQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV++   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKH-----QLRYTVNWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|77165591|ref|YP_344116.1| succinyl-diaminopimelate desuccinylase [Nitrosococcus oceani ATCC
           19707]
 gi|254434310|ref|ZP_05047818.1| succinyl-diaminopimelate desuccinylase [Nitrosococcus oceani AFC27]
 gi|123593836|sp|Q3J9B0|DAPE_NITOC RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|76883905|gb|ABA58586.1| succinyldiaminopimelate desuccinylase [Nitrosococcus oceani ATCC
           19707]
 gi|207090643|gb|EDZ67914.1| succinyl-diaminopimelate desuccinylase [Nitrosococcus oceani AFC27]
          Length = 376

 Score =  281 bits (720), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 156/378 (41%), Positives = 220/378 (58%), Gaps = 13/378 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE   +LI C S+TP+D G   +L   L  LGF  E+ +F       V N++ R G + P
Sbjct: 5   LELAKRLIACASITPRDAGCQGLLAQRLLALGFQGEQMNFGE-----VDNIWLRRGQKPP 59

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
             +FAGH DVVPPG  + W   PF+  +  G +YGRG  DMKGS+A  + A   FI  + 
Sbjct: 60  LFVFAGHTDVVPPGPPDKWLTDPFTPEVRNGLLYGRGAADMKGSLAAMVTACEHFINVHS 119

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GSI+ L+T DEEGPAINGT K++  ++ +GEK D C+VGEPT    +GD IK GRRG
Sbjct: 120 DHAGSIAFLLTSDEEGPAINGTIKVVETLQARGEKIDYCLVGEPTSQKQVGDMIKNGRRG 179

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SL G + + G QGHVAYPHL +NPI  L P L  L    +D GN  F PT  +I+ I  G
Sbjct: 180 SLGGRLIVRGIQGHVAYPHLADNPIHSLAPALAVLCAQTWDQGNKDFPPTTFQISNIQGG 239

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
             + NVIP +V++ FN R++     + L++++       I +  +L++ + ++    P F
Sbjct: 240 TGATNVIPGEVEILFNFRYSTEVTHQQLQQQMEE-----ILSQQRLNYELEWTLSGKP-F 293

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNEN 363
           LT    L + +S+++   TG     ST+GGTSD RFI      V+E G V  T+H +NE 
Sbjct: 294 LTAPGSLMTAVSQAVRGITGIDAEFSTTGGTSDGRFIAPTGAQVVELGPVNATIHKVNEC 353

Query: 364 ASLQDLEDLTCIYENFLQ 381
            ++ DLE L+ IY   L+
Sbjct: 354 VAVADLEILSRIYSRILE 371


>gi|301155929|emb|CBW15399.1| N-succinyl-diaminopimelate deacylase [Haemophilus parainfluenzae
           T3T1]
          Length = 377

 Score =  281 bits (720), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 158/384 (41%), Positives = 220/384 (57%), Gaps = 13/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +E    LI+ PS++P D G   ++   L+ LGF IE   F   N ++  NL+A+ 
Sbjct: 1   MKQKTIELAQALIRRPSISPNDEGCQQLIAERLEKLGFQIEWMPF---NDTL--NLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G+  P + FAGH DVVP GD   WTYPPFSA I +  +YGRG  DMKGS+A  I A   +
Sbjct: 56  GSGEPVIAFAGHTDVVPTGDETQWTYPPFSADIVDDMLYGRGTADMKGSLAAMIVAAEEY 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G+I+LLIT DEE  A +GT +++  +  +GEK   C+VGEP+ +  +GD +K
Sbjct: 116 VKANPNHKGTIALLITSDEEAAAKDGTVRVVETLMARGEKITYCMVGEPSSSKTLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++G + I G QGHVAYPHL ENPI    P L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITGNLYIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDNGNEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN+R+     ++ +K+++   L K       L + + ++  
Sbjct: 236 NIHAGTGSNNVIPGELYVQFNLRYCTEVTDEIIKQKVAEMLEK-----HGLKYRIDWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   L+ +I  TTG  P   T GGTSD RFI      V+EFG +  T+H
Sbjct: 291 GKP-FLTKPGKLLDALTTAIEQTTGVTPQAETGGGTSDGRFIALMGAEVVEFGPLNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  ++ DL     IY   L N
Sbjct: 350 KVNECVNVDDLAKCGQIYHQMLVN 373


>gi|299768883|ref|YP_003730909.1| succinyl-diaminopimelate desuccinylase [Acinetobacter sp. DR1]
 gi|298698971|gb|ADI89536.1| succinyl-diaminopimelate desuccinylase [Acinetobacter sp. DR1]
          Length = 378

 Score =  281 bits (720), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 158/369 (42%), Positives = 216/369 (58%), Gaps = 13/369 (3%)

Query: 16  PSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDV 75
           PSVTP D     I+ + L+ +GF IE   F       V NL+AR GTE P   FAGH DV
Sbjct: 17  PSVTPVDHTCQTIMADRLRQVGFHIEPMRFGD-----VDNLWARRGTEEPVFCFAGHTDV 71

Query: 76  VPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSISLLI 134
           VP G    W   PF+  I +GK+YGRG  DMK ++A  + A  RF+ K+ N  GSI+ LI
Sbjct: 72  VPTGKLEAWNSDPFAPEIRDGKLYGRGSADMKTALAAMVVASERFVAKHPNHKGSIAFLI 131

Query: 135 TGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHG 194
           T DEEGPA+NGT K++  +E++ EK   C+VGEP+  H +GD +K GRRGSL+  + + G
Sbjct: 132 TSDEEGPAVNGTVKVIETLEERNEKIKWCLVGEPSSTHKLGDIVKNGRRGSLNAVLKVQG 191

Query: 195 KQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQ 254
           KQGHVAYPHL  NPI    P L +L    +D GN  F  T+ +I+ I  G  + NVIP  
Sbjct: 192 KQGHVAYPHLALNPIHEASPALTELCQTVWDNGNEYFPATSFQISNIHSGTGATNVIPGT 251

Query: 255 VKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSL 314
           ++++FN R++     + LK+ +   L K       L + + ++    P FLT   +L + 
Sbjct: 252 LEVTFNFRYSTEVTAEQLKQRVHEILDKH-----ALKYEIVWNLSGLP-FLTPIGELVNA 305

Query: 315 LSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDLEDLT 373
              +I N TG    LSTSGGTSD RFI      V+E G++  T+H +NE+  + DL+ LT
Sbjct: 306 AQTAILNVTGTETELSTSGGTSDGRFIAPTGAQVLELGVLNATIHQINEHVDVHDLDPLT 365

Query: 374 CIYENFLQN 382
            IYE  L+N
Sbjct: 366 DIYEQILEN 374


>gi|206578713|ref|YP_002237191.1| succinyl-diaminopimelate desuccinylase [Klebsiella pneumoniae 342]
 gi|288934130|ref|YP_003438189.1| succinyl-diaminopimelate desuccinylase [Klebsiella variicola At-22]
 gi|238064757|sp|B5XVN4|DAPE_KLEP3 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|206567771|gb|ACI09547.1| succinyl-diaminopimelate desuccinylase [Klebsiella pneumoniae 342]
 gi|288888859|gb|ADC57177.1| succinyl-diaminopimelate desuccinylase [Klebsiella variicola At-22]
          Length = 375

 Score =  281 bits (720), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 153/384 (39%), Positives = 221/384 (57%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF++E  DF        +N +A  
Sbjct: 1   MSCPVIELAQQLIRRPSLSPDDAGCQALMIERLRAIGFTVEPMDFGD-----TQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-HGETLAFAGHTDVVPAGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + +Y N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQYPNHRGRLAFLITSDEEASAKNGTVKVVETLMARNERLDYCLVGEPSSTEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P+L +L NI +D GN  F PT+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMLAELVNIEWDKGNEFFPPTSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            +  G  S NVIP  + + FN RF+    ++ +K  + S L K      +L ++V +   
Sbjct: 235 NVQSGTGSNNVIPGDMFVQFNFRFSTELTDEMIKARVVSLLEK-----YQLRYSVEWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTGRGKLVDAVVSAIEHYNEIKPQLLTNGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRVMEQ 372


>gi|290508334|ref|ZP_06547705.1| succinyl-diaminopimelate desuccinylase [Klebsiella sp. 1_1_55]
 gi|289777728|gb|EFD85725.1| succinyl-diaminopimelate desuccinylase [Klebsiella sp. 1_1_55]
          Length = 375

 Score =  281 bits (720), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 153/384 (39%), Positives = 221/384 (57%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF++E  DF        +N +A  
Sbjct: 1   MSCPVIELAQQLIRRPSLSPDDAGCQALMIERLRAIGFTVEPMDFGD-----TQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-HGETLAFAGHTDVVPAGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + +Y N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQYPNHRGRLAFLITSDEEASAKNGTVKVVETLMARNERLDYCLVGEPSSTEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P+L +L NI +D GN  F PT+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMLAELVNIEWDKGNEFFPPTSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            +  G  S NVIP  + + FN RF+    ++ +K  + S L K      +L ++V +   
Sbjct: 235 NVQSGTGSNNVIPGDMFVQFNFRFSTELTDEMIKARVVSLLEK-----YQLRYSVEWWFS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTGRGKLVDAVVSAIEHYNEIKPQLLTNGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRVMEQ 372


>gi|239787672|emb|CAX84139.1| Succinyldiaminopimelate desuccinylase [uncultured bacterium]
          Length = 399

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 162/380 (42%), Positives = 209/380 (55%), Gaps = 16/380 (4%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+ PSVTP D G   IL   L  LGF+     F       V+NLYAR G  +P+L  AG
Sbjct: 23  LIRAPSVTPVDAGCQEILAARLARLGFTPHRLRF-----GPVQNLYARLGEASPNLCLAG 77

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF---- 127
           H DVVPPG  + W  PPF+  + EG + GRG  DMKG +A  +A V RF+ +   F    
Sbjct: 78  HTDVVPPGQEDLWRSPPFAGEVHEGFLTGRGACDMKGGLAAMVAGVERFLAERPGFAAEG 137

Query: 128 -GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSL 186
            GS+S LITGDEEG A++GT+++LSW+E++GE  D C+VGEPT     GD +K GRRGS+
Sbjct: 138 VGSLSFLITGDEEGEAVHGTREVLSWLEERGESLDHCLVGEPTGITDAGDCLKNGRRGSV 197

Query: 187 SGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNP 246
           +G IT+ G  GHVAYPH T NPI   +  L  L     D GN  F P+  + T++  G  
Sbjct: 198 NGWITVRGVPGHVAYPHQTRNPIHAALAALDALQRHPLDQGNADFEPSGFQWTSLAAGGE 257

Query: 247 SKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV-FL 305
           + NV P ++   FNIRFN     + L+  +R  L    Q +      V  +  VS + F 
Sbjct: 258 AVNVTPLELTARFNIRFNTEQTPEGLERHVRDHL----QPLLDAGFGVDLTMRVSGLPFR 313

Query: 306 THDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMHALNENA 364
           T        + ++I   TG    LSTSGGTSDARFI   CP  +E GL    MH L+E  
Sbjct: 314 TRPGAFLDRVRQAIREVTGREAALSTSGGTSDARFIAQVCPETLELGLPAVGMHQLDEGC 373

Query: 365 SLQDLEDLTCIYENFLQNWF 384
            + DLE L  I    L   F
Sbjct: 374 RVSDLEALAGIQHRLLGMLF 393


>gi|149186365|ref|ZP_01864678.1| succinyl-diaminopimelate desuccinylase [Erythrobacter sp. SD-21]
 gi|148829954|gb|EDL48392.1| succinyl-diaminopimelate desuccinylase [Erythrobacter sp. SD-21]
          Length = 377

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 160/386 (41%), Positives = 232/386 (60%), Gaps = 21/386 (5%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEE----KDFQTKNTSIVKNLYA- 58
           + LE   +L+   SVTP  G  F  +   L  LGF +      +       + V+NL+A 
Sbjct: 3   EVLELAKRLMAAESVTPATGSVFDRMEAMLAPLGFEVHRFTRGEGAPGTPEAPVENLFAI 62

Query: 59  RFGTE-APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAV 117
           R G E + H  FAGH+DVVPPG    W    F   +    +YGRG VDMKGSIAC + AV
Sbjct: 63  RRGPEGSKHFAFAGHLDVVPPG--GGWASDAFEPEVRGDLLYGRGAVDMKGSIACMVEAV 120

Query: 118 ARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDT 177
            + +P+  + G+IS +ITGDEEGPA++GT+ ++ ++ + G + D C+VGEPT  + +GD 
Sbjct: 121 -KHVPQ--DAGTISFIITGDEEGPALHGTRALIDYMRETGHQPDLCLVGEPTSVNRLGDM 177

Query: 178 IKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNME 237
           +KIGRRGS++  + + G QGHVAYPHL ENPI  L+ +L +L  +  D GN  F  +N+E
Sbjct: 178 MKIGRRGSVNIWLEVEGTQGHVAYPHLAENPIPKLVAMLAELDALVLDEGNDWFQASNLE 237

Query: 238 ITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHF 296
           IT ++VGNP+ NVIP   K   +IRFND  +  +L E++ +   K G + +P +S     
Sbjct: 238 ITDLEVGNPAHNVIPEAAKARISIRFNDEHSGASLSEKVITIAEKHGGKAMPIIS----- 292

Query: 297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRT 356
             P    FLT     + ++++++   TG  P  ST+GGTSDARF++  CPVIEFGLV  T
Sbjct: 293 GEP----FLTPPGTFSDIIARAVKEETGVNPEPSTTGGTSDARFLRAVCPVIEFGLVNAT 348

Query: 357 MHALNENASLQDLEDLTCIYENFLQN 382
           MH  +E  +++DL  L+ IY    ++
Sbjct: 349 MHKRDEAVAIEDLSTLSRIYTAIAKD 374


>gi|50084006|ref|YP_045516.1| succinyl-diaminopimelate desuccinylase [Acinetobacter sp. ADP1]
 gi|81393640|sp|Q6FE14|DAPE_ACIAD RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|49529982|emb|CAG67694.1| succinyl-diaminopimelate desuccinylase [Acinetobacter sp. ADP1]
          Length = 377

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 154/381 (40%), Positives = 225/381 (59%), Gaps = 13/381 (3%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D L+  + L++ PSVTP+D     ++   L   GF IE   F       V NL+AR GT+
Sbjct: 5   DTLDLSLNLMRRPSVTPEDHDCQAVMAERLAKAGFQIENMRFDD-----VDNLWARRGTQ 59

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            P   FAGH DVVP G+ ++W   PF+  + +G +YGRG  DMK ++A  + A  RF+ K
Sbjct: 60  QPVFCFAGHTDVVPTGNLDNWNSDPFAPEVRDGILYGRGAADMKTALAAMVVASERFVEK 119

Query: 124 YKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
           + N  GSI+ LIT DEEGP+INGT K++  +E + EK   C+VGEP+  H +GD IK GR
Sbjct: 120 HPNHKGSIAFLITSDEEGPSINGTVKVIETLEARHEKMTWCLVGEPSSTHQLGDIIKNGR 179

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSL+  +TI GKQGHVAYPHL  NPI      +H+L    +D GN  F  T+ +I+ I 
Sbjct: 180 RGSLNAVLTIKGKQGHVAYPHLARNPIHLASAAIHELCETVWDQGNEYFPATSFQISNIH 239

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
            G  + NV+P  + ++FN R+    + +   E+++ R+++ +Q    L + + ++    P
Sbjct: 240 AGTGATNVVPGTMAVTFNFRY----STEVTAEQLKERVVEVLQR-HGLDYDIVWTHSGLP 294

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALN 361
            FLT   +L +  + +I   TG    LSTSGGTSD RFI      V+E G++  ++H +N
Sbjct: 295 -FLTPVGELVNAATHAIKTVTGVDTQLSTSGGTSDGRFIAPTGAQVLELGVLNASIHQIN 353

Query: 362 ENASLQDLEDLTCIYENFLQN 382
           E+ ++ DLE L  IYE  L+ 
Sbjct: 354 EHVNVADLEPLAEIYEKILEQ 374


>gi|218700929|ref|YP_002408558.1| succinyl-diaminopimelate desuccinylase [Escherichia coli IAI39]
 gi|238064738|sp|B7NQK9|DAPE_ECO7I RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|218370915|emb|CAR18734.1| N-succinyl-diaminopimelate deacylase [Escherichia coli IAI39]
          Length = 375

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 152/384 (39%), Positives = 224/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF     +  +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDF-----ADTQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHAGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKH-----QLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|191167646|ref|ZP_03029456.1| succinyl-diaminopimelate desuccinylase [Escherichia coli B7A]
 gi|209919944|ref|YP_002294028.1| succinyl-diaminopimelate desuccinylase [Escherichia coli SE11]
 gi|300817771|ref|ZP_07097986.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 107-1]
 gi|300922173|ref|ZP_07138310.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 182-1]
 gi|301328990|ref|ZP_07222017.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 78-1]
 gi|307312538|ref|ZP_07592171.1| succinyl-diaminopimelate desuccinylase [Escherichia coli W]
 gi|309794490|ref|ZP_07688913.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 145-7]
 gi|238064745|sp|B6I539|DAPE_ECOSE RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|190902326|gb|EDV62065.1| succinyl-diaminopimelate desuccinylase [Escherichia coli B7A]
 gi|209913203|dbj|BAG78277.1| succinyl-diaminopimelate desuccinylase [Escherichia coli SE11]
 gi|300421488|gb|EFK04799.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 182-1]
 gi|300529759|gb|EFK50821.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 107-1]
 gi|300844624|gb|EFK72384.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 78-1]
 gi|306907461|gb|EFN37965.1| succinyl-diaminopimelate desuccinylase [Escherichia coli W]
 gi|308121946|gb|EFO59208.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 145-7]
 gi|315061787|gb|ADT76114.1| N-succinyl-diaminopimelate deacylase [Escherichia coli W]
 gi|323184475|gb|EFZ69850.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 1357]
 gi|323377632|gb|ADX49900.1| succinyl-diaminopimelate desuccinylase [Escherichia coli KO11]
 gi|324020143|gb|EGB89362.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 117-3]
 gi|332344290|gb|AEE57624.1| succinyl-diaminopimelate desuccinylase DapE [Escherichia coli
           UMNK88]
          Length = 375

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 152/384 (39%), Positives = 224/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF     +  +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDF-----ADTQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMSRNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKH-----QLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|77360274|ref|YP_339849.1| succinyl-diaminopimelate desuccinylase [Pseudoalteromonas
           haloplanktis TAC125]
 gi|123589450|sp|Q3IL20|DAPE_PSEHT RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|76875185|emb|CAI86406.1| Succinyl-diaminopimelate desuccinylase (SDAP) [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 376

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 162/384 (42%), Positives = 225/384 (58%), Gaps = 13/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT D +     LI+  SVTP+D G   ++ + L+ +GF+IE   F     +   N +AR 
Sbjct: 1   MTNDVIALAQALIQRESVTPEDAGCQQMMNDRLQAVGFNIESLFF-----TDTLNTWARK 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT++PH  FAGH DVVP G   +W YPPFS  +  G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GTQSPHFCFAGHTDVVPTGPEKNWQYPPFSGLVENGLLHGRGAADMKGSLAAMLVATERF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + K+ +  GSIS LIT DEEGP INGT +++  +E +GEK D C+VGEP+   ++GD +K
Sbjct: 116 VTKHPDHKGSISFLITSDEEGPFINGTTRVIDTLEARGEKIDMCLVGEPSSRDVLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+G +T+ G QGHVAYP L +NPI    P L +L+   +D GN  F  T+ +I+
Sbjct: 176 NGRRGSLTGFLTVKGIQGHVAYPQLAQNPIHLTTPALTELSQTVWDHGNEYFPATSFQIS 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NVIP ++++ FN RF+       L++ + + L +   N  +LS  V+   P
Sbjct: 236 NINGGTGAGNVIPGELEVQFNFRFSTEVTHTQLQQRVNAILQQHNLNY-ELSWIVN-GQP 293

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
               FLT    L     K+I + TG    L T+GGTSD RFI      VIE G    T+H
Sbjct: 294 ----FLTEHGPLVDATVKAIKSVTGLTTNLETTGGTSDGRFIAQTGAKVIELGPRNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            ++E  S  DL  L  IYE  L+N
Sbjct: 350 KVDECVSTDDLIALCDIYEQILEN 373


>gi|324112962|gb|EGC06938.1| succinyl-diaminopimelate desuccinylase [Escherichia fergusonii
           B253]
          Length = 375

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 152/384 (39%), Positives = 224/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF     +  +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIKRLQAIGFTVERMDF-----ADTQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKH-----QLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|323967915|gb|EGB63327.1| succinyl-diaminopimelate desuccinylase [Escherichia coli M863]
 gi|325496498|gb|EGC94357.1| N-succinyl-diaminopimelate deacylase [Escherichia fergusonii
           ECD227]
 gi|327252121|gb|EGE63793.1| succinyl-diaminopimelate desuccinylase [Escherichia coli STEC_7v]
          Length = 375

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 152/384 (39%), Positives = 224/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   I++  L+ +GF++E  DF     +  +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQAIMIERLQAIGFTVERMDF-----ADTQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKH-----QLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|260772309|ref|ZP_05881225.1| N-succinyl-L,L-diaminopimelate desuccinylase [Vibrio metschnikovii
           CIP 69.14]
 gi|260611448|gb|EEX36651.1| N-succinyl-L,L-diaminopimelate desuccinylase [Vibrio metschnikovii
           CIP 69.14]
          Length = 378

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 160/375 (42%), Positives = 216/375 (57%), Gaps = 13/375 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI   SVTP D G   +++  L  LGF+IE   F+        N +AR GTE P  +FAG
Sbjct: 13  LISRESVTPNDAGCQQVMIERLIALGFNIEPMIFEDTT-----NFWARKGTEGPLFVFAG 67

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVP G    W  PPF  T+ +G ++GRG  DMKGS+AC I AV RF+ K+ N  GSI
Sbjct: 68  HTDVVPAGPLFQWHTPPFEPTVIDGYLHGRGAADMKGSLACMIVAVERFLAKHPNHKGSI 127

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
             LIT DEEGP INGT K++  +  + E  D CIVGEP+    +GD +K GRRGS++G++
Sbjct: 128 GFLITSDEEGPFINGTTKVVDTLMARNELIDMCIVGEPSSTLKVGDVVKNGRRGSITGDL 187

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
           TI G QGHVAYPHL  NP+   +P L +L    +D GN  F PT+ +I  +  G  + NV
Sbjct: 188 TIKGTQGHVAYPHLASNPVHQALPALAELAATTWDNGNAYFPPTSFQIPNLQAGTGASNV 247

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IP +  + FN RF+    E+ +K  + S L     +   L + + ++    P FLT    
Sbjct: 248 IPGEFSVQFNFRFSTELTEQEIKRRVHSVL-----DAHGLDYELKWTLSGDP-FLTDAGS 301

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFI-KDYCPVIEFGLVGRTMHALNENASLQDL 369
           L   +  ++       P L T+GGTSD RFI K    V+E G V  T+H +NE  S+ DL
Sbjct: 302 LLDAVVCAVQEVNHQQPQLLTTGGTSDGRFIAKMGAQVVELGPVNATIHKVNECVSIADL 361

Query: 370 EDLTCIYENFLQNWF 384
           E LT +Y+N L++ F
Sbjct: 362 EKLTDMYQNVLEHLF 376


>gi|156932975|ref|YP_001436891.1| succinyl-diaminopimelate desuccinylase [Cronobacter sakazakii ATCC
           BAA-894]
 gi|238064785|sp|A7ML10|DAPE_ENTS8 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|156531229|gb|ABU76055.1| hypothetical protein ESA_00778 [Cronobacter sakazakii ATCC BAA-894]
          Length = 375

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 151/384 (39%), Positives = 223/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E       N    +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAVGFTVE-----PMNIGDTQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT    L FAGH DVVP GD   W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GT-GETLAFAGHTDVVPAGDVERWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ +  G ++ LIT DEE  A NGT K++  +  +GE+ D C+VGEP+ + ++GD +K
Sbjct: 115 VAQHPHHRGRLAFLITSDEEASATNGTVKVVEALMARGERLDYCLVGEPSSSEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P+L++L  I +D GN  F PT+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMLNELVGIEWDRGNEFFPPTSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP  + + FN RF+    ++ +K+ + + L K      +L +T+ +   
Sbjct: 235 NIQAGTGSNNVIPGDLHVQFNFRFSTELTDEMIKQRVVALLEK-----YQLRYTLDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  ++++     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVHHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE     DL+ L  +Y+  ++ 
Sbjct: 349 KINECVKASDLQLLARMYQRIMEQ 372


>gi|16130397|ref|NP_416967.1| N-succinyl-diaminopimelate deacylase [Escherichia coli str. K-12
           substr. MG1655]
 gi|24113800|ref|NP_708310.1| succinyl-diaminopimelate desuccinylase [Shigella flexneri 2a str.
           301]
 gi|30063851|ref|NP_838022.1| succinyl-diaminopimelate desuccinylase [Shigella flexneri 2a str.
           2457T]
 gi|82544919|ref|YP_408866.1| succinyl-diaminopimelate desuccinylase [Shigella boydii Sb227]
 gi|89109277|ref|AP_003057.1| N-succinyl-diaminopimelate deacylase [Escherichia coli str. K-12
           substr. W3110]
 gi|157158473|ref|YP_001463794.1| succinyl-diaminopimelate desuccinylase [Escherichia coli E24377A]
 gi|157161932|ref|YP_001459250.1| succinyl-diaminopimelate desuccinylase [Escherichia coli HS]
 gi|170019244|ref|YP_001724198.1| succinyl-diaminopimelate desuccinylase [Escherichia coli ATCC 8739]
 gi|170082081|ref|YP_001731401.1| N-succinyl-diaminopimelate deacylase [Escherichia coli str. K-12
           substr. DH10B]
 gi|170683901|ref|YP_001744654.1| succinyl-diaminopimelate desuccinylase [Escherichia coli SMS-3-5]
 gi|188495224|ref|ZP_03002494.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 53638]
 gi|193064746|ref|ZP_03045824.1| succinyl-diaminopimelate desuccinylase [Escherichia coli E22]
 gi|194427309|ref|ZP_03059859.1| succinyl-diaminopimelate desuccinylase [Escherichia coli B171]
 gi|194437583|ref|ZP_03069679.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 101-1]
 gi|215487775|ref|YP_002330206.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O127:H6
           str. E2348/69]
 gi|218554995|ref|YP_002387908.1| succinyl-diaminopimelate desuccinylase [Escherichia coli IAI1]
 gi|218690598|ref|YP_002398810.1| succinyl-diaminopimelate desuccinylase [Escherichia coli ED1a]
 gi|218696098|ref|YP_002403765.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 55989]
 gi|238901636|ref|YP_002927432.1| N-succinyl-diaminopimelate deacylase [Escherichia coli BW2952]
 gi|253772637|ref|YP_003035468.1| succinyl-diaminopimelate desuccinylase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254162446|ref|YP_003045554.1| succinyl-diaminopimelate desuccinylase [Escherichia coli B str.
           REL606]
 gi|256017387|ref|ZP_05431252.1| succinyl-diaminopimelate desuccinylase [Shigella sp. D9]
 gi|256021843|ref|ZP_05435708.1| succinyl-diaminopimelate desuccinylase [Escherichia sp. 4_1_40B]
 gi|260845103|ref|YP_003222881.1| N-succinyl-diaminopimelate deacylase [Escherichia coli O103:H2 str.
           12009]
 gi|260869159|ref|YP_003235561.1| N-succinyl-diaminopimelate deacylase [Escherichia coli O111:H- str.
           11128]
 gi|293410866|ref|ZP_06654442.1| succinyl-diaminopimelate desuccinylase [Escherichia coli B354]
 gi|297516547|ref|ZP_06934933.1| succinyl-diaminopimelate desuccinylase [Escherichia coli OP50]
 gi|300903477|ref|ZP_07121402.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 84-1]
 gi|300921400|ref|ZP_07137761.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 115-1]
 gi|300930094|ref|ZP_07145519.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 187-1]
 gi|300940288|ref|ZP_07154884.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 21-1]
 gi|300951832|ref|ZP_07165643.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 116-1]
 gi|300957179|ref|ZP_07169414.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 175-1]
 gi|301023822|ref|ZP_07187557.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 196-1]
 gi|301302819|ref|ZP_07208947.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 124-1]
 gi|301644461|ref|ZP_07244458.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 146-1]
 gi|306814451|ref|ZP_07448613.1| succinyl-diaminopimelate desuccinylase [Escherichia coli NC101]
 gi|307139105|ref|ZP_07498461.1| succinyl-diaminopimelate desuccinylase [Escherichia coli H736]
 gi|312967760|ref|ZP_07781975.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 2362-75]
 gi|312973294|ref|ZP_07787466.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 1827-70]
 gi|331643088|ref|ZP_08344223.1| succinyl-diaminopimelate desuccinylase [Escherichia coli H736]
 gi|331669208|ref|ZP_08370056.1| succinyl-diaminopimelate desuccinylase [Escherichia coli TA271]
 gi|331678453|ref|ZP_08379128.1| succinyl-diaminopimelate desuccinylase [Escherichia coli H591]
 gi|332278385|ref|ZP_08390798.1| N-succinyl-diaminopimelate deacylase [Shigella sp. D9]
 gi|83305672|sp|P0AED7|DAPE_ECOLI RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|83305673|sp|P0AED8|DAPE_SHIFL RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|123559033|sp|Q31Y20|DAPE_SHIBS RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064733|sp|A7ZPR5|DAPE_ECO24 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064734|sp|B7UGM1|DAPE_ECO27 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064736|sp|B7LCK7|DAPE_ECO55 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064739|sp|B7M7H2|DAPE_ECO8A RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064740|sp|B1XAE3|DAPE_ECODH RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064741|sp|A8A2W3|DAPE_ECOHS RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064743|sp|B1IWI8|DAPE_ECOLC RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064746|sp|B1LNC1|DAPE_ECOSM RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|259595044|sp|C4ZX46|DAPE_ECOBW RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|41234|emb|CAA40665.1| succinyldiaminopimelate desuccinylase [Escherichia coli K-12]
 gi|253061|gb|AAB22798.1| N-succinyl-L-diaminopimelic acid desuccinylase [Escherichia coli]
 gi|1788816|gb|AAC75525.1| N-succinyl-diaminopimelate deacylase [Escherichia coli str. K-12
           substr. MG1655]
 gi|1799895|dbj|BAA16346.1| N-succinyl-diaminopimelate deacylase [Escherichia coli str. K12
           substr. W3110]
 gi|24052884|gb|AAN44017.1| N-succinyl-diaminopimelate deacylase [Shigella flexneri 2a str.
           301]
 gi|30042106|gb|AAP17832.1| N-succinyl-diaminopimelate deacylase [Shigella flexneri 2a str.
           2457T]
 gi|81246330|gb|ABB67038.1| N-succinyl-diaminopimelate deacylase [Shigella boydii Sb227]
 gi|157067612|gb|ABV06867.1| succinyl-diaminopimelate desuccinylase [Escherichia coli HS]
 gi|157080503|gb|ABV20211.1| succinyl-diaminopimelate desuccinylase [Escherichia coli E24377A]
 gi|169754172|gb|ACA76871.1| succinyl-diaminopimelate desuccinylase [Escherichia coli ATCC 8739]
 gi|169889916|gb|ACB03623.1| N-succinyl-diaminopimelate deacylase [Escherichia coli str. K-12
           substr. DH10B]
 gi|170521619|gb|ACB19797.1| succinyl-diaminopimelate desuccinylase [Escherichia coli SMS-3-5]
 gi|188490423|gb|EDU65526.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 53638]
 gi|192927629|gb|EDV82245.1| succinyl-diaminopimelate desuccinylase [Escherichia coli E22]
 gi|194414630|gb|EDX30902.1| succinyl-diaminopimelate desuccinylase [Escherichia coli B171]
 gi|194423389|gb|EDX39380.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 101-1]
 gi|215265847|emb|CAS10256.1| N-succinyl-diaminopimelate deacylase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218352830|emb|CAU98618.1| N-succinyl-diaminopimelate deacylase [Escherichia coli 55989]
 gi|218361763|emb|CAQ99360.1| N-succinyl-diaminopimelate deacylase [Escherichia coli IAI1]
 gi|218428162|emb|CAR09077.2| N-succinyl-diaminopimelate deacylase [Escherichia coli ED1a]
 gi|238861918|gb|ACR63916.1| N-succinyl-diaminopimelate deacylase [Escherichia coli BW2952]
 gi|242378071|emb|CAQ32842.1| N-succinyl-L-diaminopimelate desuccinylase subunit, subunit of
           N-succinyl-L-diaminopimelate desuccinylase [Escherichia
           coli BL21(DE3)]
 gi|253323681|gb|ACT28283.1| succinyl-diaminopimelate desuccinylase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253974347|gb|ACT40018.1| succinyl-diaminopimelate desuccinylase [Escherichia coli B str.
           REL606]
 gi|253978514|gb|ACT44184.1| succinyl-diaminopimelate desuccinylase [Escherichia coli BL21(DE3)]
 gi|257760250|dbj|BAI31747.1| N-succinyl-diaminopimelate deacylase [Escherichia coli O103:H2 str.
           12009]
 gi|257765515|dbj|BAI37010.1| N-succinyl-diaminopimelate deacylase [Escherichia coli O111:H- str.
           11128]
 gi|260448450|gb|ACX38872.1| succinyl-diaminopimelate desuccinylase [Escherichia coli DH1]
 gi|281601875|gb|ADA74859.1| putative Acetylornithine deacetylase/Succinyl-diaminopimelate
           desuccinylase-like deacylase [Shigella flexneri 2002017]
 gi|284922418|emb|CBG35505.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 042]
 gi|291471334|gb|EFF13818.1| succinyl-diaminopimelate desuccinylase [Escherichia coli B354]
 gi|299880695|gb|EFI88906.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 196-1]
 gi|300316023|gb|EFJ65807.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 175-1]
 gi|300404509|gb|EFJ88047.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 84-1]
 gi|300411712|gb|EFJ95022.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 115-1]
 gi|300448928|gb|EFK12548.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 116-1]
 gi|300454852|gb|EFK18345.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 21-1]
 gi|300461984|gb|EFK25477.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 187-1]
 gi|300841754|gb|EFK69514.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 124-1]
 gi|301077206|gb|EFK92012.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 146-1]
 gi|305851845|gb|EFM52297.1| succinyl-diaminopimelate desuccinylase [Escherichia coli NC101]
 gi|309702751|emb|CBJ02080.1| succinyl-diaminopimelate desuccinylase [Escherichia coli ETEC
           H10407]
 gi|310331889|gb|EFP99124.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 1827-70]
 gi|312287957|gb|EFR15862.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 2362-75]
 gi|313650927|gb|EFS15327.1| succinyl-diaminopimelate desuccinylase [Shigella flexneri 2a str.
           2457T]
 gi|315137094|dbj|BAJ44253.1| succinyl-diaminopimelate desuccinylase [Escherichia coli DH1]
 gi|315256483|gb|EFU36451.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 85-1]
 gi|315300443|gb|EFU59673.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 16-3]
 gi|315615714|gb|EFU96346.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 3431]
 gi|320176283|gb|EFW51344.1| N-succinyl-L,L-diaminopimelate desuccinylase [Shigella dysenteriae
           CDC 74-1112]
 gi|320180455|gb|EFW55386.1| N-succinyl-L,L-diaminopimelate desuccinylase [Shigella boydii ATCC
           9905]
 gi|320185164|gb|EFW59944.1| N-succinyl-L,L-diaminopimelate desuccinylase [Shigella flexneri CDC
           796-83]
 gi|320200030|gb|EFW74619.1| N-succinyl-L,L-diaminopimelate desuccinylase [Escherichia coli
           EC4100B]
 gi|323159320|gb|EFZ45305.1| succinyl-diaminopimelate desuccinylase [Escherichia coli E128010]
 gi|323170270|gb|EFZ55923.1| succinyl-diaminopimelate desuccinylase [Escherichia coli LT-68]
 gi|323177411|gb|EFZ62999.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 1180]
 gi|323936363|gb|EGB32653.1| succinyl-diaminopimelate desuccinylase [Escherichia coli E1520]
 gi|323941273|gb|EGB37458.1| succinyl-diaminopimelate desuccinylase [Escherichia coli E482]
 gi|323944688|gb|EGB40755.1| succinyl-diaminopimelate desuccinylase [Escherichia coli H120]
 gi|323961264|gb|EGB56876.1| succinyl-diaminopimelate desuccinylase [Escherichia coli H489]
 gi|323971009|gb|EGB66258.1| succinyl-diaminopimelate desuccinylase [Escherichia coli TA007]
 gi|324118187|gb|EGC12084.1| succinyl-diaminopimelate desuccinylase [Escherichia coli E1167]
 gi|331039886|gb|EGI12106.1| succinyl-diaminopimelate desuccinylase [Escherichia coli H736]
 gi|331064402|gb|EGI36313.1| succinyl-diaminopimelate desuccinylase [Escherichia coli TA271]
 gi|331074913|gb|EGI46233.1| succinyl-diaminopimelate desuccinylase [Escherichia coli H591]
 gi|332087912|gb|EGI93037.1| succinyl-diaminopimelate desuccinylase [Shigella boydii 5216-82]
 gi|332093033|gb|EGI98099.1| succinyl-diaminopimelate desuccinylase [Shigella boydii 3594-74]
 gi|332100737|gb|EGJ04083.1| N-succinyl-diaminopimelate deacylase [Shigella sp. D9]
 gi|332755112|gb|EGJ85477.1| succinyl-diaminopimelate desuccinylase [Shigella flexneri 4343-70]
 gi|332755511|gb|EGJ85875.1| succinyl-diaminopimelate desuccinylase [Shigella flexneri K-671]
 gi|332756499|gb|EGJ86850.1| succinyl-diaminopimelate desuccinylase [Shigella flexneri 2747-71]
 gi|332766277|gb|EGJ96487.1| succinyl-diaminopimelate desuccinylase [Shigella flexneri 2930-71]
 gi|333002003|gb|EGK21569.1| succinyl-diaminopimelate desuccinylase [Shigella flexneri K-218]
 gi|333016372|gb|EGK35703.1| succinyl-diaminopimelate desuccinylase [Shigella flexneri K-304]
          Length = 375

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 152/384 (39%), Positives = 224/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF     +  +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDF-----ADTQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKH-----QLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|218548095|ref|YP_002381886.1| succinyl-diaminopimelate desuccinylase [Escherichia fergusonii ATCC
           35469]
 gi|238064787|sp|B7LKH0|DAPE_ESCF3 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|218355636|emb|CAQ88248.1| N-succinyl-diaminopimelate deacylase [Escherichia fergusonii ATCC
           35469]
          Length = 375

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 152/384 (39%), Positives = 224/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF     +  +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIKRLQAIGFTVERMDF-----ADTQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVDALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKH-----QLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|187733531|ref|YP_001881263.1| succinyl-diaminopimelate desuccinylase [Shigella boydii CDC
           3083-94]
 gi|238055227|sp|B2TXP7|DAPE_SHIB3 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|187430523|gb|ACD09797.1| succinyl-diaminopimelate desuccinylase [Shigella boydii CDC
           3083-94]
          Length = 375

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 152/384 (39%), Positives = 224/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF     +  +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDF-----ADTQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKH-----QLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNTADLQLLARMYQRIMEQ 372


>gi|333002256|gb|EGK21820.1| succinyl-diaminopimelate desuccinylase [Shigella flexneri K-272]
 gi|333016078|gb|EGK35410.1| succinyl-diaminopimelate desuccinylase [Shigella flexneri K-227]
          Length = 375

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 152/384 (39%), Positives = 224/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF     +  +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDF-----ADTQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKH-----QLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTTRGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|260913015|ref|ZP_05919500.1| succinyl-diaminopimelate desuccinylase [Pasteurella dagmatis ATCC
           43325]
 gi|260633005|gb|EEX51171.1| succinyl-diaminopimelate desuccinylase [Pasteurella dagmatis ATCC
           43325]
          Length = 377

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 155/384 (40%), Positives = 222/384 (57%), Gaps = 13/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +E   +LI+ PSV+P D G   ++   L+ LGF IE   F   N ++  NL+A+ 
Sbjct: 1   MKNSIIELASELIRRPSVSPDDQGCQQVIAERLQKLGFQIEWMPF---NDTL--NLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G  +P + FAGH DVVP GD   W YPPFSA I +  +YGRG  DMKGS+A  + AV +F
Sbjct: 56  GVGSPVITFAGHTDVVPVGDEKQWQYPPFSAQIVDDVLYGRGAADMKGSLAAMVVAVEKF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G+I+LLIT DEE  A +GT  ++  +  + E  D CIVGEP+ +  +GD +K
Sbjct: 116 VKANPNHQGTIALLITSDEEAAAKDGTVCVVETLMARNEPIDYCIVGEPSSSQKLGDIVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++  + I G QGHVAYPHL ENP+   +  L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITANLYIQGIQGHVAYPHLAENPVHKALAFLSELTTYQWDNGNEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  S NVIP ++ + FN+R+     ++ +K+ +   L K      +L+H + ++  
Sbjct: 236 NINAGTGSNNVIPGELYVQFNLRYCTEVTDEIIKKTVAEMLQK-----YQLTHRIEWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT + KL      ++   T N P L T GGTSDARFI      V+EFG + +T+H
Sbjct: 291 GKP-FLTRNGKLVEATISAVQKITKNTPHLDTGGGTSDARFIALMGAEVVEFGPLNKTIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE   + DL     +Y+  L N
Sbjct: 350 KVNECVDVNDLAKCGDVYQQILIN 373


>gi|86146840|ref|ZP_01065159.1| succinyl-diaminopimelate desuccinylase [Vibrio sp. MED222]
 gi|85835292|gb|EAQ53431.1| succinyl-diaminopimelate desuccinylase [Vibrio sp. MED222]
          Length = 378

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 156/376 (41%), Positives = 214/376 (56%), Gaps = 13/376 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            LI   SVTP+D G   ++++ LK LGF IE   F+        N +AR GTEAP   FA
Sbjct: 12  DLISRQSVTPEDAGCQDLMIDRLKALGFEIEVMVFED-----TTNFWARRGTEAPLFAFA 66

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVP G    W   PF  TI +G ++GRG  DMKGS+A  + AV +FI K+ +  GS
Sbjct: 67  GHTDVVPAGPIEQWNTKPFEPTIVDGFLHGRGAADMKGSLASMVVAVEQFIAKHPDHTGS 126

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I  LIT DEEGP INGT +++  +  +GE  D CIVGEP+    +GD +K GRRGS++G+
Sbjct: 127 IGFLITSDEEGPFINGTVRVVEALMARGENIDMCIVGEPSSTEYVGDVVKNGRRGSITGD 186

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +TI G QGHVAYPHL  NP+   +  +++L    +D GN  F PT+ +I  +  G  + N
Sbjct: 187 LTIKGTQGHVAYPHLANNPVHSSLLAINELATTEWDKGNDYFPPTSFQIPNVSAGTGASN 246

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP +  + FN+RF+   N   + E I + L K         + + ++    P FLT   
Sbjct: 247 VIPGEFNVQFNLRFSTELNNDIIVERITNTLDK-----YDFEYDLKWTFNGDP-FLTDAG 300

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFI-KDYCPVIEFGLVGRTMHALNENASLQD 368
            L   +  ++ +     P L T+GGTSD RFI +    V+E G V  T+H +NE   + D
Sbjct: 301 SLLDAIVDAVGHVNDVKPALLTTGGTSDGRFIARMKGQVVELGPVNATIHKVNECVKVAD 360

Query: 369 LEDLTCIYENFLQNWF 384
           LE LT +YE  L N F
Sbjct: 361 LEKLTDMYERTLVNLF 376


>gi|15802994|ref|NP_289024.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           EDL933]
 gi|15832588|ref|NP_311361.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. Sakai]
 gi|168748475|ref|ZP_02773497.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4113]
 gi|168756238|ref|ZP_02781245.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4401]
 gi|168761075|ref|ZP_02786082.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4501]
 gi|168768558|ref|ZP_02793565.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4486]
 gi|168773620|ref|ZP_02798627.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4196]
 gi|168778432|ref|ZP_02803439.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4076]
 gi|168787812|ref|ZP_02812819.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC869]
 gi|168798837|ref|ZP_02823844.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC508]
 gi|195936613|ref|ZP_03081995.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4024]
 gi|208809384|ref|ZP_03251721.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4206]
 gi|208812596|ref|ZP_03253925.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4045]
 gi|208820847|ref|ZP_03261167.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4042]
 gi|209396481|ref|YP_002271940.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4115]
 gi|217327512|ref|ZP_03443595.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. TW14588]
 gi|254794416|ref|YP_003079253.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. TW14359]
 gi|261223096|ref|ZP_05937377.1| N-succinyl-diaminopimelate deacylase [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261259352|ref|ZP_05951885.1| N-succinyl-diaminopimelate deacylase [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291283691|ref|YP_003500509.1| Succinyl-diaminopimelate desuccinylase [Escherichia coli O55:H7
           str. CB9615]
 gi|81765646|sp|Q8XBE0|DAPE_ECO57 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064737|sp|B5Z008|DAPE_ECO5E RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|12516850|gb|AAG57581.1|AE005476_6 N-succinyl-diaminopimelate deacylase [Escherichia coli O157:H7 str.
           EDL933]
 gi|13362804|dbj|BAB36757.1| N-succinyl-diaminopimelate deacylase [Escherichia coli O157:H7 str.
           Sakai]
 gi|187770666|gb|EDU34510.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4196]
 gi|188017094|gb|EDU55216.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4113]
 gi|189003182|gb|EDU72168.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4076]
 gi|189356596|gb|EDU75015.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4401]
 gi|189362299|gb|EDU80718.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4486]
 gi|189368452|gb|EDU86868.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4501]
 gi|189372314|gb|EDU90730.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC869]
 gi|189378637|gb|EDU97053.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC508]
 gi|208729185|gb|EDZ78786.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4206]
 gi|208733873|gb|EDZ82560.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4045]
 gi|208740970|gb|EDZ88652.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4042]
 gi|209157881|gb|ACI35314.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4115]
 gi|209763758|gb|ACI80191.1| N-succinyl-diaminopimelate deacylase [Escherichia coli]
 gi|209763760|gb|ACI80192.1| N-succinyl-diaminopimelate deacylase [Escherichia coli]
 gi|209763762|gb|ACI80193.1| N-succinyl-diaminopimelate deacylase [Escherichia coli]
 gi|209763764|gb|ACI80194.1| N-succinyl-diaminopimelate deacylase [Escherichia coli]
 gi|209763766|gb|ACI80195.1| N-succinyl-diaminopimelate deacylase [Escherichia coli]
 gi|217319879|gb|EEC28304.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. TW14588]
 gi|254593816|gb|ACT73177.1| N-succinyl-diaminopimelate deacylase [Escherichia coli O157:H7 str.
           TW14359]
 gi|290763564|gb|ADD57525.1| Succinyl-diaminopimelate desuccinylase [Escherichia coli O55:H7
           str. CB9615]
 gi|320188803|gb|EFW63462.1| N-succinyl-L,L-diaminopimelate desuccinylase [Escherichia coli
           O157:H7 str. EC1212]
 gi|320640975|gb|EFX10459.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. G5101]
 gi|320646257|gb|EFX15184.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H-
           str. 493-89]
 gi|320651763|gb|EFX20143.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H-
           str. H 2687]
 gi|320657148|gb|EFX24957.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O55:H7
           str. 3256-97 TW 07815]
 gi|320662907|gb|EFX30235.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O55:H7
           str. USDA 5905]
 gi|320667794|gb|EFX34705.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. LSU-61]
 gi|326340266|gb|EGD64070.1| N-succinyl-L,L-diaminopimelate desuccinylase [Escherichia coli
           O157:H7 str. 1125]
 gi|326344951|gb|EGD68695.1| N-succinyl-L,L-diaminopimelate desuccinylase [Escherichia coli
           O157:H7 str. 1044]
          Length = 375

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 152/384 (39%), Positives = 223/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF     +  +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDF-----ADTQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K +  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKAVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKH-----QLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|260598858|ref|YP_003211429.1| succinyl-diaminopimelate desuccinylase [Cronobacter turicensis
           z3032]
 gi|260218035|emb|CBA32738.1| Succinyl-diaminopimelate desuccinylase [Cronobacter turicensis
           z3032]
          Length = 375

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 150/384 (39%), Positives = 223/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E       N    +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLRAVGFTVE-----PMNIGDTQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT    L FAGH DVVP GD   W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GT-GETLAFAGHTDVVPAGDVERWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ +  G ++ LIT DEE  A NGT K++  +  +GE+ D C+VGEP+ + ++GD +K
Sbjct: 115 VAQHPHHRGRLAFLITSDEEASAANGTVKVVEALMARGERLDYCLVGEPSSSEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P+L++L  I +D GN  F PT+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMLNELVGIEWDRGNEFFPPTSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP  + + FN RF+    ++ +K+ + + L +      +L +T+ +   
Sbjct: 235 NIQAGTGSNNVIPGDLHVQFNFRFSTQLTDEMIKQRVVALLEQH-----QLRYTLDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  ++++     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVHHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE     DL+ L  +Y+  ++ 
Sbjct: 349 KINECVKASDLQLLARMYQRIMEQ 372


>gi|237732457|ref|ZP_04562938.1| succinyl-diaminopimelate desuccinylase [Citrobacter sp. 30_2]
 gi|226907996|gb|EEH93914.1| succinyl-diaminopimelate desuccinylase [Citrobacter sp. 30_2]
          Length = 375

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 152/384 (39%), Positives = 222/384 (57%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF++E  DF        +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRAVGFTVERMDFGD-----TQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-KGETLAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   I+GD +K
Sbjct: 115 VAQHPNHQGRLAFLITSDEEASAKNGTVKVVEALMARNERLDYCLVGEPSSTEIVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P+L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K  + + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFIQFNFRFSTELTDEMIKARVHALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTERGKLVDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|333001604|gb|EGK21172.1| succinyl-diaminopimelate desuccinylase [Shigella flexneri VA-6]
          Length = 375

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 152/384 (39%), Positives = 224/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF     +  +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDF-----ADTQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKH-----QLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIIEQ 372


>gi|30248139|ref|NP_840209.1| succinyl-diaminopimelate desuccinylase [Nitrosomonas europaea ATCC
           19718]
 gi|81584893|sp|Q82XY4|DAPE_NITEU RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|30180024|emb|CAD84019.1| Peptidase family M20/M25/M40 [Nitrosomonas europaea ATCC 19718]
          Length = 376

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 159/378 (42%), Positives = 218/378 (57%), Gaps = 17/378 (4%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI   S+TP D G   ++++ L  LGF  +   F       V+NL+ R G++AP + FAG
Sbjct: 12  LIARRSLTPDDDGCQKMIMHRLAGLGFKSDSMTFGE-----VENLWTRKGSDAPLVCFAG 66

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI---PKYKNFG 128
           H DVVP G    W   PF+  + +G +YGRG  DMK S+A F+ A+  FI   P +K  G
Sbjct: 67  HTDVVPTGPVTQWDSDPFTPVVRDGFLYGRGAADMKTSLAAFVTAIEEFIELHPDHK--G 124

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           SI+LLIT DEEGPA++GT K++  ++ +GE  D CIVGEPTC + +GDTIK GRRGSLSG
Sbjct: 125 SIALLITSDEEGPAVDGTVKVVEALQTRGEMIDYCIVGEPTCTNQLGDTIKNGRRGSLSG 184

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
            +T+ G QGH+AYPHL  NPI    P + +L    +D GN  F  T   I+ I  G  + 
Sbjct: 185 NLTVRGIQGHIAYPHLARNPIHTAAPAIAELAQTVWDNGNEYFPATTWHISNIHGGTGAT 244

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHD 308
           NVIP ++ + FN RF+      +LK  +       I +   L + + +     P +LT  
Sbjct: 245 NVIPGEINLLFNFRFSTASTVDSLKARVHE-----ILDRHGLDYELIWELSGKP-YLTPR 298

Query: 309 RKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNENASLQ 367
             L   +S +I   TG  P LST+GGTSD RFI D C  V+EFG    T+H +NE+  + 
Sbjct: 299 GTLADAVSAAIREVTGIEPELSTTGGTSDGRFIADICQQVVEFGPRNATIHKINESVEVA 358

Query: 368 DLEDLTCIYENFLQNWFI 385
           D+E L  IY   L+N  +
Sbjct: 359 DVERLARIYRLTLENLLL 376


>gi|110806404|ref|YP_689924.1| succinyl-diaminopimelate desuccinylase [Shigella flexneri 5 str.
           8401]
 gi|123048026|sp|Q0T246|DAPE_SHIF8 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|110615952|gb|ABF04619.1| N-succinyl-diaminopimelate deacylase [Shigella flexneri 5 str.
           8401]
          Length = 375

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 152/384 (39%), Positives = 224/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF     +  +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPYDAGCQALLIERLQAIGFTVERMDF-----ADTQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKH-----QLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|54308039|ref|YP_129059.1| succinyl-diaminopimelate desuccinylase [Photobacterium profundum
           SS9]
 gi|81615428|sp|Q6LTW8|DAPE_PHOPR RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|46912465|emb|CAG19257.1| putative succinyl-diaminopimelate desuccinylase [Photobacterium
           profundum SS9]
          Length = 377

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 153/377 (40%), Positives = 221/377 (58%), Gaps = 13/377 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            L+   SVTP+D G   +++  L+ L F IE   F         NL+AR GT+AP  +FA
Sbjct: 12  DLMSRNSVTPEDAGCQDVMIARLEKLDFVIETMVFDDTT-----NLWARRGTQAPLFVFA 66

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVP G    W  PPF  TI +G ++GRG  DMKGS+AC I ++ RF+ ++ +  GS
Sbjct: 67  GHTDVVPAGSLEQWHTPPFEPTIIDGYLHGRGAADMKGSLACMIVSIERFLAEHPDHTGS 126

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I+LLIT DEEGP INGT +++  +E + EK D CIVGEP+  H +GD +K GRRGS++G+
Sbjct: 127 IALLITSDEEGPFINGTTRVIDTLEARNEKIDMCIVGEPSSTHAVGDVVKNGRRGSITGD 186

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +T+ G QGHVAYPHL +NP+   +P L +L    +D GNT F  T+ +I  +  G  + N
Sbjct: 187 LTVKGIQGHVAYPHLADNPVHKALPALAELAATTWDNGNTYFPATSFQIANLASGTGASN 246

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP +  + FN RF+    +  +K  + S     I +   L++ + ++    P FLT + 
Sbjct: 247 VIPGEFDVQFNFRFSTELTDGEIKRRVHS-----ILDAHGLNYDLKWTLSGHP-FLTDEG 300

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFI-KDYCPVIEFGLVGRTMHALNENASLQD 368
            L   +  ++ +     P L T+GGTSD RFI +    V+E G V  T+H +NE     D
Sbjct: 301 TLVEAVVAAVEDVNHTKPALLTTGGTSDGRFIARTGAQVVELGPVNATIHKVNECVKAAD 360

Query: 369 LEDLTCIYENFLQNWFI 385
           LE LT +Y+  L+   +
Sbjct: 361 LEKLTDMYQKVLEKSLV 377


>gi|149908926|ref|ZP_01897585.1| succinyl-diaminopimelate desuccinylase [Moritella sp. PE36]
 gi|149807937|gb|EDM67880.1| succinyl-diaminopimelate desuccinylase [Moritella sp. PE36]
          Length = 378

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 159/371 (42%), Positives = 217/371 (58%), Gaps = 13/371 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           L+   SVTP+D G   +++  L+ LGF+IE   F+        NL+AR GT AP   FAG
Sbjct: 13  LLSRKSVTPEDAGCQQMIIERLEGLGFTIETMVFEDTT-----NLWARRGTAAPVFCFAG 67

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVP G    W   PF  T+ +G ++GRG  DMKGSIA F+ AV  F+    N  GSI
Sbjct: 68  HTDVVPVGKIEDWDTDPFVPTVIDGYLHGRGAADMKGSIASFLVAVENFVNDNPNHQGSI 127

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           +LLIT DEEGP INGT +++  +E + EK D CIVGEP+  + +GD +K GRRGSL+G+I
Sbjct: 128 ALLITSDEEGPFINGTTRVIDTLEARNEKIDWCIVGEPSSTNKVGDIVKNGRRGSLTGDI 187

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
            + G QGHVAYPHL +NPI  L P L +L+ + +D GN  F  T ++IT I  G  + N+
Sbjct: 188 VVKGIQGHVAYPHLADNPIHKLAPALTELSQVVWDQGNEYFPATTLQITDIRSGAGASNI 247

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           +P +    FN+R++       L  ++    I+GI     L++ + +     P FLT    
Sbjct: 248 VPGEATCQFNLRYS-----TELTADLIKYRIEGIFAKHGLNYEISWIHSGQP-FLTEPGN 301

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDL 369
           L + ++ SI +  G    LSTSGGTSD RFI      V+E G V  T+H +NE   + D+
Sbjct: 302 LLNAITDSIESVCGYPSELSTSGGTSDGRFIAPTGAQVVELGPVNATIHKVNECVKIADI 361

Query: 370 EDLTCIYENFL 380
           E L  IYE  L
Sbjct: 362 EQLAEIYEQTL 372


>gi|194432072|ref|ZP_03064361.1| succinyl-diaminopimelate desuccinylase [Shigella dysenteriae 1012]
 gi|194419601|gb|EDX35681.1| succinyl-diaminopimelate desuccinylase [Shigella dysenteriae 1012]
 gi|332089688|gb|EGI94789.1| succinyl-diaminopimelate desuccinylase [Shigella dysenteriae
           155-74]
          Length = 375

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 152/384 (39%), Positives = 223/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+  GF++E  DF     +  +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAFGFTVERMDF-----ADTQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKH-----QLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|323498647|ref|ZP_08103639.1| succinyl-diaminopimelate desuccinylase [Vibrio sinaloensis DSM
           21326]
 gi|323316345|gb|EGA69364.1| succinyl-diaminopimelate desuccinylase [Vibrio sinaloensis DSM
           21326]
          Length = 377

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 156/375 (41%), Positives = 217/375 (57%), Gaps = 17/375 (4%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI   SVTP+D G   +++  LK LGF+IE   F+        N +AR GTEAP   FAG
Sbjct: 13  LISRQSVTPEDAGCQEVMIERLKALGFNIEVMVFED-----TTNFWARRGTEAPLFAFAG 67

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI---PKYKNFG 128
           H DVVP G  + W  PPF  TI +G ++GRG  DMKGS+A  I AV +FI   P +K  G
Sbjct: 68  HTDVVPAGKLDQWDTPPFEPTIIDGYLHGRGAADMKGSLASMIVAVEQFIAQNPDHK--G 125

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           SI  LIT DEEGP INGT +++  +  +GE  D CIVGEP+   ++GD +K GRRGS++G
Sbjct: 126 SIGFLITSDEEGPFINGTVRVVETLMARGENIDMCIVGEPSSTEVVGDVVKNGRRGSITG 185

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
           ++T+ G QGHVAYPHL +NP+   +  +H+L +  +D GN  F PT+ +I  +  G  + 
Sbjct: 186 DLTVKGIQGHVAYPHLAKNPVHQSLLAIHELASTEWDKGNDYFPPTSFQIPNVHAGTGAS 245

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHD 308
           NVIP +  + FN+RF+   N   +   +   L K       L + + ++    P FLT  
Sbjct: 246 NVIPGEFNVQFNLRFSTELNNDMIVNRVVETLDK-----HDLDYELKWTFNGDP-FLTDT 299

Query: 309 RKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQ 367
             L   +  ++       P L T+GGTSD RFI      V+E G V  T+H +NE  ++ 
Sbjct: 300 GALLDAVVNAVDVVNQTKPALLTTGGTSDGRFIARMGGQVVELGPVNATIHKVNECVNVA 359

Query: 368 DLEDLTCIYENFLQN 382
           DLE LT +Y+  L+N
Sbjct: 360 DLEKLTDMYQKTLEN 374


>gi|226326348|ref|ZP_03801866.1| hypothetical protein PROPEN_00196 [Proteus penneri ATCC 35198]
 gi|225205299|gb|EEG87653.1| hypothetical protein PROPEN_00196 [Proteus penneri ATCC 35198]
          Length = 376

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 159/387 (41%), Positives = 219/387 (56%), Gaps = 13/387 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI  PS++P D G   ++++ L  LGF+IE   F        +N +A  
Sbjct: 1   MSCPVIELAQQLISRPSISPDDQGCQQLIIDRLTPLGFTIERMPFGE-----TENFWACR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G E   L FAGH DVVP GD N W  PPF  +I +G +YGRG  DMKGS+A  I A  RF
Sbjct: 56  GGEGETLAFAGHTDVVPTGDPNLWDNPPFEPSIRDGMLYGRGAADMKGSLAAMIVAAERF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  Y +  G ++ LIT DEE  A +GT K++  +  +GE+ D C+VGEP+  H +GD +K
Sbjct: 116 VHSYPDHRGRLAFLITSDEEAKATDGTVKVVQSLMSRGERLDYCLVGEPSSQHHLGDMVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++  + I G QGHVAYPHL ENPI    P + +L N  +D GN  F  T M+I 
Sbjct: 176 NGRRGSITANLIIQGVQGHVAYPHLAENPIHLASPFIQELINTVWDEGNEFFPATTMQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    +    EEIR R    +Q   +L + + +S  
Sbjct: 236 NIHAGTGSNNVIPGELFIQFNFRFSTAITD----EEIRQRTEALLQK-HQLRYQLEWSLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P F+T   KL   +  S+ + T   P LSTSGGTSD RFI      V+E G V  T+H
Sbjct: 291 GQP-FITGQGKLLEAVCYSVKHYTNLEPELSTSGGTSDGRFIAQMGAQVVELGPVNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            +NE  +  DL+ L+ IY+  ++   +
Sbjct: 350 KVNECVNAADLQQLSRIYQRVMEQLIL 376


>gi|331684122|ref|ZP_08384718.1| succinyl-diaminopimelate desuccinylase [Escherichia coli H299]
 gi|331079074|gb|EGI50276.1| succinyl-diaminopimelate desuccinylase [Escherichia coli H299]
          Length = 375

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 152/384 (39%), Positives = 224/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF     +  +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDF-----ADTQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVASERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKH-----QLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|193068374|ref|ZP_03049337.1| succinyl-diaminopimelate desuccinylase [Escherichia coli E110019]
 gi|192958326|gb|EDV88766.1| succinyl-diaminopimelate desuccinylase [Escherichia coli E110019]
          Length = 375

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 152/384 (39%), Positives = 224/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF     +  +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDF-----ADTQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALIARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKH-----QLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|283832145|ref|ZP_06351886.1| succinyl-diaminopimelate desuccinylase [Citrobacter youngae ATCC
           29220]
 gi|291071775|gb|EFE09884.1| succinyl-diaminopimelate desuccinylase [Citrobacter youngae ATCC
           29220]
          Length = 375

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 153/384 (39%), Positives = 225/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF++E  DF        +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRAVGFTVERMDFGD-----TQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-KGETLAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   I+GD +K
Sbjct: 115 VAQHPNHQGRLAFLITSDEEASAKNGTVKVVEALMARNERLDYCLVGEPSSTEIVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P+L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF    + +   E I+SR+++ + +  +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFIQFNFRF----STELTDEMIKSRVLE-LLDKHQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTERGKLVDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|146312608|ref|YP_001177682.1| succinyl-diaminopimelate desuccinylase [Enterobacter sp. 638]
 gi|238064784|sp|A4WD51|DAPE_ENT38 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|145319484|gb|ABP61631.1| succinyldiaminopimelate desuccinylase [Enterobacter sp. 638]
          Length = 375

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 150/384 (39%), Positives = 224/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF++E  DF        +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRAIGFTVERMDFGD-----TQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVPAGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N    ++ LIT DEE  A NGT +++  + ++ E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHKNRLAFLITSDEEASAKNGTVRVVETLMERHERLDYCLVGEPSSTEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P+L++L NI +D GN  F PT+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMLNELVNIEWDKGNEFFPPTSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            +  G  S NVIP    + FN RF    + +   E I+SR++  ++   +L ++V +   
Sbjct: 235 NLQAGTGSNNVIPGDFSVQFNFRF----STELTDEMIKSRVVALLEKY-ELRYSVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTQRGKLVDAVVNAIAHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|331648128|ref|ZP_08349218.1| succinyl-diaminopimelate desuccinylase [Escherichia coli M605]
 gi|331658621|ref|ZP_08359565.1| succinyl-diaminopimelate desuccinylase [Escherichia coli TA206]
 gi|222034191|emb|CAP76932.1| Succinyl-diaminopimelate desuccinylase [Escherichia coli LF82]
 gi|281179534|dbj|BAI55864.1| succinyl-diaminopimelate desuccinylase [Escherichia coli SE15]
 gi|312947056|gb|ADR27883.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O83:H1
           str. NRG 857C]
 gi|330912253|gb|EGH40763.1| N-succinyl-L,L-diaminopimelate desuccinylase [Escherichia coli
           AA86]
 gi|331042988|gb|EGI15128.1| succinyl-diaminopimelate desuccinylase [Escherichia coli M605]
 gi|331054286|gb|EGI26313.1| succinyl-diaminopimelate desuccinylase [Escherichia coli TA206]
          Length = 375

 Score =  280 bits (716), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 151/384 (39%), Positives = 224/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF     +  +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDF-----ADTQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P +++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFINELVAIEWDQGNDFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKH-----QLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|311278616|ref|YP_003940847.1| succinyl-diaminopimelate desuccinylase [Enterobacter cloacae SCF1]
 gi|308747811|gb|ADO47563.1| succinyl-diaminopimelate desuccinylase [Enterobacter cloacae SCF1]
          Length = 375

 Score =  280 bits (716), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 150/384 (39%), Positives = 223/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF++E  DF        +N +A  
Sbjct: 1   MSCPVIELAQQLIRRPSLSPDDAGCQALMIERLRAIGFTVEAMDFGD-----TQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVP GD N W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-KGETLAFAGHTDVVPAGDANRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A +GT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHKGRLAFLITSDEEASATHGTVKVVEALMARNERLDYCLVGEPSSTEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P++++L  I +D GN  F PT+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMINELVAIEWDKGNDYFPPTSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP  + + FN RF+    ++ +K ++ + L K      +L +T+ +   
Sbjct: 235 NIQAGTGSNNVIPGDLHVQFNFRFSTELTDEAIKAKVVALLDK-----HQLRYTLDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTGRGKLVDAVVNAIEHYNEVKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|152971336|ref|YP_001336445.1| succinyl-diaminopimelate desuccinylase [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|238064758|sp|A6TC94|DAPE_KLEP7 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|150956185|gb|ABR78215.1| succinyl-diaminopimelate desuccinylase [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
          Length = 375

 Score =  280 bits (716), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 153/384 (39%), Positives = 222/384 (57%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF++E  DF        +N +A  
Sbjct: 1   MSCPVIELAQQLIRRPSLSPDDAGCQALMIERLRAIGFTVEPMDFGD-----TQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-HGETLAFAGHTDVVPAGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + +Y N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQYPNHRGRLAFLITSDEEASAKNGTVKVVETLMARNERLDYCLVGEPSSTEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P+L +L NI +D GN  F PT+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMLAELVNIEWDKGNEFFPPTSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            +  G  S NVIP  + + FN RF    + +   E I+SR+I  ++   +L + + +   
Sbjct: 235 NVQSGTGSNNVIPGDMFVQFNFRF----STELTDEMIKSRVIALLEKY-QLRYRLEWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTGRGKLVDAVVNAIEHYNEIKPQLLTNGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRVMEQ 372


>gi|26248841|ref|NP_754881.1| succinyl-diaminopimelate desuccinylase [Escherichia coli CFT073]
 gi|91211803|ref|YP_541789.1| succinyl-diaminopimelate desuccinylase [Escherichia coli UTI89]
 gi|117624668|ref|YP_853581.1| succinyl-diaminopimelate desuccinylase [Escherichia coli APEC O1]
 gi|218559407|ref|YP_002392320.1| succinyl-diaminopimelate desuccinylase [Escherichia coli S88]
 gi|227887510|ref|ZP_04005315.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 83972]
 gi|237704988|ref|ZP_04535469.1| succinyl-diaminopimelate desuccinylase [Escherichia sp. 3_2_53FAA]
 gi|300981764|ref|ZP_07175728.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 45-1]
 gi|301046357|ref|ZP_07193519.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 185-1]
 gi|81475315|sp|Q8FF82|DAPE_ECOL6 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|122422938|sp|Q1R8Q6|DAPE_ECOUT RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064735|sp|B7MHW4|DAPE_ECO45 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064742|sp|A1ADX7|DAPE_ECOK1 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|26109247|gb|AAN81449.1|AE016764_131 Succinyl-diaminopimelate desuccinylase [Escherichia coli CFT073]
 gi|91073377|gb|ABE08258.1| succinyl-diaminopimelate desuccinylase [Escherichia coli UTI89]
 gi|115513792|gb|ABJ01867.1| succinyl-diaminopimelate desuccinylase [Escherichia coli APEC O1]
 gi|218366176|emb|CAR03922.1| N-succinyl-diaminopimelate deacylase [Escherichia coli S88]
 gi|226901354|gb|EEH87613.1| succinyl-diaminopimelate desuccinylase [Escherichia sp. 3_2_53FAA]
 gi|227835860|gb|EEJ46326.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 83972]
 gi|294492438|gb|ADE91194.1| succinyl-diaminopimelate desuccinylase [Escherichia coli IHE3034]
 gi|300301674|gb|EFJ58059.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 185-1]
 gi|300408949|gb|EFJ92487.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 45-1]
 gi|307554503|gb|ADN47278.1| N-succinyl-diaminopimelate deacylase [Escherichia coli ABU 83972]
 gi|307625965|gb|ADN70269.1| succinyl-diaminopimelate desuccinylase [Escherichia coli UM146]
 gi|315288109|gb|EFU47509.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 110-3]
 gi|315292409|gb|EFU51761.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 153-1]
 gi|320196313|gb|EFW70937.1| N-succinyl-L,L-diaminopimelate desuccinylase [Escherichia coli
           WV_060327]
 gi|323188225|gb|EFZ73518.1| succinyl-diaminopimelate desuccinylase [Escherichia coli RN587/1]
 gi|323949496|gb|EGB45384.1| succinyl-diaminopimelate desuccinylase [Escherichia coli H252]
 gi|323955720|gb|EGB51478.1| succinyl-diaminopimelate desuccinylase [Escherichia coli H263]
 gi|324009164|gb|EGB78383.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 57-2]
          Length = 375

 Score =  280 bits (716), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 151/384 (39%), Positives = 224/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF     +  +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDF-----ADTQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P +++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFINELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKH-----QLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|209695800|ref|YP_002263730.1| succinyl-diaminopimelate desuccinylase [Aliivibrio salmonicida
           LFI1238]
 gi|238055205|sp|B6EJS8|DAPE_ALISL RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|208009753|emb|CAQ80059.1| succinyl-diaminopimelate desuccinylase [Aliivibrio salmonicida
           LFI1238]
          Length = 377

 Score =  280 bits (716), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 158/373 (42%), Positives = 219/373 (58%), Gaps = 13/373 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           L+   SVTP+D G   +++  LK LGF+IE   F+        N +AR GTEAP   FAG
Sbjct: 13  LLSRQSVTPEDAGCQELMIKRLKALGFTIEIMVFED-----TTNFWARRGTEAPLFTFAG 67

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGSI 130
           H DVVP G    W   PF  TI +G +Y RG  DMKGS+AC I AV RFI ++ ++ GS+
Sbjct: 68  HTDVVPTGSLTQWNTDPFEPTIIDGMLYARGAADMKGSLACMIVAVERFISEHPEHKGSL 127

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           S LIT DEEGP INGT +++  ++++ E  D CIVGEP+    +GD +K GRRGSL+G +
Sbjct: 128 SFLITSDEEGPFINGTTRVVDTLKERNEIIDMCIVGEPSSTQYVGDVVKNGRRGSLTGNL 187

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
           T+ G QGHVAYPH+  NPI   +  L +LT   +D GN  F PT+ +I  ++ G  + NV
Sbjct: 188 TVKGIQGHVAYPHIARNPIHQSMAALLELTMTEWDLGNAYFPPTSFQIPNMNSGTGASNV 247

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IP   ++ FN RF+    E T+ E ++ R+I+ + +   L + + +     P FLT    
Sbjct: 248 IPGTAEIMFNFRFS---TESTV-EGLQQRVIE-LLDKHNLEYDLDWIINGLP-FLTDTGD 301

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDL 369
           L + +  ++       P L T+GGTSD RFI      VIE G V  T+H +NE   + DL
Sbjct: 302 LLTAVVDAVATVNQQKPELLTTGGTSDGRFIAQMGSQVIELGPVNATIHKVNECVKVDDL 361

Query: 370 EDLTCIYENFLQN 382
           E LT +Y+  L N
Sbjct: 362 EKLTDMYQEVLNN 374


>gi|331653893|ref|ZP_08354894.1| succinyl-diaminopimelate desuccinylase [Escherichia coli M718]
 gi|331048742|gb|EGI20818.1| succinyl-diaminopimelate desuccinylase [Escherichia coli M718]
          Length = 375

 Score =  280 bits (715), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 152/384 (39%), Positives = 223/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI  PS++P D G   +L+  L+ +GF++E  DF     +  +N +A  
Sbjct: 1   MSCPVIELTQQLIHRPSLSPDDAGCQALLIERLQAIGFTVERMDF-----ADTQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKH-----QLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|148360467|ref|YP_001251674.1| N-succinyl-diaminopimelate desuccinylase [Legionella pneumophila
           str. Corby]
 gi|296106466|ref|YP_003618166.1| succinyl-diaminopimelate desuccinylase [Legionella pneumophila
           2300/99 Alcoy]
 gi|238064759|sp|A5IG28|DAPE_LEGPC RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|148282240|gb|ABQ56328.1| N-succinyl-diaminopimelate desuccinylase [Legionella pneumophila
           str. Corby]
 gi|295648367|gb|ADG24214.1| succinyl-diaminopimelate desuccinylase [Legionella pneumophila
           2300/99 Alcoy]
          Length = 377

 Score =  280 bits (715), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 162/385 (42%), Positives = 225/385 (58%), Gaps = 14/385 (3%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D  + L  LI+ PS+TP+D G    ++  L+ LGF+      Q  N   V N +A +G  
Sbjct: 3   DIKQILTDLIRFPSITPEDAGCQKYMIQFLEQLGFTC-----QQLNNGPVSNFFACYGKI 57

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            P L+FAGH DVVP G+ + W   PFS     G +YGRG+ DMKGS+AC +    RFI  
Sbjct: 58  GPLLVFAGHTDVVPVGEVSKWDTDPFSLEEKNGVLYGRGVADMKGSLACMLHMARRFIKT 117

Query: 124 YKNF-GSISLLITGDEEGPAIN-GTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
           Y +F G +  LIT  EEG   N GT  ++  +E++G   D CIVGEP+ +   GD IKIG
Sbjct: 118 YPSFPGRLGFLITSGEEGDEFNLGTPYVMQKLEQQGIVIDYCIVGEPSSSLKAGDIIKIG 177

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSLS +I + GKQGHVAYPHL +NPI  + P+L +LT++ +D GN  F PT+M+IT I
Sbjct: 178 RRGSLSAKIHLSGKQGHVAYPHLADNPIHRISPVLAELTSMQWDNGNAYFPPTSMQITYI 237

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
             G  + N+IP ++ +  N R++    E+T  E +++R+I    +   L+  + +     
Sbjct: 238 HCGGHAGNIIPGELNLHLNFRYS---TEQT-DESLKTRVINAFTH-HNLNPAIEWRLNGE 292

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHAL 360
           P FLT+   L     +++    G +P LSTSGGTSD RFI  Y   VIE GLV  T+H +
Sbjct: 293 P-FLTNKGILLESCKQTVLEHIGTLPELSTSGGTSDGRFIAPYGVEVIELGLVNATIHQV 351

Query: 361 NENASLQDLEDLTCIYENFLQNWFI 385
           NE  SLQDL  L  +Y +  +   I
Sbjct: 352 NECTSLQDLNTLETMYFSICEKLLI 376


>gi|283786095|ref|YP_003365960.1| succinyl-diaminopimelate desuccinylase [Citrobacter rodentium
           ICC168]
 gi|282949549|emb|CBG89165.1| succinyl-diaminopimelate desuccinylase [Citrobacter rodentium
           ICC168]
          Length = 375

 Score =  280 bits (715), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 149/384 (38%), Positives = 224/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF++E  DF     +  +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRAIGFTVERMDF-----ADTQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVPAGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ +  G ++ LIT DEE  A +GT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPDHKGRLAFLITSDEEASAKDGTVKVVEALMARNERLDYCLVGEPSSTEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P+L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMLNELVGIEWDQGNAFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K+ + + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEIIKQRVHALLEK-----HQLRYTVEWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|218710268|ref|YP_002417889.1| succinyl-diaminopimelate desuccinylase [Vibrio splendidus LGP32]
 gi|238055243|sp|B7VIL8|DAPE_VIBSL RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|218323287|emb|CAV19464.1| Succinyl-diaminopimelate desuccinylase [Vibrio splendidus LGP32]
          Length = 378

 Score =  280 bits (715), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 156/376 (41%), Positives = 213/376 (56%), Gaps = 13/376 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            LI   SVTP+D G   +++  LK LGF IE   F+        N +AR GTEAP   FA
Sbjct: 12  DLISRQSVTPEDAGCQDLMIERLKALGFEIEVMVFED-----TTNFWARRGTEAPLFAFA 66

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVP G    W   PF  TI +G ++GRG  DMKGS+A  + AV +FI K+ +  GS
Sbjct: 67  GHTDVVPAGPIEQWNTKPFEPTIIDGFLHGRGAADMKGSLASMVVAVEQFIAKHPDHTGS 126

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I  LIT DEEGP INGT +++  +  +GE  D CIVGEP+    +GD +K GRRGS++G+
Sbjct: 127 IGFLITSDEEGPFINGTVRVVEALMARGENIDMCIVGEPSSTEYVGDVVKNGRRGSITGD 186

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +TI G QGHVAYPHL  NP+   +  +++L    +D GN  F PT+ +I  +  G  + N
Sbjct: 187 LTIKGTQGHVAYPHLANNPVHSSLLAINELATTEWDKGNDYFPPTSFQIPNVSAGTGASN 246

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP +  + FN+RF+   N   + E I + L K         + + ++    P FLT   
Sbjct: 247 VIPGEFNVQFNLRFSTELNNDIIVERITNTLDK-----YDFEYDLKWTFNGDP-FLTDAG 300

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFI-KDYCPVIEFGLVGRTMHALNENASLQD 368
            L   +  ++ +     P L T+GGTSD RFI +    V+E G V  T+H +NE   + D
Sbjct: 301 SLLDAIVDAVGHVNDVKPALLTTGGTSDGRFIARMKGQVVELGPVNATIHKVNECVKVAD 360

Query: 369 LEDLTCIYENFLQNWF 384
           LE LT +YE  L N F
Sbjct: 361 LEKLTDMYERTLVNLF 376


>gi|33596610|ref|NP_884253.1| succinyl-diaminopimelate desuccinylase [Bordetella parapertussis
           12822]
 gi|81427183|sp|Q7W8Y3|DAPE_BORPA RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|33573311|emb|CAE37294.1| succinyl-diaminopimelate desuccinylase [Bordetella parapertussis]
          Length = 379

 Score =  280 bits (715), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 163/389 (41%), Positives = 212/389 (54%), Gaps = 14/389 (3%)

Query: 1   MTPDCLEHLIQ-LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT   +  L++ LI  PSVTP D     +L   L+ +GF  E     T     V NL+AR
Sbjct: 1   MTASAVLDLVKDLIARPSVTPDDVDCQMLLAQRLERIGFQCE-----TIARGGVTNLWAR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            G  AP  +FAGH DVVPPG  + W   PF  T  +G +YGRG  DMK SIA F+ A   
Sbjct: 56  RGAGAPLTVFAGHTDVVPPGPRDKWDSDPFVPTERDGFLYGRGAADMKSSIAAFVVAAEE 115

Query: 120 FIPKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+  + ++ GSI+LLIT DEEGPA++GT  +   + ++GE+ D CIVGEPT    +GD  
Sbjct: 116 FVAAHPEHPGSIALLITSDEEGPAVDGTVIVCDELRQRGEQLDYCIVGEPTSTEALGDVC 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG + + G QGHVAYPHL  NP+  L P L +L  I +D GN  F PT  ++
Sbjct: 176 KNGRRGSLSGRLLVKGVQGHVAYPHLARNPVHQLAPALTELVAIEWDQGNEYFPPTTFQV 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + +  G  + NV+P +    FN RF+       LK  +   L +       L + + +  
Sbjct: 236 SNLHAGTGATNVVPGEAVALFNFRFSTASTPDQLKARVHEVLDRH-----GLEYQLDWEL 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTM 357
              P FLT    LT  L  +I   TG    LST+GGTSD RFI   CP VIEFG    T+
Sbjct: 291 GGEP-FLTPRGSLTDALVSAIQAETGLQAELSTTGGTSDGRFIARICPQVIEFGPCNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFIT 386
           H +NE   L  L  L  IY   L+N  + 
Sbjct: 350 HKVNERIELSSLAPLKNIYRRTLENLLLA 378


>gi|261822405|ref|YP_003260511.1| succinyl-diaminopimelate desuccinylase [Pectobacterium wasabiae
           WPP163]
 gi|261606418|gb|ACX88904.1| succinyl-diaminopimelate desuccinylase [Pectobacterium wasabiae
           WPP163]
          Length = 375

 Score =  279 bits (714), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 147/384 (38%), Positives = 221/384 (57%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLIK PS++P D G   +++  L  +GF++E  DF        +N +A  
Sbjct: 1   MSCPVIELAQQLIKRPSLSPNDEGCQALMIERLTAIGFTVEAMDFGD-----TQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT    L FAGH DVVP GD NHW +PPF   I +G +YGRG  DMKGS+A  + A  RF
Sbjct: 56  GT-GKTLAFAGHTDVVPSGDENHWQHPPFEPIIRDGMLYGRGAADMKGSLAAMVIAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  + N  G ++ L+T DEE  A+NGT K++  +  + E+ D C+VGEP+  H++GD +K
Sbjct: 115 VAAHPNHQGRLAFLMTSDEEASAVNGTVKVVDALMARNERLDYCLVGEPSSTHVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++  + +HG QGHVAYPHL +NP+    P L++L    +D GN  F PT M+I 
Sbjct: 175 NGRRGSITANLRVHGVQGHVAYPHLADNPVHRATPALNELIATEWDQGNEFFPPTTMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    +  +++ +   L +      +L++T+ +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDVLIQQRVAELLDRH-----QLNYTIDWKLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   +L   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGELVDAVVNAVKHYNEVTPELLTNGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            ++E  S  DL+ L+ +Y+  ++ 
Sbjct: 349 KVDECVSAADLQLLSRMYQRIMEQ 372


>gi|88798114|ref|ZP_01113701.1| succinyl-diaminopimelate desuccinylase [Reinekea sp. MED297]
 gi|88779311|gb|EAR10499.1| succinyl-diaminopimelate desuccinylase [Reinekea sp. MED297]
          Length = 378

 Score =  279 bits (714), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 155/384 (40%), Positives = 215/384 (55%), Gaps = 13/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  + L     LIK PSVTP D G   ++ + LK  GF IE    +      V NL+A  
Sbjct: 1   MRSETLTLACDLIKRPSVTPDDQGCQTLMADRLKACGFQIEAMRIED-----VDNLWAVH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G E P L+FAGH DVVP GD + WTYPPF  T  +G +YGRG  DMKGS+A  I A  RF
Sbjct: 56  GQEGPLLVFAGHTDVVPTGDSSAWTYPPFEPTEQDGMLYGRGAADMKGSLAAMIVATERF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  Y +  G +  LIT DEEG A +GT  ++  +  +GE+ D  +VGEP+    +GD IK
Sbjct: 116 VRDYPDHQGRLGYLITSDEEGDAYHGTVAVMERLTARGERIDWAVVGEPSSTDQVGDVIK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS+ G +TI GKQGHVAYPHL +NP+  + P +  L+   +D GN  F  T+ +++
Sbjct: 176 NGRRGSMLGYLTIKGKQGHVAYPHLAKNPVHLVAPAIADLSTEVWDEGNDFFPATSFQVS 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NVIP   ++ F+ RF+     + L++  R+     I +     + + F   
Sbjct: 236 NINSGTGASNVIPGTAEIMFSFRFSTEVTAEELQQRART-----ILDRHGFDYELRFEVK 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT    L     +++   TG  P LST+GGTSD RFI      V+E G V RT+H
Sbjct: 291 GQP-FLTDRGALVQAAVQAVTEVTGQAPELSTAGGTSDGRFIAPTGAQVVELGPVNRTIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            ++E  +  DL+ LT +Y   + N
Sbjct: 350 QIDECVASADLDTLTEMYYGIMVN 373


>gi|319775041|ref|YP_004137529.1| putative succinyl-diaminopimelate desuccinylase [Haemophilus
           influenzae F3047]
 gi|329123051|ref|ZP_08251622.1| succinyl-diaminopimelate desuccinylase [Haemophilus aegyptius ATCC
           11116]
 gi|317449632|emb|CBY85838.1| Putative succinyl-diaminopimelate desuccinylase [Haemophilus
           influenzae F3047]
 gi|327471982|gb|EGF17422.1| succinyl-diaminopimelate desuccinylase [Haemophilus aegyptius ATCC
           11116]
          Length = 377

 Score =  279 bits (714), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 217/373 (58%), Gaps = 13/373 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+ PS++P D G   I+   L+ LGF IE   F   N ++  NL+A+ GT  P + FAG
Sbjct: 12  LIRLPSISPNDEGCQQIIAERLEKLGFQIEWMPF---NDTL--NLWAKHGTSEPVIAFAG 66

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVP GD N W+ PPFSA I +G +YGRG  DMKGS+A  I A   ++    N  G+I
Sbjct: 67  HTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEYVKANPNHKGTI 126

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           +LLIT DEE  A +GT +++  +  + EK   C+VGEP+    +GD +K GRRGS++G +
Sbjct: 127 ALLITSDEEAAAKDGTVRVVETLMARDEKITYCMVGEPSSAKNLGDVVKNGRRGSITGNL 186

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
            I G QGHVAYPHL ENPI    P L +LT   +D GN  F PT+++I  I  G  S NV
Sbjct: 187 YIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDKGNEFFPPTSLQIANIHAGTGSNNV 246

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IPA++ + FN+R+     ++ +K+++   L K       L + + ++    P FLT   K
Sbjct: 247 IPAELYIQFNLRYCTEVTDEIIKQKVAEMLEKH-----NLKYRIEWNLSGKP-FLTKPGK 300

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDL 369
           L   ++ +I  T G  P   T GGTSD RFI      V+EFG +  T+H +NE  S++DL
Sbjct: 301 LLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIHKVNECVSVEDL 360

Query: 370 EDLTCIYENFLQN 382
                IY   L N
Sbjct: 361 GKCGEIYHKMLVN 373


>gi|332533563|ref|ZP_08409425.1| N-succinyl-L,L-diaminopimelate desuccinylase [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332036965|gb|EGI73424.1| N-succinyl-L,L-diaminopimelate desuccinylase [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 376

 Score =  279 bits (714), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 160/384 (41%), Positives = 223/384 (58%), Gaps = 13/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D ++    LI+  SVTP+D G   ++ + L  +GF+IE   F     +   N +AR 
Sbjct: 1   MKDDVIKLAQALIQRESVTPEDAGCQQMMNDRLAAVGFNIESLFF-----TDTLNTWARK 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT++PH  FAGH DVVP G   +W +PPFS  I +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GTQSPHFCFAGHTDVVPTGPEKNWQHPPFSGLIKDGLLHGRGAADMKGSLAAMLVATERF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + K+ +  GSIS LIT DEEGP INGT +++  +E +GEK D C+VGEP+   ++GD +K
Sbjct: 116 VTKHPDHKGSISFLITSDEEGPFINGTTRVIDTLEARGEKIDMCLVGEPSSRDVLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +T+ G QGHVAYPHL +NPI    P L +L+   +D GN  F  T+ +I+
Sbjct: 176 NGRRGSLTAFLTVKGVQGHVAYPHLAQNPIHLATPALTELSQTVWDNGNEYFPATSFQIS 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NVIP ++++ FN RF+     + L+  +   L K   N  +LS  V+    
Sbjct: 236 NINGGTGAGNVIPGELEVQFNFRFSTQVTHEQLQHRVNDILQKHNLNY-ELSWIVN---- 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
               F+T    L     K+I + TG    L T+GGTSD RFI      VIE G    T+H
Sbjct: 291 -GLPFITEHGPLVDATVKAIKSVTGLTTNLETTGGTSDGRFIAQTGAKVIELGPRNETIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            ++E  S  DL  LT IYE  L+ 
Sbjct: 350 KVDECVSTDDLIALTDIYEQILEQ 373


>gi|260856564|ref|YP_003230455.1| N-succinyl-diaminopimelate deacylase [Escherichia coli O26:H11 str.
           11368]
 gi|257755213|dbj|BAI26715.1| N-succinyl-diaminopimelate deacylase [Escherichia coli O26:H11 str.
           11368]
 gi|323156071|gb|EFZ42230.1| succinyl-diaminopimelate desuccinylase [Escherichia coli EPECa14]
          Length = 375

 Score =  279 bits (714), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 151/384 (39%), Positives = 224/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF     +  +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDF-----ADTQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKH-----QLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  +L+ L  +Y+  ++ 
Sbjct: 349 KINECVNAANLQLLARMYQRIMEQ 372


>gi|88859997|ref|ZP_01134636.1| Succinyl-diaminopimelate desuccinylase (SDAP) [Pseudoalteromonas
           tunicata D2]
 gi|88817991|gb|EAR27807.1| Succinyl-diaminopimelate desuccinylase (SDAP) [Pseudoalteromonas
           tunicata D2]
          Length = 377

 Score =  279 bits (713), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 159/373 (42%), Positives = 223/373 (59%), Gaps = 13/373 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+ PSVTP+D G   ++   LK LGFSIEE  F        +N++AR G ++P   FAG
Sbjct: 13  LIQRPSVTPKDEGCQTLMAERLKKLGFSIEELFFVD-----TQNMWARKGQQSPLFCFAG 67

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVP G  N W   PF+AT+ +G ++GRG  DMKGS+A  I A  RFI  + +  GSI
Sbjct: 68  HTDVVPTGPINAWHLDPFAATVQDGYLHGRGAADMKGSLAAMIVATERFITDFPDHKGSI 127

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           + LIT DEEGP INGT +++  +E + EK D C+VGEP+  H +GD +K GRRGSL+G +
Sbjct: 128 AFLITSDEEGPFINGTTRVIDVLEARNEKIDLCLVGEPSSTHQVGDVVKNGRRGSLTGFV 187

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
           T+ G QGHVAYP L +NPI  + P L +L+   +D GN  F  T+ +I+ I  G  + NV
Sbjct: 188 TVKGIQGHVAYPQLAKNPIHLVSPALTELSQTVWDQGNAFFPATSFQISNIQAGTGAGNV 247

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IP ++ + FN RF+    E T+ E+++ R++  I +     + +++     P FLT +  
Sbjct: 248 IPGELDVQFNFRFS---TEVTV-EQLQVRVVS-ILDHYGFDYDINWIINGLP-FLTAEGS 301

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDL 369
           L     K+I         L T+GGTSD RFI      V+E G    T+H +NE  S++DL
Sbjct: 302 LVEATVKAIKQVQHIETSLETTGGTSDGRFIAQTGAQVVELGPCNATIHKVNECVSIEDL 361

Query: 370 EDLTCIYENFLQN 382
           E LT IY + L+ 
Sbjct: 362 ERLTDIYYHILRE 374


>gi|33601165|ref|NP_888725.1| succinyl-diaminopimelate desuccinylase [Bordetella bronchiseptica
           RB50]
 gi|81431247|sp|Q7WKC6|DAPE_BORBR RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|33575600|emb|CAE32678.1| succinyl-diaminopimelate desuccinylase [Bordetella bronchiseptica
           RB50]
          Length = 379

 Score =  279 bits (713), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 163/389 (41%), Positives = 212/389 (54%), Gaps = 14/389 (3%)

Query: 1   MTPDCLEHLIQ-LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT   +  L++ LI  PSVTP D     +L   L+ +GF  E     T     V NL+AR
Sbjct: 1   MTASAVLDLVKDLIARPSVTPDDVDCQMLLAQRLERIGFQCE-----TIARGGVTNLWAR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            G  AP  +FAGH DVVPPG  + W   PF  T  +G +YGRG  DMK SIA F+ A   
Sbjct: 56  RGAGAPLTVFAGHTDVVPPGPRDKWDSDPFVPTERDGFLYGRGAADMKSSIAAFVVAAEE 115

Query: 120 FIPKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+  + ++ GSI+LLIT DEEGPA++GT  +   + ++GE+ D CIVGEPT    +GD  
Sbjct: 116 FVAAHPEHPGSIALLITSDEEGPAVDGTVIVCDELRQRGEQLDYCIVGEPTSTEALGDVC 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG + + G QGHVAYPHL  NP+  L P L +L  I +D GN  F PT  ++
Sbjct: 176 KNGRRGSLSGRLLVKGVQGHVAYPHLARNPVHQLAPALTELVAIEWDQGNEYFPPTTFQV 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + +  G  + NV+P +    FN RF+       LK  +   L +       L + + +  
Sbjct: 236 SNLHAGTGATNVVPGEAVALFNFRFSTASTPGQLKARVHEVLDRH-----GLEYQLDWEL 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTM 357
              P FLT    LT  L  +I   TG    LST+GGTSD RFI   CP VIEFG    T+
Sbjct: 291 GGEP-FLTPRGSLTDALVSAIQAETGLQAELSTTGGTSDGRFIARICPQVIEFGPCNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFIT 386
           H +NE   L  L  L  IY   L+N  + 
Sbjct: 350 HKVNERIELSSLAPLKNIYRRTLENLLLA 378


>gi|317492755|ref|ZP_07951180.1| succinyl-diaminopimelate desuccinylase [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316919278|gb|EFV40612.1| succinyl-diaminopimelate desuccinylase [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 376

 Score =  279 bits (713), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 155/386 (40%), Positives = 228/386 (59%), Gaps = 17/386 (4%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT   LE   QLIKC SV+P+D G   +L+  L+ +GF+IE+  F        +N +A  
Sbjct: 1   MTCPVLELTQQLIKCRSVSPEDAGCQELLIERLQTIGFTIEDMTFGD-----TRNFWAYR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   P L FAGH DVVP GD + WT PP+  T+ +G IYGRG  DMKGS+A  + A  RF
Sbjct: 56  GGNGPTLAFAGHTDVVPSGDESKWTNPPYEPTLRDGMIYGRGAADMKGSLAAMVVAAERF 115

Query: 121 I---PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDT 177
           I   P ++  G ++ LIT DEE  A+NGT K++  +  + EK + C+VGEP+    +GD 
Sbjct: 116 IEANPHHQ--GRLAFLITSDEEASAVNGTVKVVEKLIARQEKVEYCLVGEPSSTEKVGDV 173

Query: 178 IKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNME 237
           +K GRRGS++  + I G QGHVAYPHL +NPI    P++++L N  +D GN  F PT+M+
Sbjct: 174 VKNGRRGSMTANLYIQGVQGHVAYPHLADNPIHKAAPMINELVNEVWDEGNEFFPPTSMQ 233

Query: 238 ITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFS 297
           I  I  G  S NVIP ++ + FN RF+    E T+ + I++R +K + +  +L++++ ++
Sbjct: 234 IANIAAGTGSNNVIPGELYIQFNFRFS---TESTV-DSIKTR-VKALLDRYQLTYSLEWN 288

Query: 298 SPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRT 356
               P FLT    L   +  +I +     P L T+GGTSD RFI      V+E G V  T
Sbjct: 289 VSGLP-FLTARGHLVDAVVNAIQHYGEITPQLLTTGGTSDGRFIAQMGTQVVELGPVNAT 347

Query: 357 MHALNENASLQDLEDLTCIYENFLQN 382
           +H ++E     DL+ L+ +Y+  ++ 
Sbjct: 348 IHKVDECVHAADLQMLSRMYQRIMEQ 373


>gi|145633690|ref|ZP_01789416.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           3655]
 gi|145635499|ref|ZP_01791199.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           PittAA]
 gi|229845494|ref|ZP_04465623.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           6P18H1]
 gi|144985450|gb|EDJ92271.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           3655]
 gi|145267264|gb|EDK07268.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           PittAA]
 gi|229811597|gb|EEP47297.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           6P18H1]
          Length = 377

 Score =  279 bits (713), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 218/373 (58%), Gaps = 13/373 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+ PS++P D G   I+   L+ LGF IE   F   N ++  NL+A+ GT  P + FAG
Sbjct: 12  LIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPF---NDTL--NLWAKHGTGEPVIAFAG 66

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVP GD N W+ PPFSA I +G +YGRG  DMKGS+A  I A   ++    N  G+I
Sbjct: 67  HTDVVPTGDENQWSSPPFSADIIDGMLYGRGAADMKGSLAAMIVAAEEYVKANPNHKGTI 126

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           +LLIT DEE  A +GT +++  +  + EK   C+VGEP+    +GD +K GRRGS++G +
Sbjct: 127 ALLITSDEEAAAKDGTVRVVETLMARDEKITYCMVGEPSSAKNLGDVVKNGRRGSITGNL 186

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
            I G QGHVAYPHL ENPI    P L +LT   +D GN  F PT+++I  I  G  S NV
Sbjct: 187 YIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDKGNEFFPPTSLQIANIHAGTGSNNV 246

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IP ++ + FN+R+     ++ +K+++   L K       L + + ++    P FLT   K
Sbjct: 247 IPGELYIQFNLRYCTEVTDEIIKQKVAEMLEK-----HNLKYRIEWNLSGKP-FLTKPGK 300

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDL 369
           L   ++ +I  TTG +P   T GGTSD RFI      V+EFG +  T+H +NE  S++DL
Sbjct: 301 LLGSITSAIEETTGIMPKAETGGGTSDGRFIALMGAEVVEFGPLNATIHKVNECVSVEDL 360

Query: 370 EDLTCIYENFLQN 382
                IY   L N
Sbjct: 361 GKCGEIYHKMLVN 373


>gi|301168760|emb|CBW28351.1| N-succinyl-diaminopimelate deacylase [Haemophilus influenzae 10810]
          Length = 377

 Score =  279 bits (713), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 217/373 (58%), Gaps = 13/373 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+ PS++P D G   I+   L+ LGF IE   F   N ++  NL+A+ GT  P + FAG
Sbjct: 12  LIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPF---NDTL--NLWAKHGTSEPVIAFAG 66

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVP GD N W+ PPFSA I +G +YGRG  DMKGS+A  I A   ++    N  G+I
Sbjct: 67  HTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEYVKTNPNHKGTI 126

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           +LLIT DEE  A +GT +++  +  + EK   C+VGEP+    +GD +K GRRGS++G +
Sbjct: 127 ALLITSDEEAAAKDGTVRVVETLMARDEKITYCMVGEPSSAKNLGDVVKNGRRGSITGNL 186

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
            I G QGHVAYPHL ENPI    P L +LT   +D GN  F PT+++I  I  G  S NV
Sbjct: 187 YIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDKGNEFFPPTSLQIANIHAGTGSNNV 246

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IPA++ + FN+R+     ++ +K+++   L K       L + + ++    P FLT   K
Sbjct: 247 IPAELYIQFNLRYCTEVTDEIIKQKVAEMLEKH-----NLKYRIEWNLSGKP-FLTKPGK 300

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDL 369
           L   ++ +I  T G  P   T GGTSD RFI      V+EFG +  T+H +NE  S++DL
Sbjct: 301 LLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIHKVNECVSVEDL 360

Query: 370 EDLTCIYENFLQN 382
                IY   L N
Sbjct: 361 GKCGEIYHKMLVN 373


>gi|315126436|ref|YP_004068439.1| succinyl-diaminopimelate desuccinylase [Pseudoalteromonas sp.
           SM9913]
 gi|315014950|gb|ADT68288.1| succinyl-diaminopimelate desuccinylase [Pseudoalteromonas sp.
           SM9913]
          Length = 376

 Score =  279 bits (713), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 222/373 (59%), Gaps = 13/373 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+  SVTP+D G   ++   L  +GF IE   F     +   N +AR GT++PH  FAG
Sbjct: 12  LIQRESVTPEDAGCQHMMNERLSAIGFDIESLFF-----TDTLNTWARKGTQSPHFCFAG 66

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVP G   +W +PPF+  I +G ++GRG  DMKGS+A  I A  RF+ K+ +  GSI
Sbjct: 67  HTDVVPTGPEKNWQHPPFAGLIEDGLLHGRGAADMKGSLAAMIVATERFVTKHPDHKGSI 126

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           S LIT DEEGP INGT +++  +E++GEK D C+VGEP+   ++GD +K GRRGSL+G +
Sbjct: 127 SFLITSDEEGPFINGTTRVIDTLEERGEKIDMCLVGEPSSRDVLGDVVKNGRRGSLTGFL 186

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
           TI G QGHVAYPHL +NPI    P L +L+   +D GN  F  T+ +I+ I+ G  + NV
Sbjct: 187 TIKGVQGHVAYPHLAQNPIHLATPALTELSQTVWDMGNDFFPATSFQISNINGGTGAGNV 246

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IP ++++ FN RF+     + L++++ + L K       L++ +++     P FLT    
Sbjct: 247 IPGELEVQFNFRFSTEVTHQQLQQKVNAILQK-----HNLNYELNWIVNGLP-FLTDHGP 300

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDL 369
           L      +I + TG    L T+GGTSD RFI      VIE G    T+H ++E  S  DL
Sbjct: 301 LVDATVAAIKSVTGLTTNLETTGGTSDGRFIAQTGAKVIELGPRNATIHKVDECVSTDDL 360

Query: 370 EDLTCIYENFLQN 382
             L  IYE  L++
Sbjct: 361 IALADIYEQILEH 373


>gi|212710863|ref|ZP_03318991.1| hypothetical protein PROVALCAL_01931 [Providencia alcalifaciens DSM
           30120]
 gi|212686560|gb|EEB46088.1| hypothetical protein PROVALCAL_01931 [Providencia alcalifaciens DSM
           30120]
          Length = 376

 Score =  279 bits (713), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 153/383 (39%), Positives = 216/383 (56%), Gaps = 13/383 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +E   QLI  PS++P D G   +L+  L  +GF++E+  F         N +A  
Sbjct: 1   MNCPVIELAQQLIARPSISPDDQGCQDLLIERLNNIGFTVEKMPF-----GDTLNFWAHR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPFS TI    +YGRG  DMKGSIA  + A  RF
Sbjct: 56  GNAGKTLAFAGHTDVVPAGDHSKWQTPPFSPTIINQHLYGRGAADMKGSIAAMVVAAERF 115

Query: 121 IPKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + KY  + G ++ LIT DEE  A +GT K++  ++ + E  D C+VGEP+    +GD IK
Sbjct: 116 VEKYPTHTGRLAFLITSDEEAKATHGTVKVVETLQARHESVDYCLVGEPSSQSALGDIIK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++  +TI G QGHVAYPHL +NP+      L +L    +D GN  F  T+M+I 
Sbjct: 176 NGRRGSITAHLTILGTQGHVAYPHLADNPVHRATNFLQELVTTKWDDGNQYFPATSMQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NVIP ++K+ FN RF+    +  ++E +   L +       L++ + +   
Sbjct: 236 NINAGTGADNVIPGELKVQFNFRFSTELTDTIIRERVTDMLER-----HGLAYRLEWFLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT D +L S   ++I+  TG    LSTSGGTSD RFI      VIE G +  T+H
Sbjct: 291 GQP-FLTGDSELVSATVQAIHEVTGRETTLSTSGGTSDGRFIAQMGTHVIELGPLNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQ 381
            ++E  S++DL+ L  IYE  ++
Sbjct: 350 KVDECVSIEDLQQLAVIYERIME 372


>gi|227329727|ref|ZP_03833751.1| succinyl-diaminopimelate desuccinylase [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 375

 Score =  278 bits (712), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 147/384 (38%), Positives = 221/384 (57%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLIK PS++P D G   +++  L  +GF++E  DF        +N +A  
Sbjct: 1   MSCPVIELAQQLIKRPSLSPNDEGCQALMIERLTAIGFTVEAMDFGD-----TQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT    L FAGH DVVP GD +HW +PPF   I +G +YGRG  DMKGS+A  + A  RF
Sbjct: 56  GT-GKTLAFAGHTDVVPSGDESHWQHPPFEPIIRDGMLYGRGAADMKGSLAAMVIAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  + N  G ++ LIT DEE  A+NGT K++  +  + E+ D C+VGEP+  H++GD +K
Sbjct: 115 VAAHPNHQGRLAFLITSDEEASAVNGTVKVVEALMARNERLDYCLVGEPSSTHVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++  + +HG QGHVAYPHL +NP+    P L++L    +D GN  F PT M+I 
Sbjct: 175 NGRRGSITANLRVHGVQGHVAYPHLADNPVHRAAPALNELIATEWDQGNDFFPPTTMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    +  +++ +   L +      +L++T+ +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDVLIQQRVAELLDRH-----QLNYTIDWKLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   +L   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGELVDAVVNAVKHYNEVTPELLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            ++E  S  DL+ L+ +Y+  ++ 
Sbjct: 349 KVDECVSAADLQLLSRMYQRIMEQ 372


>gi|260776510|ref|ZP_05885405.1| N-succinyl-L,L-diaminopimelate desuccinylase [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260607733|gb|EEX33998.1| N-succinyl-L,L-diaminopimelate desuccinylase [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 377

 Score =  278 bits (712), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 152/374 (40%), Positives = 214/374 (57%), Gaps = 13/374 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            LI   SVTP D G   +++  LK LGF IE   F+        N +AR GTEAP   FA
Sbjct: 12  DLISRQSVTPVDAGCQDVMIERLKALGFEIEVMVFEDTT-----NFWARRGTEAPLFAFA 66

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVP G+   W  PPF  T+ +G ++GRG  DMKGS+A  I AV +FI ++ +  GS
Sbjct: 67  GHTDVVPAGNVELWDTPPFEPTMVDGYLHGRGAADMKGSLASMIVAVEQFIAEHPDHKGS 126

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I  LIT DEEGP INGT +++  +  + E  D CIVGEP+   ++GD +K GRRGS++G+
Sbjct: 127 IGFLITSDEEGPFINGTVRVVETLMARDENIDMCIVGEPSSTELVGDVVKNGRRGSITGD 186

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +T+ G QGHVAYPHL +NP+   +  +H+L +  +D GN  F PT+ +I  +  G  + N
Sbjct: 187 LTVKGVQGHVAYPHLAKNPVHQSLMAIHELASTEWDKGNDYFPPTSFQIPNVHAGTGASN 246

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP +  + FN+RF+   N   + + +   L K       L + + ++    P FLT   
Sbjct: 247 VIPGEFNVQFNLRFSTELNNDIIVKRVTDTLDKH-----DLDYELKWTFNGDP-FLTDTG 300

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQD 368
            L   +  ++       P L T+GGTSD RFI      V+E G V  T+H +NE   + D
Sbjct: 301 ALLDAVVDAVDTVNQTKPALLTTGGTSDGRFIARMGGQVVELGPVNATIHKVNECVKVDD 360

Query: 369 LEDLTCIYENFLQN 382
           LE LT +Y+  L+N
Sbjct: 361 LEKLTKMYQKTLEN 374


>gi|288940163|ref|YP_003442403.1| succinyl-diaminopimelate desuccinylase [Allochromatium vinosum DSM
           180]
 gi|288895535|gb|ADC61371.1| succinyl-diaminopimelate desuccinylase [Allochromatium vinosum DSM
           180]
          Length = 378

 Score =  278 bits (712), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 154/387 (39%), Positives = 226/387 (58%), Gaps = 14/387 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+P  LE   +L++ PSVTP+D G   ++   L  +GF++E   F       V NL+AR 
Sbjct: 1   MSP-TLELACELVRRPSVTPEDQGCQELIAERLAAIGFTVEPMPFGE-----VTNLWARR 54

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G+E P L  AGH DVVP G  + W   PF   I +G ++GRG  DMKGS+A  + AV  F
Sbjct: 55  GSEGPLLCLAGHTDVVPAGPLDLWDSDPFDPVIRDGMLHGRGAADMKGSVAAMVTAVESF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  + +  GS++ L+T DEEGPA+NGT K++  ++++GE  D  +VGEP+    +GD+IK
Sbjct: 115 VAAHPDHPGSLAFLLTSDEEGPAVNGTAKVIERLQQRGEHIDYALVGEPSSREQLGDSIK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSLSG +TIHGKQGHVAYPHL +NP       L  L  + +D GN  F PT+ +I 
Sbjct: 175 NGRRGSLSGFLTIHGKQGHVAYPHLAKNPFHAAADALAALCAVVWDQGNAYFPPTSFQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            +++G  ++NVIP Q++  FN+RF+   + +T+K  +R+ L +G        + + +   
Sbjct: 235 NLNMGTGAENVIPGQLEAQFNLRFSTELDPETIKRRVRAILDQG-----DFDYELSWRLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   +L      +I    G    LSTSGGTSD RFI      V+E G +  T+H
Sbjct: 290 GHP-FLTTPGELVDAARSAIREVCGIETELSTSGGTSDGRFIAPTGAQVLELGPLNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            ++E  ++ DL+ L  IY   ++   +
Sbjct: 349 QVDECVAVADLDQLHRIYGRMIERLLL 375


>gi|260548887|ref|ZP_05823109.1| succinyl-diaminopimelate desuccinylase [Acinetobacter sp. RUH2624]
 gi|260408055|gb|EEX01526.1| succinyl-diaminopimelate desuccinylase [Acinetobacter sp. RUH2624]
          Length = 377

 Score =  278 bits (712), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 158/369 (42%), Positives = 215/369 (58%), Gaps = 13/369 (3%)

Query: 16  PSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDV 75
           PSVTP D     I+ + L   GF IE   F       V NL+AR GTE P   FAGH DV
Sbjct: 17  PSVTPVDHTCQTIMADRLAKAGFHIEPMRFGD-----VDNLWARRGTEGPVFCFAGHTDV 71

Query: 76  VPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSISLLI 134
           VP G  + W   PF+  I +GK+YGRG  DMK ++A  + A  RF+ K+ N  GSI+ LI
Sbjct: 72  VPTGRLDAWNSDPFAPEIRDGKLYGRGSADMKTALAAMVVASERFVVKHPNHKGSIAFLI 131

Query: 135 TGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHG 194
           T DEEGPA+NGT K++  +E++ EK   C+VGEP+    +GD +K GRRGSL+G + +HG
Sbjct: 132 TSDEEGPAVNGTVKVIETLEERNEKITWCLVGEPSSTSKLGDIVKNGRRGSLNGVLHVHG 191

Query: 195 KQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQ 254
           KQGHVAYPHL  NPI      L +L    +D GN  F  T+ +I+ I  G  + NVIP  
Sbjct: 192 KQGHVAYPHLARNPIHEASAALAELCQTVWDNGNEYFPATSFQISNIHSGTGATNVIPGT 251

Query: 255 VKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSL 314
           ++++FN R++     + LK+ +   L K       L + + ++    P FLT   +L + 
Sbjct: 252 LEVTFNFRYSTEVTAEQLKQRVHEILDK-----HGLQYEIDWNLSGLP-FLTPVGELVNA 305

Query: 315 LSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDLEDLT 373
              +I N TG    LSTSGGTSD RFI      V+E G++  T+H +NE+  + DL+ LT
Sbjct: 306 AQTAILNVTGTETELSTSGGTSDGRFIAPTGAQVLELGVLNATIHQINEHVDVHDLDPLT 365

Query: 374 CIYENFLQN 382
            IYE  L+N
Sbjct: 366 DIYEQILEN 374


>gi|145629016|ref|ZP_01784815.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           22.1-21]
 gi|144978519|gb|EDJ88242.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           22.1-21]
          Length = 377

 Score =  278 bits (712), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 158/373 (42%), Positives = 216/373 (57%), Gaps = 13/373 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+ PS++P D G   I+   L+ LGF IE   F   N ++  NL+A+ GT  P + FAG
Sbjct: 12  LIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPF---NDTL--NLWAKHGTSEPVIAFAG 66

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVP GD N W+ PPFSA I +G +YGRG  DMKGS+A  I A   ++    N  G+I
Sbjct: 67  HTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEYVKANPNHKGTI 126

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           +LLIT DEE  A +GT +++  +  + EK   C+VGEP+    +GD +K GRRGS++G +
Sbjct: 127 ALLITSDEEAAAKDGTIRVVETLMTRDEKITYCMVGEPSSAKNLGDVVKNGRRGSITGNL 186

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
            I G QGHVAYPHL ENPI    P L +LT   +D GN  F PTN++I  I  G  S NV
Sbjct: 187 YIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDKGNEFFPPTNLQIANIHAGTGSNNV 246

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IPA++ + FN+R+        + +EI  + + G+     L + + ++    P FLT   K
Sbjct: 247 IPAELYIQFNLRYC-----TEVTDEIIKQKVAGMLEKHNLKYRIEWNLSGKP-FLTKPGK 300

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDL 369
           L   ++ +I  T G  P   T GGTSD RFI      V+EFG +  T+H +NE  S++DL
Sbjct: 301 LLDSITFAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIHKVNECVSVEDL 360

Query: 370 EDLTCIYENFLQN 382
                IY   L N
Sbjct: 361 GKCGEIYHKMLVN 373


>gi|317049081|ref|YP_004116729.1| succinyl-diaminopimelate desuccinylase [Pantoea sp. At-9b]
 gi|316950698|gb|ADU70173.1| succinyl-diaminopimelate desuccinylase [Pantoea sp. At-9b]
          Length = 375

 Score =  278 bits (712), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 146/380 (38%), Positives = 219/380 (57%), Gaps = 14/380 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            +E   QLI+ PS++P D G   +L+  L+ +GF +E       +     N +A  G + 
Sbjct: 5   VIELAQQLIRRPSLSPDDAGCQALLIARLEAIGFQVE-----PMHIGDTLNFWATRG-QG 58

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
             L FAGH DVVPPGD N W  PPF  TI +G ++GRG  DMKGS+A  + A  RF+  +
Sbjct: 59  ETLAFAGHTDVVPPGDANRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERFVAAH 118

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
            N  G ++ LIT DEE  A+NGT K++  +  + E+ D C+VGEP+   ++GD +K GRR
Sbjct: 119 PNHQGRLAFLITSDEEASAVNGTVKVVERLMARNERMDYCLVGEPSSTEVVGDVVKNGRR 178

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++  +TIHG QGHVAYPHL +NP+   +P L++L    +D GN  F PT+M+I  +  
Sbjct: 179 GSITANLTIHGVQGHVAYPHLADNPVHRAMPALNELVATEWDQGNEFFPPTSMQIANVKA 238

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  S NVIP +  + FN RF+    ++ ++E + + L +      +L +T+ ++    P 
Sbjct: 239 GTGSNNVIPGEFFVQFNFRFSTELTDQMIRERVAALLDRH-----QLRYTLEWNLSGQP- 292

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNE 362
           FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H +NE
Sbjct: 293 FLTSRGKLVDAVVNAVAHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIHKINE 352

Query: 363 NASLQDLEDLTCIYENFLQN 382
                DL+ L+ +Y+  ++ 
Sbjct: 353 CVKASDLQMLSRMYQRIMEQ 372


>gi|50120230|ref|YP_049397.1| succinyl-diaminopimelate desuccinylase [Pectobacterium atrosepticum
           SCRI1043]
 gi|81645771|sp|Q6D7N4|DAPE_ERWCT RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|49610756|emb|CAG74201.1| succinyl-diaminopimelate desuccinylase [Pectobacterium atrosepticum
           SCRI1043]
          Length = 375

 Score =  278 bits (712), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 147/384 (38%), Positives = 221/384 (57%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLIK PS++P D G   +++  L  +GF++E  DF        +N +A  
Sbjct: 1   MSCPVIELAQQLIKRPSLSPNDEGCQALMIERLTAIGFTVEAMDFGD-----TQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT    L FAGH DVVP GD +HW +PPF   I +G +YGRG  DMKGS+A  + A  RF
Sbjct: 56  GT-GKTLAFAGHTDVVPSGDESHWQHPPFEPIIRDGMLYGRGAADMKGSLAAMVIAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  + N  G ++ LIT DEE  A+NGT K++  +  + E+ D C+VGEP+  H++GD +K
Sbjct: 115 VAAHPNHQGRLAFLITSDEEASAVNGTVKVVDALMARNERLDYCLVGEPSSTHVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++  + IHG QGHVAYPHL +NP+    P L++L    +D GN  F PT M+I 
Sbjct: 175 NGRRGSITANLRIHGMQGHVAYPHLADNPVHRAAPALNELIATEWDRGNDFFPPTTMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    +  +++ +   L +      +L++T+ +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDVLIQQRVAELLDR-----HQLNYTIDWKLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   +L   +  ++ +     P L T+GGTSD RFI      V+E G +  T+H
Sbjct: 290 GQP-FLTARGELVDAVVNAVKHYNEVTPELLTNGGTSDGRFIARMGAQVVELGPINATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            ++E  S  DL+ L+ +Y+  ++ 
Sbjct: 349 KVDECVSAADLQLLSRMYQRIMEQ 372


>gi|300717907|ref|YP_003742710.1| N-succinyl-diaminopimelate deacylase [Erwinia billingiae Eb661]
 gi|299063743|emb|CAX60863.1| N-succinyl-diaminopimelate deacylase [Erwinia billingiae Eb661]
          Length = 375

 Score =  278 bits (712), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 151/379 (39%), Positives = 218/379 (57%), Gaps = 14/379 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           +E   QLI+ PS++P D G   IL+  LK LGF+IE       N     N++A  G +  
Sbjct: 6   IELTQQLIRRPSLSPDDAGCQAILIERLKALGFTIE-----PMNIGDTLNVWAWRG-QGE 59

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            L FAGH DVVP GD + W  PPF  TI +G +YGRG  DMKGS+A  I A  RF+    
Sbjct: 60  TLAFAGHTDVVPTGDASRWINPPFEPTIRDGMLYGRGAADMKGSLAAMIVAAERFVTSNP 119

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   I+GD +K GRRG
Sbjct: 120 NHKGRLAFLITSDEEASATNGTVKVVEALMARKERMDYCLVGEPSSTEIVGDVVKNGRRG 179

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           S++  +T+HG QGHVAYPHL +NP+   +P L++L    +D GN  F PT+M+I  +  G
Sbjct: 180 SMTANLTVHGVQGHVAYPHLADNPVHRALPALNELVATEWDQGNEFFPPTSMQIANVQAG 239

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
             S NVIP +  + FN RF+    +  +K++++  L +      +L +T+ ++    P F
Sbjct: 240 TGSNNVIPGECFVQFNFRFSTELTDAMIKQKVQELLDRH-----QLRYTLEWNVSGQP-F 293

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNEN 363
           LT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H +NE 
Sbjct: 294 LTSRGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIHKINEC 353

Query: 364 ASLQDLEDLTCIYENFLQN 382
               DL+ L+ +Y+  ++ 
Sbjct: 354 VKAADLQLLSRMYQRIMEQ 372


>gi|257095183|ref|YP_003168824.1| succinyl-diaminopimelate desuccinylase [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257047707|gb|ACV36895.1| succinyl-diaminopimelate desuccinylase [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 388

 Score =  278 bits (712), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 159/374 (42%), Positives = 213/374 (56%), Gaps = 13/374 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           QLI C S+TP DGG   I+V  L+ LGF   + DF   N + V NL+AR G++ P L  A
Sbjct: 20  QLIACRSLTPDDGGCLPIIVRRLEALGF---QCDFM--NRAGVTNLWARRGSQRPLLCLA 74

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVP G  + W   PF     +G +YGRG  DMKGS+A F+ A   F+    +  GS
Sbjct: 75  GHTDVVPSGPLDEWHSDPFRPVRRDGVLYGRGAADMKGSLAAFVTAAEDFVAARPDHRGS 134

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           ++ L+T DEEG AI+GT  +   + ++GE  D CIVGEPT    +GD IK GRRGSLSG+
Sbjct: 135 LAFLLTSDEEGDAIDGTVVVTDALRQRGETIDYCIVGEPTAVDTLGDMIKNGRRGSLSGK 194

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +TI G QGH+AYPHL +NPI    P + +L    +D GN  F PT  +++ I  G  + N
Sbjct: 195 LTIKGIQGHIAYPHLAKNPIHLAAPAIAELAQTVWDRGNAFFPPTTWQVSNIHAGTGAGN 254

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP  V + FN RF       +  EE+++RL   ++    L + + ++    P    H  
Sbjct: 255 VIPGSVDIDFNFRF----ATASTPEELQARLCALLER-HGLDYDIVWTLGARPFLTGHGA 309

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMHALNENASLQD 368
            L + L+ +I   TG    LST+GGTSD RFI + CP VIE G V  T+H +NE   L  
Sbjct: 310 LLDASLA-AIRAETGIEAELSTAGGTSDGRFIAEICPQVIEIGPVNATIHKVNECVDLVA 368

Query: 369 LEDLTCIYENFLQN 382
           L  L  IY   L+ 
Sbjct: 369 LPQLAAIYRRILEQ 382


>gi|296104106|ref|YP_003614252.1| succinyl-diaminopimelate desuccinylase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295058565|gb|ADF63303.1| succinyl-diaminopimelate desuccinylase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 375

 Score =  278 bits (711), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 151/384 (39%), Positives = 222/384 (57%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF++E  DF        +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRAIGFTVERMDFGD-----TQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVPAGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N    ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHKNRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSTEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P+L +L +I +D GN  F PT+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMLSELVSIEWDKGNEFFPPTSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            +  G  S NVIP    + FN RF    + +   E I++R+I  ++   +L +TV +   
Sbjct: 235 NVKAGTGSNNVIPGDCFVQFNFRF----STELTDEMIKARVIALLEKY-QLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTQRGKLVDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|227114402|ref|ZP_03828058.1| succinyl-diaminopimelate desuccinylase [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 375

 Score =  278 bits (711), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 147/384 (38%), Positives = 221/384 (57%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLIK PS++P D G   +++  L  +GF++E  DF        +N +A  
Sbjct: 1   MSCPVIELAQQLIKRPSLSPNDEGCQALMIERLTAIGFTVEAMDFGD-----TQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT    L FAGH DVVP GD +HW +PPF   I +G +YGRG  DMKGS+A  + A  RF
Sbjct: 56  GT-GKTLAFAGHTDVVPSGDESHWQHPPFEPIIRDGMLYGRGAADMKGSLAAMVIAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  + N  G ++ LIT DEE  A+NGT K++  +  + E+ D C+VGEP+  H++GD +K
Sbjct: 115 VAAHPNHQGRLAFLITSDEEASAVNGTVKVVEALMARNERLDFCLVGEPSSTHVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++  + +HG QGHVAYPHL +NP+    P L++L    +D GN  F PT M+I 
Sbjct: 175 NGRRGSITANLRVHGVQGHVAYPHLADNPVHRAAPALNELIATEWDQGNDFFPPTTMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    +  +++ +   L +      +L++T+ +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDVLIQQRVAELLDRH-----QLNYTIDWKLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   +L   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGELVDAVVNAVKHYNEVTPELLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            ++E  S  DL+ L+ +Y+  ++ 
Sbjct: 349 KVDECVSAADLQLLSRMYQRIMEQ 372


>gi|16765803|ref|NP_461418.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|161502366|ref|YP_001569478.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|161612767|ref|YP_001586732.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167991788|ref|ZP_02572887.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168238211|ref|ZP_02663269.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168243256|ref|ZP_02668188.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168261482|ref|ZP_02683455.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|194446769|ref|YP_002041742.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194450617|ref|YP_002046546.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194733983|ref|YP_002115545.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197262106|ref|ZP_03162180.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|198245701|ref|YP_002216550.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|205353586|ref|YP_002227387.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207857894|ref|YP_002244545.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|81522296|sp|Q8ZN75|DAPE_SALTY RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName: Full=Aspartyl peptidase;
           AltName: Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238055209|sp|B5FQH3|DAPE_SALDC RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238055210|sp|B5R4J0|DAPE_SALEP RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238055211|sp|B5RCV3|DAPE_SALG2 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238055212|sp|B4TD58|DAPE_SALHS RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238055213|sp|B4T0L0|DAPE_SALNS RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238055214|sp|A9N2Z9|DAPE_SALPB RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238055216|sp|B4TR55|DAPE_SALSV RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064816|sp|A9MHQ8|DAPE_SALAR RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|16421025|gb|AAL21377.1| N-succinyl-diaminopimelate deacylase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|160863713|gb|ABX20336.1| hypothetical protein SARI_00399 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|161362131|gb|ABX65899.1| hypothetical protein SPAB_00466 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194405432|gb|ACF65654.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194408921|gb|ACF69140.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194709485|gb|ACF88706.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197240361|gb|EDY22981.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197288943|gb|EDY28316.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|197940217|gb|ACH77550.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|205273367|emb|CAR38339.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205329839|gb|EDZ16603.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205337585|gb|EDZ24349.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205349336|gb|EDZ35967.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|206709697|emb|CAR34047.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|261247683|emb|CBG25510.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267994593|gb|ACY89478.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301159035|emb|CBW18548.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312913471|dbj|BAJ37445.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|320086975|emb|CBY96745.1| N-succinyl-diaminopimelate deacylase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|321222815|gb|EFX47886.1| N-succinyl-L,L-diaminopimelate desuccinylase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. TN061786]
 gi|322613778|gb|EFY10717.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322619479|gb|EFY16355.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322624984|gb|EFY21813.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322629573|gb|EFY26349.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322633997|gb|EFY30734.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322635565|gb|EFY32276.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322644381|gb|EFY40922.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322652092|gb|EFY48454.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322655255|gb|EFY51564.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322658302|gb|EFY54568.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322664302|gb|EFY60499.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322669470|gb|EFY65619.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322673197|gb|EFY69303.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322676588|gb|EFY72656.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322683339|gb|EFY79353.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322685775|gb|EFY81768.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323130813|gb|ADX18243.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323192547|gb|EFZ77776.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323199593|gb|EFZ84684.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323201249|gb|EFZ86317.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323208079|gb|EFZ93024.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323210198|gb|EFZ95099.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323217064|gb|EGA01786.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323220597|gb|EGA05046.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323225483|gb|EGA09714.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323229247|gb|EGA13371.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323235438|gb|EGA19522.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323237376|gb|EGA21439.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323245131|gb|EGA29132.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323248834|gb|EGA32760.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323253121|gb|EGA36953.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323255920|gb|EGA39665.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323260962|gb|EGA44559.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323266398|gb|EGA49886.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323269771|gb|EGA53221.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326624305|gb|EGE30650.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326628683|gb|EGE35026.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
 gi|332989411|gb|AEF08394.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 375

 Score =  278 bits (711), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 152/384 (39%), Positives = 221/384 (57%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF+IE  DF        +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRKIGFTIEHMDFGD-----TQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-RGETLAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ +  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   I+GD +K
Sbjct: 115 VAQHPHHRGRLAFLITSDEEASAKNGTVKVVEALMARNERLDYCLVGEPSSTEIVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M++ 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDRGNDFFPATSMQVA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +KE + + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKERVHALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|68248712|ref|YP_247824.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           86-028NP]
 gi|229847068|ref|ZP_04467174.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           7P49H1]
 gi|81336873|sp|Q4QP83|DAPE_HAEI8 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|68056911|gb|AAX87164.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           86-028NP]
 gi|229810152|gb|EEP45872.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           7P49H1]
          Length = 377

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 217/373 (58%), Gaps = 13/373 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+ PS++P D G   I+   L+ LGF IE   F   N ++  NL+A+ GT  P + FAG
Sbjct: 12  LIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPF---NDTL--NLWAKHGTSEPVIAFAG 66

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVP GD N W+ PPFSA I +G +YGRG  DMKGS+A  I A   ++    N  G+I
Sbjct: 67  HTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEYVKANPNHKGTI 126

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           +LLIT DEE  A +GT +++  +  + EK   C+VGEP+    +GD +K GRRGS++G +
Sbjct: 127 ALLITSDEEAAAKDGTIRVVETLMARDEKITYCMVGEPSSAKNLGDVVKNGRRGSITGNL 186

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
            I G QGHVAYPHL ENPI    P L +LT   +D GN  F PT+++I  I  G  S NV
Sbjct: 187 YIKGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDKGNEFFPPTSLQIANIHAGTGSNNV 246

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IPA++ + FN+R+     ++ +K+++   L K       L + + ++    P FLT   K
Sbjct: 247 IPAELYIQFNLRYCTEVTDEIIKQKVAEMLEKH-----NLKYRIEWNLSGKP-FLTKPGK 300

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDL 369
           L   ++ +I  T G  P   T GGTSD RFI      V+EFG +  T+H +NE  S++DL
Sbjct: 301 LLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIHKVNECVSIEDL 360

Query: 370 EDLTCIYENFLQN 382
                IY   L N
Sbjct: 361 GKCGEIYHKMLVN 373


>gi|254448798|ref|ZP_05062255.1| succinyl-diaminopimelate desuccinylase [gamma proteobacterium
           HTCC5015]
 gi|198261639|gb|EDY85927.1| succinyl-diaminopimelate desuccinylase [gamma proteobacterium
           HTCC5015]
          Length = 376

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 156/381 (40%), Positives = 220/381 (57%), Gaps = 13/381 (3%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           + LE    LI+  S+TP D G   +++  L+ +GF +E   F       V N +AR G  
Sbjct: 3   NTLELAQALIQRRSITPDDAGCQDLMIQRLEAIGFQVERLRF-----GDVDNFWARRGQS 57

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            P   FAGH DVVP G  + WT+PPF A +A+G+++GRG  DMKGS+A  I A   F+  
Sbjct: 58  GPLFCFAGHTDVVPTGPESEWTHPPFEAVVADGQLHGRGAADMKGSLAAMIVACENFVAA 117

Query: 124 YKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
           + +  GSI+ LIT DEEGPA NGT K++ W+E++ E  D C+VGEP+    +GD IK GR
Sbjct: 118 HPDHKGSIAFLITSDEEGPADNGTVKVMEWLEQRQEAIDYCLVGEPSSTDRVGDIIKNGR 177

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSL   +T+ G QGHVAYPHL  NP+    P L +L    +D GN  F  T+ +++ I 
Sbjct: 178 RGSLGCVLTVKGIQGHVAYPHLARNPVHQAAPALAELAATQWDNGNDHFPATSFQVSNIQ 237

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
            G  + NVIP   ++ FN RF+   NE  L++   + L K       L +T+ +     P
Sbjct: 238 AGTGATNVIPGHCEVVFNFRFSTETNEADLRQRTEAILDK-----HGLEYTIDWKLSGHP 292

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMHALN 361
            FLT + +L     K+I NTTG    LST+GGTSD RFI      V+E G V  T+H ++
Sbjct: 293 -FLTAEGELVEAAQKAILNTTGKPTQLSTAGGTSDGRFIAPSGAQVVELGPVNATIHQVD 351

Query: 362 ENASLQDLEDLTCIYENFLQN 382
           E+ +  +L+ L  IY + L++
Sbjct: 352 EHTNAAELDTLERIYTDTLKH 372


>gi|33592831|ref|NP_880475.1| succinyl-diaminopimelate desuccinylase [Bordetella pertussis Tohama
           I]
 gi|81425091|sp|Q7VXJ5|DAPE_BORPE RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|33572479|emb|CAE42050.1| succinyl-diaminopimelate desuccinylase [Bordetella pertussis Tohama
           I]
 gi|332382244|gb|AEE67091.1| succinyl-diaminopimelate desuccinylase [Bordetella pertussis CS]
          Length = 379

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 163/389 (41%), Positives = 212/389 (54%), Gaps = 14/389 (3%)

Query: 1   MTPDCLEHLIQ-LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT   +  L++ LI  PSVTP D     +L   L+ +GF  E     T     V NL+AR
Sbjct: 1   MTASAVLDLVKDLIARPSVTPDDVDCQMLLAQRLERIGFQCE-----TIARGGVTNLWAR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            G  AP  +FAGH DVVPPG  + W   PF  T  +G +YGRG  DMK SIA F+ A   
Sbjct: 56  RGAGAPLTVFAGHTDVVPPGPRDKWDSDPFVPTERDGFLYGRGAADMKSSIAAFVVAAEE 115

Query: 120 FIPKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+  + ++ GSI+LLIT DEEGPA++GT  +   + ++GE+ D CIVGEPT    +GD  
Sbjct: 116 FVAVHPEHPGSIALLITSDEEGPAVDGTVIVCDELRQRGEQLDYCIVGEPTSTEALGDVC 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG + + G QGHVAYPHL  NP+  L P L +L  I +D GN  F PT  ++
Sbjct: 176 KNGRRGSLSGRLLVKGVQGHVAYPHLARNPVHQLAPALTELVAIEWDQGNEYFPPTTFQV 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + +  G  + NV+P +    FN RF+       LK  +   L +       L + + +  
Sbjct: 236 SNLHAGTGATNVVPGEAVALFNFRFSTASTPGQLKARVHEVLDRH-----GLEYQLDWEL 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTM 357
              P FLT    LT  L  +I   TG    LST+GGTSD RFI   CP VIEFG    T+
Sbjct: 291 GGEP-FLTPRGSLTDALVSAIQAETGLQAELSTTGGTSDGRFIARICPQVIEFGPCNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFIT 386
           H +NE   L  L  L  IY   L+N  + 
Sbjct: 350 HKVNERIELSSLAPLKNIYRRTLENLLLA 378


>gi|262281171|ref|ZP_06058953.1| succinyl-diaminopimelate desuccinylase [Acinetobacter calcoaceticus
           RUH2202]
 gi|262257402|gb|EEY76138.1| succinyl-diaminopimelate desuccinylase [Acinetobacter calcoaceticus
           RUH2202]
          Length = 377

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 157/369 (42%), Positives = 215/369 (58%), Gaps = 13/369 (3%)

Query: 16  PSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDV 75
           PSVTP D     I+ + L  +GF IE   F       V NL+AR GTE P   FAGH DV
Sbjct: 17  PSVTPIDHTCQTIMADRLSQVGFHIEPMRFGE-----VDNLWARRGTEEPVFCFAGHTDV 71

Query: 76  VPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSISLLI 134
           VP G    W   PF+  I +GK+YGRG  DMK ++A  + A  RF+ K+ +  GSI+ LI
Sbjct: 72  VPTGKLEAWNSDPFAPEIRDGKLYGRGSADMKTALAAMVVASERFVAKHPDHKGSIAFLI 131

Query: 135 TGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHG 194
           T DEEGPA+NGT K++  +E++ EK   C+VGEP+  H +GD +K GRRGSL+  + + G
Sbjct: 132 TSDEEGPAVNGTVKVIETLEERNEKIKWCLVGEPSSTHKLGDIVKNGRRGSLNAVLKVQG 191

Query: 195 KQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQ 254
           KQGHVAYPHL  NPI    P L +L    +D GN  F  T+ +I+ I  G  + NVIP  
Sbjct: 192 KQGHVAYPHLALNPIHEASPALTELCQSVWDNGNEYFPATSFQISNIHAGTGATNVIPGT 251

Query: 255 VKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSL 314
           ++++FN R++     + LK+ +   L K       L + + ++    P FLT   +L + 
Sbjct: 252 LEVTFNFRYSTEVTAEQLKQRVHEILDKH-----GLQYEIVWNLSGLP-FLTPVGELVNA 305

Query: 315 LSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDLEDLT 373
              +I N TG    LSTSGGTSD RFI      V+E G++  T+H +NE+  + DL+ LT
Sbjct: 306 AQTAILNVTGTETELSTSGGTSDGRFIAPTGAQVLELGVLNATIHQINEHVDVHDLDPLT 365

Query: 374 CIYENFLQN 382
            IYE  L+N
Sbjct: 366 DIYEQILEN 374


>gi|323977351|gb|EGB72437.1| succinyl-diaminopimelate desuccinylase [Escherichia coli TW10509]
          Length = 375

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 151/384 (39%), Positives = 223/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF     +  +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDF-----ADTQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVV PGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVSPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|168817766|ref|ZP_02829766.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205344997|gb|EDZ31761.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
          Length = 375

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 152/384 (39%), Positives = 221/384 (57%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF+IE  DF        +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRKIGFTIEHMDFGD-----TQNFWAWS 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-RGETLAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ +  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   I+GD +K
Sbjct: 115 VAQHPHHRGRLAFLITSDEEASAKNGTVKVVEALMARNERLDYCLVGEPSSTEIVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M++ 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDRGNDFFPATSMQVA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +KE + + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKERVHALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|309750482|gb|ADO80466.1| N-succinyl-diaminopimelate deacylase [Haemophilus influenzae R2866]
          Length = 377

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 217/373 (58%), Gaps = 13/373 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+ PS++P D G   I+   L+ LGF IE   F   N ++  NL+A+ GT  P + FAG
Sbjct: 12  LIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPF---NDTL--NLWAKHGTSEPVIAFAG 66

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVP GD N W+ PPFSA I +G +YGRG  DMKGS+A  I A   ++    N  G+I
Sbjct: 67  HTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEYVKANPNHKGTI 126

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           +LLIT DEE  A +GT +++  +  + EK   C+VGEP+    +GD +K GRRGS++G +
Sbjct: 127 ALLITSDEEAAAKDGTIRVVETLMTRDEKITYCMVGEPSSAKNLGDVVKNGRRGSITGNL 186

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
            I G QGHVAYPHL ENPI    P L +LT   +D GN  F PT+++I  I  G  S NV
Sbjct: 187 YIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDKGNEFFPPTSLQIANIHAGTGSNNV 246

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IPA++ + FN+R+     ++ +K+++   L K       L + + ++    P FLT   K
Sbjct: 247 IPAELYIQFNLRYCTEVTDEIIKQKVAGMLEK-----HNLKYRIEWNLSGKP-FLTKPGK 300

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDL 369
           L   ++ +I  T G  P   T GGTSD RFI      V+EFG +  T+H +NE  S++DL
Sbjct: 301 LLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIHKVNECVSVEDL 360

Query: 370 EDLTCIYENFLQN 382
                IY   L N
Sbjct: 361 GKCGEIYHKMLVN 373


>gi|308050148|ref|YP_003913714.1| succinyldiaminopimelate desuccinylase [Ferrimonas balearica DSM
           9799]
 gi|307632338|gb|ADN76640.1| succinyldiaminopimelate desuccinylase [Ferrimonas balearica DSM
           9799]
          Length = 377

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 159/373 (42%), Positives = 218/373 (58%), Gaps = 13/373 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            LI  PSVTP+D G   ++   L+ LGF+IE   F+        NL+AR G+E P   FA
Sbjct: 12  DLIARPSVTPEDAGCQAMMAAHLERLGFTIESMVFEDTT-----NLWARRGSEGPVFCFA 66

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVPPGD + W  PPF  T+ +G ++GRG  DMKGS+A  + AV RF+ ++ +  GS
Sbjct: 67  GHTDVVPPGDLSQWHTPPFEPTVIDGILHGRGAADMKGSLAAMLVAVERFVTEHPDHQGS 126

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I+ LIT DEEGP INGT +++  +E + EK   CIVGEP+  H +GD IK GRRGSL+ E
Sbjct: 127 IAFLITSDEEGPFINGTTRVIDTLEARNEKITWCIVGEPSSTHKLGDIIKNGRRGSLTAE 186

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +T+ G QGHVAYPHL +NP+    P L +L  + +D GN  F PT+ +I  I  G  + N
Sbjct: 187 VTVKGIQGHVAYPHLADNPVHKAAPALAELAAMEWDKGNAFFPPTSFQIANIHAGTGAPN 246

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           V+P  + + FN R+    + +   +++ SR +  I +   L + + ++    P FLT   
Sbjct: 247 VVPGALNVQFNFRY----STEVTAQDLESR-VHNIFDRYGLDYDIKWTYNGQP-FLTGGG 300

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQD 368
            L      +I   TG     STSGGTSD RFI      VIE G    T+H +NE  S++D
Sbjct: 301 ALLDATCAAIREVTGYDTEPSTSGGTSDGRFIAPTGAQVIELGPCNATIHKINECVSVRD 360

Query: 369 LEDLTCIYENFLQ 381
           LE L   YE  L+
Sbjct: 361 LELLAECYEKVLE 373


>gi|262376721|ref|ZP_06069949.1| succinyl-diaminopimelate desuccinylase [Acinetobacter lwoffii
           SH145]
 gi|262308431|gb|EEY89566.1| succinyl-diaminopimelate desuccinylase [Acinetobacter lwoffii
           SH145]
          Length = 378

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 160/379 (42%), Positives = 223/379 (58%), Gaps = 13/379 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           L+  +QL++ PSVTP D     I+   LK +GF+IE   F+      V N++AR GTE P
Sbjct: 7   LDLSLQLLRQPSVTPIDHDCQNIMAERLKKIGFNIESMRFED-----VDNIWARKGTEGP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
              FAGH DVVP G+ + W   PF   I EGK+YGRG  DMK ++A  + A  RFI KY 
Sbjct: 62  VFCFAGHTDVVPTGNLDAWNSDPFLPEIREGKLYGRGSADMKTALAAMVVATERFIEKYP 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           N  GSI+ LIT DEEGP+INGT K++  +E + EK   C+VGEP+  + +GD +K GRRG
Sbjct: 122 NHKGSIAYLITSDEEGPSINGTVKVIETLEARNEKITWCLVGEPSSTNKLGDIVKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SL+  +T+ GKQGHVAYPHL  NPI      + +L +  +D GN  F  T  +I+ I+ G
Sbjct: 182 SLNANLTVKGKQGHVAYPHLAVNPIHTASKAIAELCDTVWDHGNEYFPATTFQISNINSG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
             + NV+P  + +  N R+    + +   EE++ R ++ I +   + + V ++    P F
Sbjct: 242 TGATNVVPGTMNLLCNWRY----STEVTAEELKVRTLE-ILDRHGVDYDVSWTLSGLP-F 295

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNEN 363
           LT   +L +    +I N T     LSTSGGTSD RFI      V+E G++  T+H +NE+
Sbjct: 296 LTPIGELVNAAKTAILNVTRTETELSTSGGTSDGRFIAPTGAQVLELGVLNATIHQINEH 355

Query: 364 ASLQDLEDLTCIYENFLQN 382
             + DLE LT IYE  L N
Sbjct: 356 VDIDDLEPLTEIYEQILVN 374


>gi|261252296|ref|ZP_05944869.1| N-succinyl-L,L-diaminopimelate desuccinylase [Vibrio orientalis CIP
           102891]
 gi|260935687|gb|EEX91676.1| N-succinyl-L,L-diaminopimelate desuccinylase [Vibrio orientalis CIP
           102891]
          Length = 377

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 156/374 (41%), Positives = 211/374 (56%), Gaps = 13/374 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            LI   SVTP+D G   +++  LK LGF IE   F+        N +AR GT+AP   FA
Sbjct: 12  DLISRQSVTPEDAGCQDVMIERLKALGFEIEVMVFED-----TTNFWARRGTQAPLFAFA 66

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVP G    W  PPF  TI +G ++GRG  DMKGS+A  I AV +FI    N  GS
Sbjct: 67  GHTDVVPAGKLELWDTPPFEPTIKDGFLHGRGAADMKGSLASMIVAVEQFIADNPNHNGS 126

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I  LIT DEEGP INGT +++  +  +GE  D CIVGEP+   I+GD +K GRRGS++G+
Sbjct: 127 IGFLITSDEEGPFINGTVRVVEALMARGENIDMCIVGEPSSTEIVGDVVKNGRRGSITGD 186

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +T+ G QGHVAYPHL  NP+   +  +H+L    +D GN  F PT+ +I  +  G  + N
Sbjct: 187 LTVKGIQGHVAYPHLARNPVHQSLMAIHELATTEWDQGNDYFPPTSFQIPNVHAGTGASN 246

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP +  + FN+RF+   N  T+   +   L K       L + + ++    P FLT   
Sbjct: 247 VIPGEFNVQFNLRFSTELNNDTIVSRVTETLDK-----HDLDYDLKWTFNGDP-FLTDTG 300

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQD 368
            L   +  ++       P L T+GGTSD RFI      V+E G V  T+H +NE   + D
Sbjct: 301 ALLDAVVDAVDAVNQTKPALLTTGGTSDGRFIARMGGQVVELGPVNATIHKVNECVKVDD 360

Query: 369 LEDLTCIYENFLQN 382
           LE LT +Y+  L+N
Sbjct: 361 LEKLTDMYQKTLEN 374


>gi|52841122|ref|YP_094921.1| succinyl-diaminopimelate desuccinylase [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
 gi|54296907|ref|YP_123276.1| succinyl-diaminopimelate desuccinylase [Legionella pneumophila str.
           Paris]
 gi|81601926|sp|Q5X6L7|DAPE_LEGPA RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|81603452|sp|Q5ZX46|DAPE_LEGPH RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|52628233|gb|AAU26974.1| N-succinyl-diaminopimelate desuccinylase [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
 gi|53750692|emb|CAH12099.1| Succinyl-diaminopimelate desuccinylase [Legionella pneumophila str.
           Paris]
          Length = 377

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 162/385 (42%), Positives = 224/385 (58%), Gaps = 14/385 (3%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D  + L  LI  PS+TP+D G    ++  L+ LGF+      Q  N   V N +A +G  
Sbjct: 3   DIKQILTDLIGFPSITPEDAGCQKYMIQFLEQLGFTC-----QQLNNGPVSNFFACYGKI 57

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            P L+FAGH DVVP G+ + W   PFS     G +YGRG+ DMKGS+AC +    RFI  
Sbjct: 58  GPLLVFAGHTDVVPVGEVSKWDTDPFSLEEKSGVLYGRGVADMKGSLACMLHMARRFIKT 117

Query: 124 YKNF-GSISLLITGDEEGPAIN-GTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
           Y +F G +  LIT  EEG   N GT  ++  +E++G   D CIVGEP+ +   GD IKIG
Sbjct: 118 YPSFPGRLGFLITSGEEGDEFNLGTPYVMQKLEQQGIVIDYCIVGEPSSSLKAGDVIKIG 177

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSLS +I + GKQGHVAYPHL +NPI  + P+L +LT++ +D GN  F PT+M+IT I
Sbjct: 178 RRGSLSAKIHLSGKQGHVAYPHLADNPIHRISPVLAELTSMQWDNGNAFFPPTSMQITYI 237

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
             G  + N+IP ++ +  N R++    E+T  E +++R+I    +   L+  + +     
Sbjct: 238 HCGGHAGNIIPGELNLHLNFRYS---TEQT-DESLKTRVINAFTH-HNLNPAIEWRLNGE 292

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHAL 360
           P FLT+   L     +++    G +P LSTSGGTSD RFI  Y   VIE GLV  T+H +
Sbjct: 293 P-FLTNKGILLESCKQTVLEHIGTLPELSTSGGTSDGRFIAPYGVEVIELGLVNATIHQV 351

Query: 361 NENASLQDLEDLTCIYENFLQNWFI 385
           NE  SLQDL  L  +Y +  +   I
Sbjct: 352 NECTSLQDLNTLETMYFSICEKLLI 376


>gi|56412635|ref|YP_149710.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|62181048|ref|YP_217465.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|197361570|ref|YP_002141206.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|224582985|ref|YP_002636783.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|75481765|sp|Q57LM8|DAPE_SALCH RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|81361651|sp|Q5PLR5|DAPE_SALPA RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238055215|sp|B5BB22|DAPE_SALPK RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|254767084|sp|C0PYS5|DAPE_SALPC RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|56126892|gb|AAV76398.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|62128681|gb|AAX66384.1| N-succinyl-diaminopimelate deacylase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|197093046|emb|CAR58484.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|224467512|gb|ACN45342.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|322715531|gb|EFZ07102.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
          Length = 375

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 152/384 (39%), Positives = 221/384 (57%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF+IE  DF        +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRKIGFTIEHMDFGD-----TQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-RGETLAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ +  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   I+GD +K
Sbjct: 115 VAQHPHHRGRLAFLITSDEEASAKNGTVKVVEALMARNERLDYCLVGEPSSTEIVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M++ 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDRGNDFFPATSMQVA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +KE + + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEIIKERVHALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|255320550|ref|ZP_05361730.1| succinyl-diaminopimelate desuccinylase [Acinetobacter
           radioresistens SK82]
 gi|262379107|ref|ZP_06072263.1| succinyl-diaminopimelate desuccinylase [Acinetobacter
           radioresistens SH164]
 gi|255302400|gb|EET81637.1| succinyl-diaminopimelate desuccinylase [Acinetobacter
           radioresistens SK82]
 gi|262298564|gb|EEY86477.1| succinyl-diaminopimelate desuccinylase [Acinetobacter
           radioresistens SH164]
          Length = 378

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 157/384 (40%), Positives = 225/384 (58%), Gaps = 19/384 (4%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           + D L+  +QL++ PSVTP D     I+   L  +GF IE   F+      V NL+AR G
Sbjct: 4   SSDTLDLSLQLLRQPSVTPVDHNCQNIMAERLSKVGFHIENMRFED-----VDNLWARRG 58

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
           T+ P   FAGH DVVP G+ + W   PF   I +GK+YGRG  DMK ++A  + A  RF+
Sbjct: 59  TKDPVFCFAGHTDVVPTGNLDAWNSDPFIPEIRDGKLYGRGSADMKTALAAMVIASERFV 118

Query: 122 PKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
            K+ +  GSI+ LIT DEEGP+INGT K++  +E + EK   C+VGEP+  H +GD IK 
Sbjct: 119 AKHPDHKGSIAFLITSDEEGPSINGTVKVVETLESRNEKMTWCLVGEPSSTHQLGDIIKN 178

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGSL+G +T+ GKQGHVAYPHL  NPI      L +L    +D+GN  F  T+ +I+ 
Sbjct: 179 GRRGSLNGVLTVKGKQGHVAYPHLAINPIHTASAALAELCETVWDSGNEYFPATSFQISN 238

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFS--- 297
           I  G  + NV+P  + ++FN R+    + +   +E+++R+I  +Q      H V F    
Sbjct: 239 IQAGTGATNVVPGTMTVTFNFRY----STEVTADELKARVITILQR-----HQVDFDIKW 289

Query: 298 SPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRT 356
           +     FLT   +L +   ++I+   G    LSTSGGTSD RFI      V+E G++  +
Sbjct: 290 TLSGLPFLTPVGELVNAAVQAIHEVNGVEAKLSTSGGTSDGRFIAPTGAQVLELGVLNAS 349

Query: 357 MHALNENASLQDLEDLTCIYENFL 380
           +H ++E+ ++ DLE L  IYE  L
Sbjct: 350 IHQIDEHVNVDDLEPLAEIYEKIL 373


>gi|261867491|ref|YP_003255413.1| succinyl-diaminopimelate desuccinylase [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261412823|gb|ACX82194.1| succinyl-diaminopimelate desuccinylase [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 377

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 154/373 (41%), Positives = 215/373 (57%), Gaps = 13/373 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+  S++P D G   ++   L+ LGF IE   F   N ++  NL+A+ G+  P + FAG
Sbjct: 12  LIRXASISPNDEGCQQLIAERLEKLGFQIEWLPF---NDTL--NLWAKHGSGDPVIAFAG 66

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVP GD + WTYPPF A I +  +YGRG  DMKGS+A  + A   ++  + N  G+I
Sbjct: 67  HTDVVPTGDESQWTYPPFDAKIVDDMLYGRGAADMKGSLAAMVVATEEYVKAHPNHQGTI 126

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           +LLIT DEE  A +GT +++  +  +GEK   C+VGEP+    +GD +K GRRGS++G +
Sbjct: 127 ALLITSDEEAAAKDGTVRVVETLMARGEKITYCMVGEPSSTQTLGDVVKNGRRGSITGNL 186

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
            I G QGHVAYPHL ENPI    P L +LT   +D GN  F PT+++I  I  G  S NV
Sbjct: 187 YIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDNGNDFFPPTSLQIANIHAGTGSNNV 246

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IP ++ + FN+R+     +  +K+++   L K       L + + ++    P FLT   K
Sbjct: 247 IPGELYVQFNLRYCTEVTDGMIKQKVAEMLEK-----HGLKYRIEWNLSGKP-FLTKPGK 300

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDL 369
           L S L  S+    G  P L T GGTSD RFI      V+EFG +  T+H +NE  S++DL
Sbjct: 301 LVSALVDSLQQIAGITPKLETGGGTSDGRFIALMGAEVVEFGPLNATIHKVNECVSVEDL 360

Query: 370 EDLTCIYENFLQN 382
                IY   L N
Sbjct: 361 GKCGQIYHQMLVN 373


>gi|114562940|ref|YP_750453.1| succinyl-diaminopimelate desuccinylase [Shewanella frigidimarina
           NCIMB 400]
 gi|122299929|sp|Q083F0|DAPE_SHEFN RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|114334233|gb|ABI71615.1| succinyldiaminopimelate desuccinylase [Shewanella frigidimarina
           NCIMB 400]
          Length = 377

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 160/383 (41%), Positives = 220/383 (57%), Gaps = 13/383 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D +E    LI  PSVTP D G   ++ N L  +GF+IE   F+        N++AR 
Sbjct: 1   MNNDVVELAKDLISRPSVTPLDEGCQTLMANRLAAVGFNIEPMVFED-----TTNMWARR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   P   FAGH DVVP GD N W  PPF  TI +  ++GRG  DMKGS+A  I A  RF
Sbjct: 56  GNCDPVFCFAGHTDVVPTGDLNRWHTPPFEPTIIDNYLHGRGAADMKGSLAAMIIATERF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + K+ +  GSI+ LIT DEEGP INGT +++  +E + EK    +VGEP+  H +GD +K
Sbjct: 116 VAKHPDHNGSIAYLITSDEEGPFINGTTRVIDTLEARNEKMTWALVGEPSSTHKLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+G +T++G QGHVAYPHL +NPI   +P L +L  + +D GN  F PT+ +I 
Sbjct: 176 NGRRGSLTGNLTVNGIQGHVAYPHLADNPIHKAVPALTELAQMHWDNGNEFFPPTSFQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NVIP ++ + FN R+    + +   EE+  R++  I +   L + +++   
Sbjct: 236 NINGGTGASNVIPGELTVMFNFRY----STEVTAEELILRVVS-ILDAHGLDYDINWIFN 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT D  L     ++I   TG      TSGGTSD RFI      V+E G V  T+H
Sbjct: 291 GLP-FLTGDGPLLDATREAIREVTGYETDPQTSGGTSDGRFIAPTGAQVLELGPVNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQ 381
            +NE  ++ DLE L   YE  L+
Sbjct: 350 KVNECVNVADLEILANCYERILE 372


>gi|52424729|ref|YP_087866.1| succinyl-diaminopimelate desuccinylase [Mannheimia
           succiniciproducens MBEL55E]
 gi|81387390|sp|Q65US9|DAPE_MANSM RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|52306781|gb|AAU37281.1| ArgE protein [Mannheimia succiniciproducens MBEL55E]
          Length = 377

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 155/373 (41%), Positives = 218/373 (58%), Gaps = 13/373 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+ PS++P D G   ++   L  LGF+IE   F   N +I  NL+A+ GT +P + FAG
Sbjct: 12  LIRRPSISPDDQGCQQVIAERLTKLGFNIEWMSF---NDTI--NLWAKHGTTSPVVAFAG 66

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVP GD N W YPPFSA I +  +YGRG  DMKGS+A  I A   ++    N  G+I
Sbjct: 67  HTDVVPTGDENQWNYPPFSAQIVDDMLYGRGAADMKGSLAAMIVAAEEYVKANPNHAGTI 126

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           +LLIT DEE  A +GT K++  +  +GE  D C+VGEP+    +GD +K GRRGS++G++
Sbjct: 127 ALLITSDEEAAAKDGTVKVVESLMARGENIDYCLVGEPSSAKQLGDVVKNGRRGSITGDL 186

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
            I G QGHVAYPHL ENP+      L +LT   +D GN  F PT+++I  I  G  S NV
Sbjct: 187 YIQGIQGHVAYPHLAENPVHKATKFLTELTTYEWDNGNEFFPPTSLQIANIHAGTGSNNV 246

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IP ++ + FN+R+     ++ +K ++   L K       L++ + ++    P FLT   K
Sbjct: 247 IPGELYVQFNLRYCTEVTDEFIKNKVAEMLQK-----HDLTYRIDWNLSGKP-FLTKPGK 300

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDL 369
           L + + +S+ +  G  P L T GGTSD RFI      V+E G +  T+H +NE  S +DL
Sbjct: 301 LLNAVVESLESVAGIKPKLDTGGGTSDGRFIALMGAEVVELGPLNATIHKVNECVSCRDL 360

Query: 370 EDLTCIYENFLQN 382
             L  +Y   L N
Sbjct: 361 ATLGEVYRQMLVN 373


>gi|148244419|ref|YP_001219113.1| succinyl-diaminopimelate desuccinylase [Candidatus Vesicomyosocius
           okutanii HA]
 gi|238055238|sp|A5CXE9|DAPE_VESOH RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|146326246|dbj|BAF61389.1| succinyl-diaminopimelate desuccinylase [Candidatus Vesicomyosocius
           okutanii HA]
          Length = 376

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 160/375 (42%), Positives = 218/375 (58%), Gaps = 14/375 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           +L+   S+TPQD G   I+++ L  L F I +  F       V N +A  G ++P  +FA
Sbjct: 10  KLVSIDSITPQDKGCQSIMISHLNDLNFEITDLKFGE-----VDNFWAIRGQQSPVFVFA 64

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVP G+ + W  PPFSA +  G +YGRG  DMKGS+A  ++A  RF+  + N  GS
Sbjct: 65  GHTDVVPVGNESEWHMPPFSAQVKNGMLYGRGTSDMKGSLAAMLSATDRFVKDHSNHKGS 124

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I  LIT DEEGPAINGT K+  +++K  +  D C+VGEP+  H +GD IK GRRGSL+G 
Sbjct: 125 IGYLITSDEEGPAINGTVKVAQYLKKINQTVDYCLVGEPSATHELGDIIKNGRRGSLNGS 184

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
             I GKQGH+AYPHL  NPI  +IP L+ L N  +D GN  F  T+ +I+ I  G    N
Sbjct: 185 FKIIGKQGHIAYPHLASNPIHLVIPALNDLCNEVWDEGNEYFPATSFQISNIQSGTGVTN 244

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP +  + FN R+    + +  +E+++SR+   I +     + + +     P FLT   
Sbjct: 245 VIPGESNIVFNFRY----STQCTQEQLQSRVC-AILDKRNFEYQITWEHSGYP-FLTPKG 298

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP--VIEFGLVGRTMHALNENASLQ 367
           KL +    +I         LSTSGGTSD RFI       VIE G    T+H +NE  S+Q
Sbjct: 299 KLVNACVNAIKTVKNINTQLSTSGGTSDGRFIAPILKTRVIELGPSNATIHQVNECVSIQ 358

Query: 368 DLEDLTCIYENFLQN 382
           DLEDL+ IY + L+N
Sbjct: 359 DLEDLSDIYYHILKN 373


>gi|293446824|ref|ZP_06663246.1| succinyl-diaminopimelate desuccinylase [Escherichia coli B088]
 gi|291323654|gb|EFE63082.1| succinyl-diaminopimelate desuccinylase [Escherichia coli B088]
          Length = 375

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 151/384 (39%), Positives = 223/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E   F     +  +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMYF-----ADTQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMSRNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEKH-----QLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|204929618|ref|ZP_03220692.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|204321337|gb|EDZ06537.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
          Length = 375

 Score =  278 bits (710), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 151/384 (39%), Positives = 221/384 (57%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF+IE  DF        +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRKIGFTIEHMDFGD-----TQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-RGETLAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ +  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPHHRGRLAFLITSDEEASAKNGTVKVVEALMARNERLDYCLVGEPSSTEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M++ 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDRGNDFFPATSMQVA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +KE + + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKERVHALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|291326199|ref|ZP_06573877.1| succinyl-diaminopimelate desuccinylase [Providencia rettgeri DSM
           1131]
 gi|291315359|gb|EFE55812.1| succinyl-diaminopimelate desuccinylase [Providencia rettgeri DSM
           1131]
          Length = 389

 Score =  278 bits (710), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 154/381 (40%), Positives = 222/381 (58%), Gaps = 15/381 (3%)

Query: 4   DC--LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           DC  ++   +LI  PS++P D G   IL   L  LGF++E   F   NT    N +A  G
Sbjct: 15  DCPVIQLAKELISRPSISPDDQGCQAILTERLNQLGFTVEPMHF--GNT---LNFWAHRG 69

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
           T+ P L FAGH DVVP G+  +W  PPFS TI    +YGRG  DMKGS+A  + A  RF+
Sbjct: 70  TQGPTLAFAGHTDVVPAGNSENWQTPPFSPTIINQHLYGRGAADMKGSVAAMVVAAERFV 129

Query: 122 PKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
            K+ ++ G ++ LIT DEE  A++GT K++  +  + E+ D C+VGEP+    +GD IK 
Sbjct: 130 KKHPQHQGRLAFLITSDEEADALDGTVKVVETLMARNERVDYCLVGEPSSQSQLGDIIKN 189

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGS++  +TI G QGHVAYPHL +NP+      L +LT+  +D GN  F  T M+I  
Sbjct: 190 GRRGSITANLTILGTQGHVAYPHLADNPVHRSTAFLQELTSTIWDNGNEFFPATTMQIAN 249

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV 300
           I  G  + NVIP ++ + FN RF+    +  +++ + S L +       L++ + +S   
Sbjct: 250 IHAGTGASNVIPGELFVQFNFRFSTELTDTQIRDRVTSMLER-----HGLTYKIEWSLSG 304

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHA 359
            P FLT  ++L +   ++I+  TG    LSTSGGTSD RFI      VIE G +  T+H 
Sbjct: 305 QP-FLTEKQELVTATLQAIHELTGLNAELSTSGGTSDGRFIAQMGTQVIELGPLNATIHK 363

Query: 360 LNENASLQDLEDLTCIYENFL 380
           ++E  S++DL+ L  IYE  +
Sbjct: 364 VDECVSVKDLQQLALIYERVM 384


>gi|167549502|ref|ZP_02343261.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|168466774|ref|ZP_02700628.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197251549|ref|YP_002147435.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|200386710|ref|ZP_03213322.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|238913620|ref|ZP_04657457.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|238064815|sp|B5F0L0|DAPE_SALA4 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|195630741|gb|EDX49333.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197215252|gb|ACH52649.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|199603808|gb|EDZ02353.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|205325344|gb|EDZ13183.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
          Length = 375

 Score =  278 bits (710), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 152/384 (39%), Positives = 221/384 (57%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF+IE  DF        +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRKIGFTIEHMDFGD-----TQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-RGETLAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ +  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   I+GD +K
Sbjct: 115 VAQHPHHRGRLAFLITSDEEASAKNGTVKVVEALMARHERLDYCLVGEPSSTEIVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M++ 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDRGNDFFPATSMQVA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +KE + + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKERVHALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|160871696|ref|ZP_02061828.1| succinyl-diaminopimelate desuccinylase [Rickettsiella grylli]
 gi|159120495|gb|EDP45833.1| succinyl-diaminopimelate desuccinylase [Rickettsiella grylli]
          Length = 390

 Score =  277 bits (709), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 160/388 (41%), Positives = 217/388 (55%), Gaps = 15/388 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           +E + QL+  PSVTP D G   +L   LK L F+IE   F       V N +AR G ++P
Sbjct: 14  IELVQQLVAKPSVTPNDKGCQSLLCQHLKCLDFAIEHFPFAE-----VNNFWARRGKKSP 68

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY- 124
            L+F GH DVVP G    W  PPF  TI  G++YGRG  DMKGS+A  + A  +FI  Y 
Sbjct: 69  LLVFVGHTDVVPAGPLEKWETPPFMPTIRNGQLYGRGSADMKGSLAAMLVACRKFIHDYP 128

Query: 125 KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
            + GSI+ LIT DEEGP I G  K+   ++K+ EK D C+VGEPTC   +GDT+KIGRRG
Sbjct: 129 HHHGSIAWLITSDEEGPGIQGIAKVTEVLKKRNEKIDYCLVGEPTCEKKLGDTLKIGRRG 188

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTG--NTTFSPTNMEITTID 242
           SLS  + + GKQ H+AYP L+ENPI    PLL +L    +D G  +  F PT ++ + I 
Sbjct: 189 SLSAHLIVKGKQAHIAYPQLSENPIHQFSPLLVELLRTDWDDGIKHPHFQPTRLQFSNIQ 248

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
            G    NV P  + + FN R++       LK  + + L K +           FS     
Sbjct: 249 GGVGVNNVTPDCLDVKFNFRYSPGTTSIKLKNTVENILKKYLLKYQINWEEGGFS----- 303

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALN 361
            FL+   +L       I N TG +P +ST+GGTSD RFI      ++EFG   +T+H +N
Sbjct: 304 -FLSPSGQLRLACLDIIKNITGIVPTISTTGGTSDGRFIASMGAEIVEFGPCNQTIHQIN 362

Query: 362 ENASLQDLEDLTCIYENFLQNWFITPSQ 389
           E  S+++LE L+ IYE  L+   +  +Q
Sbjct: 363 ECVSIEELEKLSKIYEEILKKILLQSTQ 390


>gi|91793170|ref|YP_562821.1| succinyl-diaminopimelate desuccinylase [Shewanella denitrificans
           OS217]
 gi|123166131|sp|Q12N78|DAPE_SHEDO RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|91715172|gb|ABE55098.1| succinyldiaminopimelate desuccinylase [Shewanella denitrificans
           OS217]
          Length = 376

 Score =  277 bits (709), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 158/383 (41%), Positives = 220/383 (57%), Gaps = 13/383 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+ D  +  + LI  PSVTP D G   ++   L   GF++E   F+        NL+AR 
Sbjct: 1   MSTDVTQLAMALIARPSVTPLDEGCQTLMGKHLSAAGFTLEPMVFED-----TTNLWARR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT+AP   FAGH DVVP GD   W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GTQAPVFCFAGHTDVVPIGDLARWHTPPFEPTIIDGYLHGRGAADMKGSLAAMLVATERF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + K+ +  GSI+ LIT DEEGP INGT +++  +E + EK    +VGEP+  + +GD +K
Sbjct: 116 VAKHPHHNGSIAYLITSDEEGPFINGTTRVIDTLEARNEKITWALVGEPSSTYKLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+G +T++G QGHVAYPHL +NPI    P L +L  + +D GN  F PT+ +I 
Sbjct: 176 NGRRGSLTGNLTVNGVQGHVAYPHLADNPIHKAAPALTELAQMHWDNGNEFFPPTSFQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NVIP  +++ FN R+    + +   +E+ +R++ GI +   L + + +   
Sbjct: 236 NINGGTGASNVIPGNLEVMFNFRY----STEVTADELIARVL-GILDAHGLDYDISWVFN 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT D  L      +I   TG      T+GGTSD RFI      VIE G V  T+H
Sbjct: 291 GLP-FLTGDGPLLEATKSAIREVTGYDTDPQTTGGTSDGRFIAPTGAQVIELGPVNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQ 381
            +NE   + DLE L   YE  L+
Sbjct: 350 KVNECVKIADLEQLALCYEKLLE 372


>gi|254785167|ref|YP_003072595.1| succinyl-diaminopimelate desuccinylase [Teredinibacter turnerae
           T7901]
 gi|259595047|sp|C5BQE9|DAPE_TERTT RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|237684078|gb|ACR11342.1| succinyl-diaminopimelate desuccinylase [Teredinibacter turnerae
           T7901]
          Length = 375

 Score =  277 bits (709), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 157/384 (40%), Positives = 211/384 (54%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+P  L+    LI   SVTP+D G   ++   L+ +GF IE   F       V N +A  
Sbjct: 1   MSP-TLQLACDLISRASVTPEDAGCQALMTERLRAIGFHIESLRFDD-----VDNFWAVR 54

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   P L FAGH DVVP GD   W  PP+  TI +G +YGRG  DMKGS+A  + A   F
Sbjct: 55  GASGPILCFAGHTDVVPEGDPAKWQSPPYEPTITDGLLYGRGAADMKGSLAAMVTACEAF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G I+ LIT DEEG A NGT K++ W+E +GEK   C+VGEP+    +GD IK
Sbjct: 115 VAEHPNHTGRIAFLITSDEEGIAANGTVKVVEWLEARGEKVTWCLVGEPSSTQSVGDVIK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL  ++T+ GKQGHVAYPHL +NPI  + P L  L    +D GN  F  T+ +++
Sbjct: 175 NGRRGSLGCKLTVKGKQGHVAYPHLAKNPIHLVAPALADLAAEQWDEGNDFFPATSFQVS 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
             + G  + NVIP +  + FN RF+       LK+   + L K       L + +H+   
Sbjct: 235 NFNAGTGATNVIPGEAAIVFNFRFSTESTADELKQRTEAILAK-----HGLDYDIHWHLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT    L      +I    G  P LSTSGGTSD RFI      V+E G V  T+H
Sbjct: 290 GEP-FLTPAGALVDAAVTAIRAECGAEPELSTSGGTSDGRFIAPTGAQVLELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  ++ DL+ L+  Y+  L+ 
Sbjct: 349 QINECVNVADLDKLSATYQRILKE 372


>gi|270157423|ref|ZP_06186080.1| succinyl-diaminopimelate desuccinylase [Legionella longbeachae
           D-4968]
 gi|289164183|ref|YP_003454321.1| Succinyl-diaminopimelate desuccinylase [Legionella longbeachae
           NSW150]
 gi|269989448|gb|EEZ95702.1| succinyl-diaminopimelate desuccinylase [Legionella longbeachae
           D-4968]
 gi|288857356|emb|CBJ11184.1| Succinyl-diaminopimelate desuccinylase [Legionella longbeachae
           NSW150]
          Length = 389

 Score =  277 bits (709), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 158/377 (41%), Positives = 213/377 (56%), Gaps = 14/377 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI  PS+TP+D G    ++  L+  GF+      Q  N   V N +A +G   P L+FAG
Sbjct: 23  LISFPSITPEDAGCQEFMIQFLEQAGFTC-----QRMNQGPVSNFFASYGETGPLLVFAG 77

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVP G+ + W+  PF     EG +YGRG+ DMKGS+AC +    RFI  Y  F G +
Sbjct: 78  HTDVVPIGELSKWSTDPFVLENREGFLYGRGVADMKGSLACMLLMAQRFIKAYPQFHGRL 137

Query: 131 SLLITGDEEGPAIN-GTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
             LIT  EEG   + GT  ++  +  +G   D CIVGEP+  H +GD IKIGRRGSL+ +
Sbjct: 138 GFLITSAEEGEDYDMGTPYVMQLLATQGIHIDYCIVGEPSSTHTVGDVIKIGRRGSLNAK 197

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           I I GKQGHVAYPHL +NPI  + P+L +LT   +D GNT F PT+M+IT +  G  + N
Sbjct: 198 INIQGKQGHVAYPHLADNPIHKMSPVLTRLTTTVWDQGNTHFPPTSMQITHMHSGGHAAN 257

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           +IP ++ +  N R++       LKE    +++   Q    L+  + +     P FLT   
Sbjct: 258 IIPGELVLHLNFRYSTEQTHHALKE----KVVSAFQEF-NLNPVIEWRLSGEP-FLTAHG 311

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQD 368
            L     ++I   TGN P LSTSGGTSD RFI  Y   VIE G V  T+H +NE  SL  
Sbjct: 312 CLLESCKEAIIEITGNAPELSTSGGTSDGRFIAPYGVEVIELGPVNATIHQVNECISLNQ 371

Query: 369 LEDLTCIYENFLQNWFI 385
           L++L  +Y    +  FI
Sbjct: 372 LDELETLYFLICEKIFI 388


>gi|85711706|ref|ZP_01042763.1| succinyl-diaminopimelate desuccinylase [Idiomarina baltica OS145]
 gi|85694566|gb|EAQ32507.1| succinyl-diaminopimelate desuccinylase [Idiomarina baltica OS145]
          Length = 377

 Score =  277 bits (709), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 154/372 (41%), Positives = 216/372 (58%), Gaps = 13/372 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           L++ PS+TP D G   +L + LK LGF +E   F+        NL+AR G   P L FAG
Sbjct: 13  LLERPSITPADEGCQQVLGDRLKSLGFELESMIFED-----TTNLWARLGQGKPVLCFAG 67

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFG-SI 130
           H DVVPPGD + W++PPF  T  EG +YGRG  DMKGS+A  I AV R++ +       I
Sbjct: 68  HTDVVPPGDPSDWSFPPFQPTEHEGYLYGRGAADMKGSLAAMIVAVERYLKQVDEPPFDI 127

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           + LIT DEEGP INGTK+++  +E + EK   CIVGEP+    +GD +K GRRGSLSG +
Sbjct: 128 AFLITSDEEGPFINGTKRVMETLESRNEKITWCIVGEPSSTEQLGDVVKNGRRGSLSGSL 187

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
           ++ G QGHVAYPHL ENP+      L +LT   +D GN  F PT  +++ I  G  + NV
Sbjct: 188 SVIGVQGHVAYPHLAENPVHSAANALAELTQTRWDDGNEFFPPTTFQVSNIHAGTGAGNV 247

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IP ++ + FN RF+       L++ + +     I +   L++ +++     P FLT    
Sbjct: 248 IPGRLDIEFNFRFSTESTSTQLQQRVET-----ILDAHNLNYQLNWKLN-GPAFLTAQGL 301

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDL 369
           L + +  +I    G    LST+GGTSD RFI      +IE G V  T+H ++E   + DL
Sbjct: 302 LINKVQCAIKRVCGYPTKLSTAGGTSDGRFIAPTGAELIELGPVNATIHKVDECVKITDL 361

Query: 370 EDLTCIYENFLQ 381
           + LT +Y+  L+
Sbjct: 362 DTLTDVYQAILE 373


>gi|145631527|ref|ZP_01787295.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           R3021]
 gi|144982872|gb|EDJ90389.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           R3021]
          Length = 377

 Score =  277 bits (709), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 216/373 (57%), Gaps = 13/373 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI  PS++P D G   I+   L+ LGF IE   F   N ++  NL+A+ GT  P + FAG
Sbjct: 12  LIHRPSISPNDEGCQQIIAERLEKLGFQIEWMPF---NDTL--NLWAKHGTSEPVIAFAG 66

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVP GD N W+ PPFSA I +G +YGRG  DMKGS+A  I A   ++    N  G+I
Sbjct: 67  HTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEYVKANPNHKGTI 126

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           +LLIT DEE  A +GT +++  +  + EK   C+VGEP+    +GD +K GRRGS++G +
Sbjct: 127 ALLITSDEEAAAKDGTIRVVETLMARNEKITYCMVGEPSSAKNLGDVVKNGRRGSITGNL 186

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
            I G QGHVAYPHL ENPI    P L +LT   +D GN  F PT+++I  I  G  S NV
Sbjct: 187 YIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDKGNEFFPPTSLQIANIHAGTGSNNV 246

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IPA++ + FN+R+     ++ +K+++   L K       L + + ++    P FLT   K
Sbjct: 247 IPAELYIQFNLRYCTEVTDEIIKQKVAGMLEK-----HNLKYRIEWNLSGKP-FLTKPGK 300

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDL 369
           L   ++ +I  T G  P   T GGTSD RFI      V+EFG +  T+H +NE  S++DL
Sbjct: 301 LLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIHKVNECVSVEDL 360

Query: 370 EDLTCIYENFLQN 382
                IY   L N
Sbjct: 361 GKCGEIYHKMLVN 373


>gi|310817039|ref|YP_003965003.1| succinyl-diaminopimelate desuccinylase [Ketogulonicigenium vulgare
           Y25]
 gi|308755774|gb|ADO43703.1| succinyl-diaminopimelate desuccinylase [Ketogulonicigenium vulgare
           Y25]
          Length = 355

 Score =  277 bits (709), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 138/335 (41%), Positives = 200/335 (59%), Gaps = 6/335 (1%)

Query: 53  VKNLYARFGTEAPHLMFA--GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSI 110
           + NL+AR+G +  +  F   GHIDVVP GD + WT+ PF A I +G +YGRG VDMK  +
Sbjct: 23  ISNLFARWGRKGANRSFGFNGHIDVVPVGDASQWTFDPFGAEIVDGYMYGRGAVDMKSGV 82

Query: 111 ACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTC 170
           A F+ A   F       G+I L ITGDEE    +GT+ +L W+ + GE    CIVGEPT 
Sbjct: 83  AAFVGAAIDFTRNTPPDGAIVLTITGDEEDVGEDGTRALLDWMAENGEAMSVCIVGEPTS 142

Query: 171 NHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTT 230
             ++GD +KIGRRGS +   T+ G+QGH AYP    NP+  +  L+ +L++   D G   
Sbjct: 143 PEVLGDMMKIGRRGSATVWFTVTGQQGHAAYPQRALNPMPAMARLMDRLSSRVLDEGTDH 202

Query: 231 FSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKL 290
           F  +++++ TID GN + NVIP Q + + N+RFND+    +L + +++   K      + 
Sbjct: 203 FDSSSLQVVTIDTGNGATNVIPGQTRATINVRFNDIHTGASLVDWMQAEADK---VAAEF 259

Query: 291 SHTVHFSSPVS-PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIE 349
              V   S +S   FLT    L+ L++ ++   TG  P+LSTSGGTSDARF+K +CPV+E
Sbjct: 260 GVQVALRSRISGEAFLTPPGALSDLVAAAVKAETGLSPVLSTSGGTSDARFVKSHCPVVE 319

Query: 350 FGLVGRTMHALNENASLQDLEDLTCIYENFLQNWF 384
           FGLVG+ MH ++E   +  +  L  IY   L ++F
Sbjct: 320 FGLVGKRMHGVDERVEIVQIGQLQAIYTRVLADYF 354


>gi|168232029|ref|ZP_02657087.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|194472281|ref|ZP_03078265.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194458645|gb|EDX47484.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|205333703|gb|EDZ20467.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
          Length = 375

 Score =  277 bits (709), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 152/384 (39%), Positives = 221/384 (57%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF+IE  DF        +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRKIGFTIEHMDFGD-----TQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-RGETLAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ +  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   I+GD +K
Sbjct: 115 VAQHPHHRGRLAFLITSDEEASAKNGTVKVVEALMARHERLDYCLVGEPSSTEIVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M++ 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDRGNDFFPATSMQVA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +KE + + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKERVHALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVLELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|329297531|ref|ZP_08254867.1| succinyl-diaminopimelate desuccinylase [Plautia stali symbiont]
          Length = 375

 Score =  277 bits (709), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 145/380 (38%), Positives = 219/380 (57%), Gaps = 14/380 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            +E   QLI+ PS++P D G   +L+  L+ +GF +E       +     N +A  G + 
Sbjct: 5   VIELAQQLIRRPSLSPDDAGCQAMLIARLEAIGFHVE-----PMHIGDTLNFWATRG-QG 58

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
             L FAGH DVVPPGD N W  PPF  +I +G ++GRG  DMKGS+A  + A  RF+  +
Sbjct: 59  ETLAFAGHTDVVPPGDANRWISPPFEPSIRDGMLFGRGAADMKGSLAAMVVAAERFVAAH 118

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
            N  G ++ LIT DEE  A+NGT K++  +  + E+ D C+VGEP+   ++GD +K GRR
Sbjct: 119 PNHAGRLAFLITSDEEASAVNGTVKVVERLMARNERMDYCLVGEPSSTEVVGDVVKNGRR 178

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++  +TIHG QGHVAYPHL +NP+   +P L++L    +D GN  F PT+M+I  +  
Sbjct: 179 GSMTANLTIHGVQGHVAYPHLADNPVHRAMPALNELVATEWDQGNEFFPPTSMQIANVQA 238

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  S NVIP +  + FN RF+    ++ +K+ + + L +      +L +T+ ++    P 
Sbjct: 239 GTGSNNVIPGEFFVQFNFRFSTELTDQMIKDRVAALLDRH-----QLRYTLEWNVSGQP- 292

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNE 362
           FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H +NE
Sbjct: 293 FLTSRGKLVDAVVNAVAHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIHKINE 352

Query: 363 NASLQDLEDLTCIYENFLQN 382
                DL+ L+ +Y+  ++ 
Sbjct: 353 CVKASDLQLLSRMYQRIMEQ 372


>gi|16761400|ref|NP_457017.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29140903|ref|NP_804245.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|213053079|ref|ZP_03345957.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213425363|ref|ZP_03358113.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213649879|ref|ZP_03379932.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213851969|ref|ZP_03381501.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|289828740|ref|ZP_06546530.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|81513418|sp|Q8Z4S2|DAPE_SALTI RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|25320458|pir||AG0816 succinyl-diaminopimelate desuccinylase [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16503700|emb|CAD02683.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29136528|gb|AAO68094.1| succinyldiaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
          Length = 375

 Score =  277 bits (709), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 153/384 (39%), Positives = 221/384 (57%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF+IE  DF        +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDVGCQALMIERLRKIGFTIEHMDFGD-----TQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-RGETLAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ +  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   I+GD +K
Sbjct: 115 VAQHPHHRGRLAFLITSDEEASAKNGTVKVVEALMARNERLDYCLVGEPSSTEIVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDRGNDFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +KE + + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKERVHALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|226940852|ref|YP_002795926.1| succinyl-diaminopimelate desuccinylase [Laribacter hongkongensis
           HLHK9]
 gi|254767083|sp|C1D8X7|DAPE_LARHH RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|226715779|gb|ACO74917.1| Succinyl-diaminopimelate desuccinylase [Laribacter hongkongensis
           HLHK9]
          Length = 376

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 156/384 (40%), Positives = 228/384 (59%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M P  LE   +LI+  S TP D G   +++  L+ +GF++E   F       V N +AR 
Sbjct: 1   MNP-TLELACELIRRNSTTPDDAGCQELMIARLERIGFTVERMRFGE-----VDNFWARR 54

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G+++P L FAGH DVVP G    W   PF     +G ++GRG  DMK S+A F+ A+  F
Sbjct: 55  GSDSPTLCFAGHTDVVPTGPLTAWHSDPFEPVERDGHLFGRGAADMKASLAAFVTAIEDF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  + +  GSI+LL+T DEEG A++GT+ ++  +  +GE +D CIVGEPT     GDTIK
Sbjct: 115 VAGHPDHKGSIALLVTSDEEGVAVHGTRAVVETLAARGETFDWCIVGEPTSARQFGDTIK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSLSG++T+ G QGH+AYPHL  NP+  L P L +L  I +D GN  F PT+ +++
Sbjct: 175 NGRRGSLSGKLTVKGVQGHIAYPHLARNPVHLLAPALAELAAIRWDEGNAHFPPTSWQVS 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  + N+IP  V++ FN RF+       LK  + S L +       L + + ++  
Sbjct: 235 NIHGGTGATNIIPGTVEVQFNFRFSTEQTADGLKNAVHSLLDR-----HGLDYELEWNLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMH 358
            +P FLT    L + +  ++ + TG +P L+TSGGTSD RFIKD C  V+EFG +  T+H
Sbjct: 290 GNP-FLTATGDLIAAIETAVKDVTGIMPELNTSGGTSDGRFIKDVCREVVEFGPLNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +++D+  L+ IY   L +
Sbjct: 349 KVNECVAVEDVPKLSEIYRRTLAS 372


>gi|119469290|ref|ZP_01612229.1| succinyl-diaminopimelate desuccinylase [Alteromonadales bacterium
           TW-7]
 gi|119447154|gb|EAW28423.1| succinyl-diaminopimelate desuccinylase [Alteromonadales bacterium
           TW-7]
          Length = 375

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 156/372 (41%), Positives = 220/372 (59%), Gaps = 13/372 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+  SVTP+D G   ++   L+ +GF+IE   F     +   N +AR G ++PH  FAG
Sbjct: 11  LIQRESVTPEDAGCQQMMNERLEAIGFNIESLFF-----TDTLNTWARKGDQSPHFCFAG 65

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVP G   +W +PPFS  +  G ++GRG  DMKGS+A  I A  RFI KY N  GSI
Sbjct: 66  HTDVVPTGPAKNWQHPPFSGLVENGLLHGRGAADMKGSLAAMIVATERFITKYPNHKGSI 125

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           S LIT DEEGP INGT +++  +E +GEK D C+VGEP+   ++GD +K GRRGSL+G +
Sbjct: 126 SFLITSDEEGPFINGTTRVIDTLESRGEKIDMCLVGEPSSRDVLGDVVKNGRRGSLTGFV 185

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
            + G QGHVAYPHL +NPI      L +L+   +D GN  F  T+ +I+ I+ G  + NV
Sbjct: 186 KVKGIQGHVAYPHLAQNPIHLATEALTELSQTQWDKGNDFFPATSFQISNINGGTGAGNV 245

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IP ++ + FN RF    + +   ++++ R+I  +Q    L++ +++     P F+T    
Sbjct: 246 IPGELDVQFNFRF----STEVTHQQLQQRVIDILQK-HNLNYELNWIVNGLP-FITEHGP 299

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDL 369
           L      +I + TG +  L T+GGTSD RFI      VIE G    T+H ++E  S  DL
Sbjct: 300 LVDATVNAIESVTGLVTNLETTGGTSDGRFIAQTGAKVIELGPRNATIHKVDECVSTDDL 359

Query: 370 EDLTCIYENFLQ 381
             LT IYE  L+
Sbjct: 360 IKLTDIYEQILE 371


>gi|82777849|ref|YP_404198.1| succinyl-diaminopimelate desuccinylase [Shigella dysenteriae Sd197]
 gi|309784800|ref|ZP_07679433.1| succinyl-diaminopimelate desuccinylase [Shigella dysenteriae 1617]
 gi|123561955|sp|Q32D98|DAPE_SHIDS RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|81241997|gb|ABB62707.1| N-succinyl-diaminopimelate deacylase [Shigella dysenteriae Sd197]
 gi|308927170|gb|EFP72644.1| succinyl-diaminopimelate desuccinylase [Shigella dysenteriae 1617]
          Length = 375

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 150/384 (39%), Positives = 222/384 (57%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF     +  +N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDF-----ADTQNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGETLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D  N  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQSNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NV P ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVTPGELFVQFNFRFSTELTDEMIKAQVLALLEKH-----QLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  +  DL+ L  +Y+  ++ 
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQ 372


>gi|332525857|ref|ZP_08401998.1| succinyl-diaminopimelate desuccinylase [Rubrivivax benzoatilyticus
           JA2]
 gi|332109408|gb|EGJ10331.1| succinyl-diaminopimelate desuccinylase [Rubrivivax benzoatilyticus
           JA2]
          Length = 381

 Score =  276 bits (707), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 149/378 (39%), Positives = 222/378 (58%), Gaps = 11/378 (2%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE-APHLMF 69
           QLI   SVTP+D G   ++ + L  LGF  E       +  +   L  R G+E  P L F
Sbjct: 10  QLIARRSVTPEDAGCQDLIASRLAALGFECETIVCGPDDFRVTNLLARRAGSEPGPVLAF 69

Query: 70  AGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFG 128
           AGH DVVP G  + WT  PF  +  +G++YGRG  DMK S+A  + AV  FI    ++ G
Sbjct: 70  AGHTDVVPTGPLDRWTSDPFVPSHRDGRLYGRGAADMKSSLAAMVVAVEEFIAAQPRHAG 129

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           +I+ L+T DEEGP+++GT +++  ++++GE+ DACIVGEPT    +GD +K GRRGSLSG
Sbjct: 130 AITFLLTSDEEGPSVDGTVRLVELLQQRGERLDACIVGEPTSVSRLGDMLKNGRRGSLSG 189

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
            +T+ GKQGH+AYP L +NPI    P L +L  + +D GN  F PT+ +++ +  G  + 
Sbjct: 190 RLTVIGKQGHIAYPQLAKNPIHVFAPALAELAAMRWDEGNAFFPPTSWQVSNLHGGTGAS 249

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPVFLTH 307
           NVIP ++ + FN RF+     ++L+  +   L + G++      H + ++    P FLT 
Sbjct: 250 NVIPGELVVDFNFRFSTESTPESLQARVAEVLARHGVE------HRLEWTLSGRP-FLTT 302

Query: 308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMHALNENASL 366
              L + LS +I    G  P LST+GGTSD RFI   CP V+EFG +  T+H ++E+   
Sbjct: 303 PGPLIAALSAAIVTECGVEPELSTTGGTSDGRFIAAICPQVVEFGPLNATIHQIDEHVDA 362

Query: 367 QDLEDLTCIYENFLQNWF 384
             +E L  +Y   L+++ 
Sbjct: 363 ASVETLKNVYRRTLEHYL 380


>gi|312796232|ref|YP_004029154.1| succinyl-diaminopimelate desuccinylase [Burkholderia rhizoxinica
           HKI 454]
 gi|312168007|emb|CBW75010.1| Succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) [Burkholderia
           rhizoxinica HKI 454]
          Length = 379

 Score =  276 bits (707), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 155/380 (40%), Positives = 220/380 (57%), Gaps = 17/380 (4%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYA-RFGTEAPH---L 67
           LI   SVTP+D G   ++   L  LGF+ E     T     V NL+A + G + P    L
Sbjct: 11  LIGRASVTPEDAGCQALMAERLVALGFTCE-----TIAEGGVTNLWALKRGADGPAGKLL 65

Query: 68  MFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KN 126
            FAGH DVVP G    W   PF     +G++YGRG  DMK S+A F+ A   F+  + ++
Sbjct: 66  AFAGHTDVVPTGPLEQWRSDPFVPVRRDGRLYGRGAADMKASLAAFVVAAEEFVAAHPQH 125

Query: 127 FGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSL 186
            GSI LLIT DEEGPA  GT K++  +E +GE+ D C+VGEPT +   GDT+K GRRGSL
Sbjct: 126 RGSIGLLITSDEEGPARYGTVKVVERLEARGERLDYCVVGEPTSSERFGDTVKNGRRGSL 185

Query: 187 SGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNP 246
           SG +T+ G QGH+AYPHL +NP+  L P L +L  + +D GN  F PT  +I+ +  G  
Sbjct: 186 SGTLTVRGIQGHIAYPHLAKNPVHLLAPALAELVRVAWDQGNEYFPPTTWQISNLHAGTG 245

Query: 247 SKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLT 306
           + N+IP    + FN RF+      T  +E+++R +  I +   L +T+ ++    P FLT
Sbjct: 246 ATNIIPGSASIDFNFRFST----ATTPDELKAR-VHAILDAHGLDYTLTWNLSGMP-FLT 299

Query: 307 HDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMHALNENAS 365
              +L++ L ++I   TG  P+LST+GGTSD RFI   C  VIEFG    ++H ++E+  
Sbjct: 300 PRGELSNALEQAIEAETGIRPVLSTTGGTSDGRFIARICKQVIEFGPCNASIHKVDEHIE 359

Query: 366 LQDLEDLTCIYENFLQNWFI 385
           L  +E L  +Y   L+   +
Sbjct: 360 LAHIEPLKNVYRGVLERLVV 379


>gi|220934324|ref|YP_002513223.1| succinyl-diaminopimelate desuccinylase [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|238055235|sp|B8GPR9|DAPE_THISH RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|219995634|gb|ACL72236.1| succinyl-diaminopimelate desuccinylase [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 376

 Score =  276 bits (707), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 157/384 (40%), Positives = 227/384 (59%), Gaps = 13/384 (3%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D L+   +LI+  SVTP+D G   ++   L  LGF      F+      V NL+ R G+E
Sbjct: 3   DTLDLAQELIRRRSVTPEDAGCQQLIAERLAPLGFEAHHLRFED-----VDNLWLRRGSE 57

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            P L FAGH DVVP G    W+  PF   I  G++YGRG  DMK SIA F+ A   F+  
Sbjct: 58  GPVLAFAGHTDVVPTGPVEKWSSDPFQPQIRNGQLYGRGAADMKSSIAAFVIACEAFLKD 117

Query: 124 YKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
           + +  GSI+LLIT DEEGP++NGT K++ W+E +GEK    +VGEP+    +GD IK GR
Sbjct: 118 HPDHKGSIALLITSDEEGPSVNGTVKVVEWLEARGEKITWALVGEPSSTERLGDVIKNGR 177

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSLSG + + G+QGHVAYPHL +NP+   +P L +L  I +D GN  F PT+ +I+ I 
Sbjct: 178 RGSLSGVLRVRGQQGHVAYPHLADNPVHRALPALAELAAIQWDEGNEHFPPTSFQISNIH 237

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
            G  ++NVIP ++++ FN+RF+    E+T  E IR+R +  + +   L + + +     P
Sbjct: 238 AGTGAENVIPGELEVMFNLRFS---TEQT-DEGIRTR-VHAVLDAHGLDYELSWRLSGHP 292

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALN 361
            FLT + +L    S +I    G    LST+GGTSD RFI      V+E G +  ++H ++
Sbjct: 293 -FLTAEGELVEAASAAIREVMGLDTELSTAGGTSDGRFIAPTGAQVVELGPLNASIHKID 351

Query: 362 ENASLQDLEDLTCIYENFLQNWFI 385
           E+  ++DL+ L+ IY   L+   +
Sbjct: 352 EHVRIEDLDALSRIYTGILKRLLV 375


>gi|110833998|ref|YP_692857.1| succinyl-diaminopimelate desuccinylase [Alcanivorax borkumensis
           SK2]
 gi|123050550|sp|Q0VQG3|DAPE_ALCBS RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|110647109|emb|CAL16585.1| succinyl-diaminopimelate desuccinylase [Alcanivorax borkumensis
           SK2]
          Length = 377

 Score =  276 bits (707), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 155/383 (40%), Positives = 222/383 (57%), Gaps = 13/383 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           L++  +LI+  SVTP+D G    ++  L++LGF  E   F+      V+NL+AR GT+ P
Sbjct: 5   LDYTKELIRRASVTPEDQGCQAWIIEKLEVLGFKCETLWFEE-----VRNLWARRGTQGP 59

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
              FAGH DVVP GD   W Y PF+ T     +YGRG  DMKGSIA  I A+  FI  + 
Sbjct: 60  VFAFAGHTDVVPTGDVTAWKYDPFTPTEEGDLLYGRGAADMKGSIAAMIVAMEDFIAAHP 119

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  GS++ LIT DEEGP++NGT K++  ++ + E  D C+VGEP+  + +GD IK GRRG
Sbjct: 120 DHNGSLAFLITADEEGPSVNGTVKVVEHLQARQEHIDYCLVGEPSSTNTVGDVIKNGRRG 179

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SL  ++T+ G QGHVAYPHL  NPI  + P L +L+   +D GN  F  T+ +I+ I+ G
Sbjct: 180 SLGAKLTVKGIQGHVAYPHLARNPIHDVAPALAELSATEWDQGNDFFPATSFQISNINGG 239

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
             + NVIP   ++ FN RF+    +  L+E + + L K       L + + ++    P F
Sbjct: 240 TGATNVIPGTCEIIFNFRFSTELTDAILRERVEAILDK-----HGLDYDLQWTLSGQP-F 293

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNEN 363
           LT    L      +I + T     LST+GGTSD RFI      V+E G    T+H ++E+
Sbjct: 294 LTDRGALVDAAVGAIRDVTELDTELSTAGGTSDGRFIAPTGTQVVELGPTNATIHKVDEH 353

Query: 364 ASLQDLEDLTCIYENFLQNWFIT 386
            S+ +L+ LT IY+  LQ+   T
Sbjct: 354 TSISELDTLTQIYQRLLQHLMTT 376


>gi|212635492|ref|YP_002312017.1| succinyl-diaminopimelate desuccinylase [Shewanella piezotolerans
           WP3]
 gi|238055222|sp|B8CMP0|DAPE_SHEPW RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|212556976|gb|ACJ29430.1| Proteobacterial succinyl-diaminopimelate desuccinylase [Shewanella
           piezotolerans WP3]
          Length = 381

 Score =  276 bits (707), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 156/374 (41%), Positives = 214/374 (57%), Gaps = 13/374 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            LI  PSVTP D G   ++ + LK  GF+IE+  F+        N++AR GT++P   FA
Sbjct: 15  DLISRPSVTPLDEGCQTLMADRLKDAGFNIEDMVFED-----TTNMWARKGTQSPVFCFA 69

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVP GD N W  PPF   + +  ++GRG  DMKGS+A  + A  RF+ K+ +  GS
Sbjct: 70  GHTDVVPVGDLNRWHTPPFEPVVIDDYLHGRGAADMKGSLAAMVVATERFVKKHPDHKGS 129

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I+ LIT DEEGP INGT +++  +E + EK    +VGEP+  H +GD +K GRRGSL+G 
Sbjct: 130 IAFLITSDEEGPFINGTTRVIDTLEARNEKITWSLVGEPSSTHKLGDIVKNGRRGSLTGN 189

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +T+ G QGHVAYPHL +NPI    P L +L  + +D GN  F PT+ +I  I+ G  + N
Sbjct: 190 LTVKGMQGHVAYPHLADNPIHKASPALDELARMKWDNGNEFFPPTSFQIANINGGTGASN 249

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP  +++ FN R++       +  EI    +  I +   L + +++     P FLT D 
Sbjct: 250 VIPGTLEVMFNFRYS-----TEVTAEILIERVLNILDAHGLDYDINWIFNGLP-FLTGDG 303

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQD 368
            L      +I   TG      TSGGTSD RFI      V+E G V  T+H +NE   + D
Sbjct: 304 PLLDATRDAIKKVTGLDTDPQTSGGTSDGRFIAPTGAHVLELGPVNATIHKVNECVKVSD 363

Query: 369 LEDLTCIYENFLQN 382
           LE LT  YE  L+N
Sbjct: 364 LEQLTLCYEAILEN 377


>gi|163752199|ref|ZP_02159402.1| succinyl-diaminopimelate desuccinylase [Shewanella benthica KT99]
 gi|161327928|gb|EDP99105.1| succinyl-diaminopimelate desuccinylase [Shewanella benthica KT99]
          Length = 376

 Score =  276 bits (706), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 157/383 (40%), Positives = 216/383 (56%), Gaps = 13/383 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+ D L     LI  PS+TP D G   ++ + L  +GF IE   F+        N++AR 
Sbjct: 1   MSQDVLTLAQDLISRPSLTPLDEGCQQLMADRLAKVGFDIEPMVFED-----TTNMWARR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GTE P   FAGH DVVP GD N W  PPF   + +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GTEKPLFCFAGHTDVVPVGDLNRWHTPPFDPVVIDGYLHGRGAADMKGSLAAMLVATERF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + K  +  GSI+ LIT DEEGP INGT +++  +E + EK    +VGEP+  H +GD +K
Sbjct: 116 VEKNPDHKGSIAFLITSDEEGPFINGTTRVIDTLEARNEKITWSLVGEPSSTHKLGDIVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+G +T++G QGHVAYPHL ENPI   +P L +L  + +D GN  F PT+ +I 
Sbjct: 176 NGRRGSLTGNLTVNGIQGHVAYPHLAENPIHKAMPALDELAKMHWDKGNEYFPPTSFQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NVIP  +++ FN R++       +  EI  + +  I +   L + +++   
Sbjct: 236 NINGGTGASNVIPGALEVMFNFRYS-----TEVTAEILIQRVLNILDAHGLEYDINWIFN 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT D  L      +I   TG      T+GGTSD RFI      VIE G V  T+H
Sbjct: 291 GLP-FLTGDGPLLDATKAAIKQVTGTDTDPQTTGGTSDGRFIAPTGAQVIELGPVNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQ 381
            +NE   + D+E L   YE  L+
Sbjct: 350 KVNECVKVDDIEQLALCYEVILE 372


>gi|84389717|ref|ZP_00991269.1| succinyl-diaminopimelate desuccinylase [Vibrio splendidus 12B01]
 gi|84376818|gb|EAP93692.1| succinyl-diaminopimelate desuccinylase [Vibrio splendidus 12B01]
          Length = 378

 Score =  276 bits (706), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 156/376 (41%), Positives = 211/376 (56%), Gaps = 13/376 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            LI   SVTP+D G   +++  LK LGF IE   F+        N +AR GTE P   FA
Sbjct: 12  DLISRQSVTPEDAGCQDLMIERLKALGFEIEVMVFED-----TTNFWARRGTEVPLFAFA 66

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVP G    W   PF  TI +G ++GRG  DMKGS+A  I AV +FI K+ +  GS
Sbjct: 67  GHTDVVPAGPIEQWHTKPFEPTIVDGFLHGRGAADMKGSLASMIVAVEQFIAKHPDHTGS 126

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I  LIT DEEGP INGT +++  +  +GE  D CIVGEP+    +GD +K GRRGS++G+
Sbjct: 127 IGFLITSDEEGPFINGTVRVVEALMARGENIDMCIVGEPSSTEYVGDVVKNGRRGSITGD 186

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +TI G QGHVAYPHL  NP+   +  +++L    +D GN  F PT+ +I  +  G  + N
Sbjct: 187 LTIKGTQGHVAYPHLANNPVHSSLLAINELATTEWDKGNDYFPPTSFQIPNVSAGTGASN 246

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP +  + FN+RF+   N   + E I + L K         + + +     P FLT   
Sbjct: 247 VIPGEFNVQFNLRFSTELNNDIIVERITNTLDK-----YDFEYDLKWIFNGDP-FLTDAG 300

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFI-KDYCPVIEFGLVGRTMHALNENASLQD 368
            L   +  ++ +     P L T+GGTSD RFI +    V+E G V  T+H +NE   + D
Sbjct: 301 SLLDAIVDAVGHVNDVKPALLTTGGTSDGRFIARMKGQVVELGPVNATIHKVNECVKVAD 360

Query: 369 LEDLTCIYENFLQNWF 384
           LE LT +YE  L N F
Sbjct: 361 LEKLTDMYERTLVNLF 376


>gi|120555465|ref|YP_959816.1| succinyl-diaminopimelate desuccinylase [Marinobacter aquaeolei VT8]
 gi|238064789|sp|A1U3R0|DAPE_MARAV RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|120325314|gb|ABM19629.1| succinyldiaminopimelate desuccinylase [Marinobacter aquaeolei VT8]
          Length = 376

 Score =  276 bits (706), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 159/377 (42%), Positives = 215/377 (57%), Gaps = 14/377 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE    LI+  SVTP D G   ++++ L  LGFS E   F   +     NL+AR G   P
Sbjct: 7   LELAKDLIRRQSVTPDDAGCQELMMSRLAPLGFSGENLRFGETD-----NLWARKGNNGP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            L FAGH DVVP G   +W +PPF   I +G ++GRG  DMKGS+A FI A  RF+  + 
Sbjct: 62  VLAFAGHTDVVPTGPEKNWAHPPFDPIIKDGYLHGRGAADMKGSLAAFITACERFVANHP 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           N  GSI+LLIT DEEGPA +GT K++  +E + EK D C++GEP+  H +GD IK GRRG
Sbjct: 122 NHRGSIALLITSDEEGPAQDGTVKVVETLEARNEKMDWCLIGEPSSTHQVGDVIKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SL G +T+ G QGHVAYPHL EN +  + P L  L    +D GN  F PT  +IT ++ G
Sbjct: 182 SLHGYLTVRGVQGHVAYPHLAENAVHNVAPALDALAKEFWDNGNDFFPPTTFQITRVEAG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
             S N++P +  + FN R+      ++L+E + +     I +   L + + +     P F
Sbjct: 242 VGS-NIVPGECLVHFNFRYCTENTAESLEERVVA-----ILDRHNLKYDLQWHLSGRP-F 294

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNEN 363
           LT    L S    +I   TG    LSTSGGTSD RFI      V+E G +  T+H ++E 
Sbjct: 295 LTDKGALVSAAQNAIRTVTGRETELSTSGGTSDGRFIAPTGAQVVELGPINATIHKVDEC 354

Query: 364 ASLQDLEDLTCIYENFL 380
              +DL+ L+ IYE  L
Sbjct: 355 VKAEDLDTLSEIYEQIL 371


>gi|153874306|ref|ZP_02002577.1| Proteobacterial succinyl-diaminopimelate desuccinylase [Beggiatoa
           sp. PS]
 gi|152069229|gb|EDN67422.1| Proteobacterial succinyl-diaminopimelate desuccinylase [Beggiatoa
           sp. PS]
          Length = 379

 Score =  276 bits (706), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 156/379 (41%), Positives = 218/379 (57%), Gaps = 13/379 (3%)

Query: 10  IQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMF 69
           I+LI  PS+TP D G   ++   L+ LGF IE   F       V NL+AR G   P  +F
Sbjct: 9   IELINRPSITPVDAGCQTLIAERLQALGFIIEHLRFGE-----VDNLWARRGNTNPLFVF 63

Query: 70  AGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFG 128
           AGH DVVP G  N W + PFS+T+ EG +YGRG  DMKGS+A  + A  RF+ +Y K+ G
Sbjct: 64  AGHTDVVPTGPENQWQFSPFSSTLHEGFLYGRGSADMKGSLAAMVTAYERFVAEYPKHQG 123

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           SI+ LIT DEEG A++GT K++ ++++K    D C+VGEP+    + D +K GRRGSL+G
Sbjct: 124 SIAFLITSDEEGIAVDGTVKVIKYLQEKNVSIDWCLVGEPSSEKRLCDVVKNGRRGSLNG 183

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
            +TI G QGHVAYPH  ENPI    P+L  L  I +D GN  F  T+ +IT I  G  + 
Sbjct: 184 LLTIQGIQGHVAYPHKAENPIHRFAPVLKTLCEIEWDQGNQFFPKTSFQITNIKAGTGAD 243

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHD 308
           NVIP  +++ FN R++       L+E++ + L K       L + + +    SP   T  
Sbjct: 244 NVIPDDLEILFNFRYSTEVTHTQLQEQMTALLDK-----QALKYNLTWRHSGSPFLTTTT 298

Query: 309 R-KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASL 366
              L +   ++I    G    LST GGTSD RFI      VIE G +  T+H +NE  ++
Sbjct: 299 SGTLIAATQQAISEVCGYETTLSTGGGTSDGRFIAPTGAQVIEVGPLNATIHKINECVNV 358

Query: 367 QDLEDLTCIYENFLQNWFI 385
           +DL+ L+ +Y+  L+   I
Sbjct: 359 EDLDTLSIVYQKILEKLLI 377


>gi|326386370|ref|ZP_08207993.1| succinyl-diaminopimelate desuccinylase [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326209031|gb|EGD59825.1| succinyl-diaminopimelate desuccinylase [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 380

 Score =  276 bits (706), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 169/371 (45%), Positives = 224/371 (60%), Gaps = 17/371 (4%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYA-RFGTEAP-HLM 68
           +L+ C SVTP  G  F  L   L+LLGF++            V+NL A R G E   H  
Sbjct: 16  RLMACDSVTPAMGAVFAELSAMLELLGFAVHRFVAGEAPDGPVENLVAIRQGPEGSRHFA 75

Query: 69  FAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFG 128
           FAGH+DVVPPG+   WT  PF+       +YGRG VDMKGSIA  +AAVA+ +P+    G
Sbjct: 76  FAGHLDVVPPGE--GWTSAPFAPERRGELLYGRGAVDMKGSIASMVAAVAQ-VPR--EAG 130

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           +IS LITGDEEGPA  GT  ++  I   G+  D C+VGEPT  H +GD  KIGRRGS++ 
Sbjct: 131 TISFLITGDEEGPARFGTVAIIDHIRATGDLPDLCLVGEPTSVHRLGDMAKIGRRGSVNI 190

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
            +T  G QGHVAYPHL +NPI  L+ LL  L  +  D G+  F P+N+EIT + VGNP+ 
Sbjct: 191 WLTAKGAQGHVAYPHLADNPIPRLVALLADLDALVLDDGSDWFQPSNLEITDLAVGNPAT 250

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS-PVFLTH 307
           NVIPA+ +   +IRFNDL       E++ +++ +  Q     +H V   + +S   FLT 
Sbjct: 251 NVIPAEARARISIRFNDLHR----GEDLVAKVTELAQ-----AHKVETRAIISGEAFLTM 301

Query: 308 DRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQ 367
               ++LL  ++   TG  P LST+GGTSDARF++  CPVIEFGL   TMH  +E  +++
Sbjct: 302 PGDFSALLVDAVEAETGLTPELSTTGGTSDARFLRAVCPVIEFGLSNATMHKKDEAVAME 361

Query: 368 DLEDLTCIYEN 378
           DL  L+ IY  
Sbjct: 362 DLVVLSRIYRR 372


>gi|118595130|ref|ZP_01552477.1| succinyl-diaminopimelate desuccinylase [Methylophilales bacterium
           HTCC2181]
 gi|118440908|gb|EAV47535.1| succinyl-diaminopimelate desuccinylase [Methylophilales bacterium
           HTCC2181]
          Length = 376

 Score =  276 bits (706), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 152/374 (40%), Positives = 227/374 (60%), Gaps = 13/374 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           +LIK  S+TP D G    +++ +K LGF++E  ++     S VKN YAR G  +P ++FA
Sbjct: 10  ELIKKASITPDDMGCQDHMISHIKPLGFNVELMEY-----SNVKNFYARKGDSSPLIVFA 64

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVP G  + W + PFS +  +G +YGRG  DMK S+A FI A+  FI ++ N  GS
Sbjct: 65  GHTDVVPTGPIDQWRFDPFSPSEDDGLLYGRGSADMKTSLAAFIIAIEEFIDEHPNHNGS 124

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I LLIT DEEG A +GT K++  ++ + EK D CIVGEPT N   GDT+K GRRGSLS +
Sbjct: 125 IGLLITADEEGIATDGTVKVVEALKARNEKIDYCIVGEPTSNKYFGDTVKNGRRGSLSAK 184

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           + + G QGH+AYP L  NPI  + P++  L    +D GN  F  T+ +I+ I+ G  + N
Sbjct: 185 LIVKGIQGHIAYPELIRNPIHEVAPVIDLLVKTVWDDGNEYFPKTSWQISNINGGTGATN 244

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           V+P +V++ FN R++       LKE + + L+        L + + ++   +P +LT   
Sbjct: 245 VVPGEVEILFNFRYSTSNTADKLKERVETILVD-----HNLDYQISWNHSGNP-YLTEKG 298

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNENASLQD 368
            L   +S +I +     P +ST+GGTSD RFI   C  V+EFG +  ++H +NE+ +++D
Sbjct: 299 MLVDKISGAIESVLNIKPSISTTGGTSDGRFISTICDQVVEFGPINASIHKINEHVNIKD 358

Query: 369 LEDLTCIYENFLQN 382
           ++ L  IY+  L+N
Sbjct: 359 VDLLKDIYKKTLEN 372


>gi|310768302|gb|ADP13252.1| succinyl-diaminopimelate desuccinylase [Erwinia sp. Ejp617]
          Length = 375

 Score =  276 bits (706), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 145/374 (38%), Positives = 216/374 (57%), Gaps = 14/374 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           QLI+ PS++P D G   IL+  L+ LGF+IE  +F         N +A  G E   L FA
Sbjct: 11  QLIRRPSLSPDDAGCQEILIARLQALGFTIEPMNFGD-----TLNFWAWRG-EGETLAFA 64

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNFGS 129
           GH DVVP GD  HW  PPF   I EG ++GRG  DMKGS+A  + A  RF+  Y ++ G 
Sbjct: 65  GHTDVVPTGDVKHWQTPPFEPAIREGMLFGRGAADMKGSLAAMVVAAERFVASYPQHKGR 124

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           ++ L+T DEE    NGT K++  +  + E+ D C+VGEP+   ++GD +K GRRGS++  
Sbjct: 125 LAFLVTSDEEASGTNGTVKVVEALMARDERLDYCLVGEPSSTEVVGDVVKNGRRGSITAN 184

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +T+HG QGHVAYPHL +NP+  +IP L++L    +D GN  F PT+M+I  +  G  S N
Sbjct: 185 LTVHGVQGHVAYPHLADNPVHRVIPALNELVATEWDKGNEFFPPTSMQIANVQAGTGSNN 244

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP    + FN RF+    +  ++++++  L +      +L +++ +     P FLT   
Sbjct: 245 VIPGDCFVQFNFRFSTELTDVIIQQQVKELLDRH-----QLRYSIEWKLSGQP-FLTPRG 298

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFI-KDYCPVIEFGLVGRTMHALNENASLQD 368
           KL   +  ++ +     P L T+GGTSD RFI +    V+E G V  T+H +NE     D
Sbjct: 299 KLVDAVVNAVEHYNEIKPQLLTNGGTSDGRFIARTGAQVVELGPVNATIHKINECVKAAD 358

Query: 369 LEDLTCIYENFLQN 382
           L+ L+ +Y+  ++ 
Sbjct: 359 LQLLSRMYQRIMEQ 372


>gi|152980053|ref|YP_001353762.1| succinyl-diaminopimelate desuccinylase [Janthinobacterium sp.
           Marseille]
 gi|238064756|sp|A6SZR5|DAPE_JANMA RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|151280130|gb|ABR88540.1| succinyl-diaminopimelate desuccinylase [Janthinobacterium sp.
           Marseille]
          Length = 375

 Score =  276 bits (705), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 160/380 (42%), Positives = 221/380 (58%), Gaps = 19/380 (5%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           +LI   SVTP+D G    L+  L+ LGF  E     T  +  V NL+AR GT  P L+FA
Sbjct: 10  ELIALSSVTPEDKGCQSRLIELLEPLGFVCE-----TIESDGVTNLWARKGTTQPLLVFA 64

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI---PKYKNF 127
           GH DVVP G    WT PPF  T  EGK+YGRG  DMK SIA  + A   F+   P +K  
Sbjct: 65  GHTDVVPTGPLEQWTSPPFVPTQREGKLYGRGAADMKTSIAAMVVAAEEFVQAHPAHK-- 122

Query: 128 GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLS 187
           GSI  LIT DEEGPA +GT  + + ++ +GE+ D C+VGEPT + ++GDTIK GRRGS+S
Sbjct: 123 GSIGFLITSDEEGPATDGTVIVCNALKARGEQLDYCVVGEPTSSDVLGDTIKNGRRGSMS 182

Query: 188 GEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPS 247
           G++T+ G QGH+AYP L  NPI    P L +L    +D GN  + PT+ +++ I  G  +
Sbjct: 183 GKLTVKGIQGHIAYPQLARNPIHQCAPALAELVAEKWDDGNEYYLPTSWQVSNIHGGAGA 242

Query: 248 KNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIK-GIQNVPKLSHTVHFSSPVSPVFLT 306
            NVIP  V + FN RF        L++ + + L K G++   K S + H        FLT
Sbjct: 243 SNVIPGNVVIDFNFRFCTASTVDGLQKRVHAILDKHGLEYDLKWSISGH-------PFLT 295

Query: 307 HDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMHALNENAS 365
               L+  +S +I + TG    LST+GGTSD RFI   CP V+EFG    ++H ++E+  
Sbjct: 296 PKGTLSDAMSDAIKSETGVTTELSTTGGTSDGRFIAQICPQVVEFGPPNGSIHKIDEHIE 355

Query: 366 LQDLEDLTCIYENFLQNWFI 385
           ++ ++ L  IY   ++N  +
Sbjct: 356 VRFIDPLKNIYRRTMENLLL 375


>gi|145639602|ref|ZP_01795206.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           PittII]
 gi|145271393|gb|EDK11306.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           PittII]
          Length = 377

 Score =  276 bits (705), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 156/373 (41%), Positives = 215/373 (57%), Gaps = 13/373 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+ PS++P D G   I+   L+ LGF IE   F   N ++  NL+A+ GT  P + FAG
Sbjct: 12  LIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPF---NDTL--NLWAKHGTSEPVIAFAG 66

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVP GD N W+ PPFSA I +G +YGRG  DMKGS+A  I A   ++    N  G+I
Sbjct: 67  HTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEYVKANPNHKGTI 126

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           +LLIT DEE  A +GT +++  +  + EK   C+VGEP+    +GD +K GRRGS++G +
Sbjct: 127 ALLITSDEEAAAKDGTIRVVETLMTRDEKITYCMVGEPSSAKNLGDVVKNGRRGSITGNL 186

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
            I G QGHVAYPHL ENPI    P L +LT   +D GN  F PT+++I  I  G  S NV
Sbjct: 187 YIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDKGNEFFPPTSLQIANIHAGTGSNNV 246

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IPA++ +  N+R+        + +EI  + + G+     L + + ++    P FLT   K
Sbjct: 247 IPAELYIQLNLRYC-----TEVTDEIIKQKVAGMLEKHNLKYRIEWNLSGKP-FLTKPGK 300

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDL 369
           L   ++ +I  T G  P   T GGTSD RFI      V+EFG +  T+H +NE  S++DL
Sbjct: 301 LLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIHKVNECVSVEDL 360

Query: 370 EDLTCIYENFLQN 382
                IY   L N
Sbjct: 361 GKCGEIYHKMLVN 373


>gi|170726539|ref|YP_001760565.1| succinyl-diaminopimelate desuccinylase [Shewanella woodyi ATCC
           51908]
 gi|238055226|sp|B1KDS3|DAPE_SHEWM RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|169811886|gb|ACA86470.1| succinyl-diaminopimelate desuccinylase [Shewanella woodyi ATCC
           51908]
          Length = 376

 Score =  276 bits (705), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 159/383 (41%), Positives = 215/383 (56%), Gaps = 13/383 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+ + L     LI  PSVTP D G   ++   L   GF IE   F+        N++AR 
Sbjct: 1   MSQEVLTLAQDLISRPSVTPLDEGCQTLMAERLAAQGFEIESMVFED-----TTNMWARR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G E P   FAGH DVVP GD N W  PPF   + +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GKEGPLFCFAGHTDVVPVGDLNRWHTPPFDPVVIDGYLHGRGAADMKGSLAAMVVATERF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + K+ +  GSI+ LIT DEEGP INGT +++  +E + EK    +VGEP+  H +GD +K
Sbjct: 116 VEKHPDHNGSIAFLITSDEEGPFINGTTRVIDTLEARNEKITWSLVGEPSSTHKLGDIVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+G +TI+G QGHVAYPHL +NPI    P L +L  + +D GN  F PT+ +I 
Sbjct: 176 NGRRGSLTGNLTINGIQGHVAYPHLADNPIHKAAPALDELARMKWDNGNEFFPPTSFQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NVIP  +++ FN R++       +  EI  + +  I +   L + + +   
Sbjct: 236 NINGGTGASNVIPGALEVMFNFRYS-----TEVTAEILIQRVLNILDAHGLDYDISWIFN 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT D  L     ++I   TG+     TSGGTSD RFI      VIE G V  T+H
Sbjct: 291 GLP-FLTGDGPLLDATREAIKQVTGSDTDPQTSGGTSDGRFIAPTGAHVIELGPVNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQ 381
            +NE   + DLE LT  YE  L+
Sbjct: 350 KVNECVKVSDLELLTQCYEVILE 372


>gi|87198605|ref|YP_495862.1| succinyl-diaminopimelate desuccinylase [Novosphingobium
           aromaticivorans DSM 12444]
 gi|123490621|sp|Q2GAU5|DAPE_NOVAD RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|87134286|gb|ABD25028.1| succinyldiaminopimelate desuccinylase [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 375

 Score =  276 bits (705), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 169/375 (45%), Positives = 220/375 (58%), Gaps = 23/375 (6%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYA-RFGTE-APHLM 68
           +LI CPS+TP  G  F  L   L+ LGF+I            V+NL+A R G E A H  
Sbjct: 12  RLIDCPSITPATGAVFDCLQAMLEPLGFAIHRFVAGEAPDGPVENLFAIRKGPEGARHFA 71

Query: 69  FAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFG 128
           FAGH+DVVPPG+   WT  PF A      +YGRG VDMKGSIA  +AAVA  IP   + G
Sbjct: 72  FAGHLDVVPPGE--GWTSGPFKAERRGELLYGRGAVDMKGSIAAMVAAVAE-IPA--DAG 126

Query: 129 SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSG 188
           ++S +ITGDEEGPA  GT  ++  I + G + D C+VGEPT  H +GD +KIGRRGS++ 
Sbjct: 127 TLSFIITGDEEGPARYGTVPLIDLIRQLGAEPDLCLVGEPTSVHRLGDMVKIGRRGSVNM 186

Query: 189 EITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSK 248
            I   G QGHVAYPHL +NPI  L+ LL  L  +  D G   F P+N+EIT ++VGNP+ 
Sbjct: 187 WIACKGAQGHVAYPHLADNPIPRLVALLADLDALVLDGGTEWFQPSNLEITDLEVGNPAT 246

Query: 249 NVIPAQVKMSFNIRFNDLWNEKTL---KEEIRSRLIKGIQNVPKLSHTVHFSSPVS-PVF 304
           NVIPA+ +   +IRFND      L    EEI  R            H     + +S   F
Sbjct: 247 NVIPAEARARISIRFNDRHTGAELVARVEEIAHR------------HKGEVRAVISGESF 294

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENA 364
           +T     +++++ ++   TG  P LSTSGGTSDARF++  CPV+EFGL   TMH  +E  
Sbjct: 295 ITLPGAFSAMIADAVKAETGLDPELSTSGGTSDARFLRAVCPVVEFGLCNATMHKKDEAV 354

Query: 365 SLQDLEDLTCIYENF 379
           +++DL  L  IY   
Sbjct: 355 AMEDLRVLQRIYRRI 369


>gi|329893763|ref|ZP_08269851.1| N-succinyl-L,L-diaminopimelate desuccinylase [gamma proteobacterium
           IMCC3088]
 gi|328923486|gb|EGG30800.1| N-succinyl-L,L-diaminopimelate desuccinylase [gamma proteobacterium
           IMCC3088]
          Length = 375

 Score =  275 bits (704), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 152/372 (40%), Positives = 214/372 (57%), Gaps = 13/372 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
           +LI+  S+TP+DG    ++   L+ +GF      F       V NL+A  G+  P L+FA
Sbjct: 10  ELIERQSITPEDGACQTLMATRLEAIGFKSRPMPFGE-----VSNLWASRGSGGPTLVFA 64

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVP G    W  PPF+ TI +G ++GRG  DMK S+A  I A  RF+  + N  G 
Sbjct: 65  GHTDVVPTGPLEQWQSPPFTPTIRDGHLFGRGAADMKASLAAMITACERFVAAHPNHRGR 124

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I+ LIT DEEGPA +GT K++  +  +GE  D C++GEP+    +GD IK GRRGS    
Sbjct: 125 IAFLITSDEEGPAHDGTVKVIEQLASEGEAIDWCVIGEPSSTAQLGDVIKNGRRGSQGAR 184

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           +TI GKQGH+AYPHL +NPI   +  L  L    +D GN  F  T ++I+ I  G  + N
Sbjct: 185 LTIFGKQGHIAYPHLADNPIHKALAALSSLIEQHWDEGNEFFPATQLQISNIHGGTGATN 244

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           VIP +V + FN+R++     + L+++I + L K       + + + +     P FLT   
Sbjct: 245 VIPGEVVVDFNLRYSSETTAQELEQKITALLDKF-----AIKYHIDWVRSGKP-FLTRPG 298

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQD 368
           +LT  +S ++    G  P LSTSGGTSD RFI  Y   VIE G V  T+H +NE  +++D
Sbjct: 299 QLTHAVSNAVQKVCGIQPELSTSGGTSDGRFIAPYDIDVIELGPVNATIHQINECVAVED 358

Query: 369 LEDLTCIYENFL 380
           +E L+ IYE  L
Sbjct: 359 VERLSLIYEQVL 370


>gi|90022252|ref|YP_528079.1| succinyl-diaminopimelate desuccinylase [Saccharophagus degradans
           2-40]
 gi|122996053|sp|Q21HG2|DAPE_SACD2 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|89951852|gb|ABD81867.1| succinyldiaminopimelate desuccinylase [Saccharophagus degradans
           2-40]
          Length = 382

 Score =  275 bits (704), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 155/372 (41%), Positives = 211/372 (56%), Gaps = 13/372 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFA 70
            LI  PSVTP+D     +++  L+ +GF +E   F       V N +A  G   P L FA
Sbjct: 17  DLIAQPSVTPEDAHCQRMMIERLEAIGFKVENLRFGD-----VDNFWAIRGESGPILAFA 71

Query: 71  GHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GS 129
           GH DVVP GD   W   PF+ TI +G +YGRG  DMKGS+A  I A   FI  + N  G 
Sbjct: 72  GHTDVVPTGDLGKWATDPFTPTIKDGMLYGRGAADMKGSLAAMITACESFIAAHPNHTGR 131

Query: 130 ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGE 189
           I+ LIT DEEGPAINGT K++ W+E + EK   C+VGEP+   ++GD IK GRRGSL  E
Sbjct: 132 IAFLITSDEEGPAINGTVKVVEWLEARNEKIKWCLVGEPSSTTLVGDVIKNGRRGSLGAE 191

Query: 190 ITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKN 249
           + + G QGHVAYPHL  NPI  + P L ++ +  +D GN  F PT+ +++  + G  + N
Sbjct: 192 LIVKGVQGHVAYPHLAVNPIHMIAPALAEMASETWDNGNEFFPPTSFQVSNFNSGTGATN 251

Query: 250 VIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDR 309
           V+P +  + FN RF+       LK+  R+  I    NV   ++ + ++    P FLT + 
Sbjct: 252 VVPGEANVVFNFRFSTELTADILKQ--RTHAILDKHNV---NYDLKWNLSGEP-FLTAEG 305

Query: 310 KLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQD 368
           +L +    +I   TG    LST+GGTSD RFI      V+E G V  T+H +NE  S+ D
Sbjct: 306 ELVAASVAAIKKITGRDTELSTAGGTSDGRFIAPTGAQVLELGPVNATIHQINECVSVDD 365

Query: 369 LEDLTCIYENFL 380
           L  L+ IY   L
Sbjct: 366 LNTLSDIYCTML 377


>gi|307130027|ref|YP_003882043.1| N-succinyl-L,L-diaminopimelate desuccinylase [Dickeya dadantii
           3937]
 gi|306527556|gb|ADM97486.1| N-succinyl-L,L-diaminopimelate desuccinylase [Dickeya dadantii
           3937]
          Length = 375

 Score =  275 bits (704), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 146/384 (38%), Positives = 224/384 (58%), Gaps = 14/384 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLIK PS++P D G   +++  L+ +GF +E+ D         +N +A  
Sbjct: 1   MSCPVIELAQQLIKRPSLSPDDAGCQALMIERLQAIGFIVEKLDVDD-----TQNFWACR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVP G+ + W  PPF   I +G +YGRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGKTLAFAGHTDVVPVGNESQWQTPPFEPAIRDGMLYGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  + N  G ++ LIT DEE  A+NGT K++  +  + E+ D C+VGEP+    +GD +K
Sbjct: 115 VAAHPNHQGRLAFLITSDEEASAVNGTVKVVETLMARQERLDYCLVGEPSSTDRVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++  + IHG QGHVAYPHL +NP+   IP L++L    +D GN  F PT+M+I 
Sbjct: 175 NGRRGSITANLRIHGVQGHVAYPHLADNPVHRAIPALNELVATVWDQGNEFFPPTSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  S NVIP  + + FN RF+    ++ +K+++++ L +      +L++T+ +   
Sbjct: 235 NINAGTGSNNVIPGDLDVQFNFRFSTELTDELIKQQVKALLDRH-----QLNYTLEWRLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P FLT   +L   +  ++ + +   P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GHP-FLTSRGELVDAVVNAVEHYSEITPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQN 382
            +NE  S  DL+ L+ +Y+  ++ 
Sbjct: 349 KVNECVSAADLQLLSRMYQRIMEQ 372


>gi|330720263|gb|EGG98625.1| N-succinyl-L2CL-diaminopimelate desuccinylase [gamma
           proteobacterium IMCC2047]
          Length = 377

 Score =  275 bits (703), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 156/379 (41%), Positives = 218/379 (57%), Gaps = 13/379 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE    LI  PSVTP D     ++++ L+ +GF+IE  +F       V NL+A  G   P
Sbjct: 7   LEFTKDLIAQPSVTPADCDCQEMMISRLEAVGFNIERLNFGE-----VTNLWAVHGESGP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            L FAGH DVVP G   +WT  PF   + +G +YGRG  DMKGSIA    A  RFI    
Sbjct: 62  ILAFAGHTDVVPTGPIENWTSHPFKPEVRDGYLYGRGAADMKGSIAAMTIAAERFISANP 121

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           +  G ++ LIT DEEGPA+NGT K++  ++++GE+   C+VGEP+  + +GD IK GRRG
Sbjct: 122 DHSGRLAFLITSDEEGPAVNGTVKVIEHLQQQGEQLRWCVVGEPSSTNKLGDVIKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SL+GE+TI GKQGH+AYPHL +NPI    P L  L    +D GN  F  T+ +I+ I+ G
Sbjct: 182 SLNGELTIQGKQGHIAYPHLADNPIHHACPALADLIAEQWDQGNDFFPATSFQISNINSG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
             + NVIP   ++ FN R++     +  +EE++ R  + I N  +L + + +     P F
Sbjct: 242 TGATNVIPGTTEVVFNFRYST----EVTQEELQQR-TEAILNRHQLDYKLDWKLSGLP-F 295

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNEN 363
           LT   +L      ++    G+   LSTSGGTSD RFI      VIE G    T+H LNE 
Sbjct: 296 LTEPGELVGAAQSALIEVMGSEAELSTSGGTSDGRFIAPTGAQVIELGPCNATIHQLNER 355

Query: 364 ASLQDLEDLTCIYENFLQN 382
             +++LE    IY++ + N
Sbjct: 356 VLVEELEQTAQIYQSIMSN 374


>gi|148825625|ref|YP_001290378.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           PittEE]
 gi|319896542|ref|YP_004134735.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           F3031]
 gi|238064747|sp|A5UB44|DAPE_HAEIE RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|148715785|gb|ABQ97995.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           PittEE]
 gi|309972769|gb|ADO95970.1| N-succinyl-diaminopimelate deacylase [Haemophilus influenzae R2846]
 gi|317432044|emb|CBY80393.1| putative succinyl-diaminopimelate desuccinylase [Haemophilus
           influenzae F3031]
          Length = 377

 Score =  275 bits (703), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 155/373 (41%), Positives = 216/373 (57%), Gaps = 13/373 (3%)

Query: 12  LIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAG 71
           LI+ PS++P D G   I+   L+ LGF IE   F   N ++  NL+A+ GT  P + F G
Sbjct: 12  LIRRPSISPNDEGCQQIIAEGLEKLGFQIEWMPF---NDTL--NLWAKHGTSEPVIAFVG 66

Query: 72  HIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSI 130
           H DVVP GD N W+ PPFSA I +G +YGRG  DMKGS+A  I A   ++    N  G+I
Sbjct: 67  HTDVVPTGDENQWSSPPFSAEIIDGILYGRGAADMKGSLAAMIVAAEEYVKANPNHKGTI 126

Query: 131 SLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEI 190
           +LLIT DEE  A +GT +++  +  + EK   C+VGEP+    +GD +K GRRGS++G +
Sbjct: 127 ALLITSDEEAAAKDGTIRVVETLMTRDEKITYCMVGEPSSAKNLGDVVKNGRRGSITGNL 186

Query: 191 TIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNV 250
            I G QGHVAYPHL ENPI    P L +LT   +D GN  F PT+++I  I  G  S NV
Sbjct: 187 YIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDKGNEFFPPTSLQIANIHAGTGSNNV 246

Query: 251 IPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRK 310
           IPA++ + FN+R+     ++ +K+++   L K       L + + ++    P FLT   K
Sbjct: 247 IPAELYIQFNLRYCTEVTDEIIKQKVAEMLAK-----HNLKYRIEWNLSGKP-FLTKPGK 300

Query: 311 LTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMHALNENASLQDL 369
           L   ++ +I   TG  P   T GGTSD RFI      V+EFG +  ++H +NE  S++DL
Sbjct: 301 LLDSITSAIEEITGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSSIHKVNECVSVEDL 360

Query: 370 EDLTCIYENFLQN 382
                IY   L N
Sbjct: 361 GKCGEIYHKM