PSIBLAST alignment of GI: 254780782 and protein with PDB id: 1xmb

>gi|56554606|pdb|1XMB|A Chain A, X-Ray Structure Of Iaa-Aminoacid Hydrolase From Arabidopsis Thaliana Gene At5g56660 Length = 418
>gi|150261472|pdb|2Q43|A Chain A, Ensemble Refinement Of The Protein Crystal Structure Of Iaa- Aminoacid Hydrolase From Arabidopsis Thaliana Gene At5g56660 Length = 418
 Score = 78.0 bits (190), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 52/395 (13%), Positives = 116/395 (29%), Gaps = 29/395 (7%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            ++   ++ + P +  ++     ++ + L+L+G               +  +    GT  
Sbjct: 30  MVKIRRKIHENPELGYEELETSKLIRSELELIGIKYR-------YPVAITGVIGYIGTGE 82

Query: 65  PH-LMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
           P  +     +D +P  +   W +    A   +    G          A  I    R    
Sbjct: 83  PPFVALRADMDALPIQEGVEWEHKSKIA--GKMHACGHDGHVTMLLGAAKILHEHR---- 136

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
           +   G++ L+    EEG +    K       K  E      +                  
Sbjct: 137 HHLQGTVVLIFQPAEEGLS-GAKKMREEGALKNVEAIFGIHLSARIPFGKAASRAGSFLA 195

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           G+   E  I GK GH A P  T +P+     ++  L  +     +   S     + T+  
Sbjct: 196 GAGVFEAVITGKGGHAAIPQHTIDPVVAASSIVLSLQQLVSRETDPLDSK----VVTVSK 251

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
            N           ++             L++ ++  + K        +      +   P+
Sbjct: 252 VNGGNAFNVIPDSITIGGTLRAFTGFTQLQQRVKEVITKQAAVHRCNASVNLTPNGREPM 311

Query: 304 FLT-HDRKLTSLLSKSIYNTTGNIPLLSTSG--GTSDARFIKDYCPV--IEFGL-----V 353
             T +++ L     K + +  G    +  +   G+ D  +  +  P      G+      
Sbjct: 312 PPTVNNKDLYKQFKKVVRDLLGQEAFVEAAPVMGSEDFSYFAETIPGHFSLLGMQDETNG 371

Query: 354 GRTMHALNENASLQDLEDLTCIYENFLQNWFITPS 388
             + H+     +   L     I+ +    +    +
Sbjct: 372 YASSHSPLYRINEDVLPYGAAIHASMAVQYLKEKA 406