PSIBLAST alignment of GI: 254780782 and protein with PDB id: 3ct9

>gi|187609402|pdb|3CT9|A Chain A, Crystal Structure Of A Putative Zinc Peptidase (Np_812461.1) From Bacteroides Thetaiotaomicron Vpi-5482 At 2.31 A Resolution Length = 356
>gi|187609403|pdb|3CT9|B Chain B, Crystal Structure Of A Putative Zinc Peptidase (Np_812461.1) From Bacteroides Thetaiotaomicron Vpi-5482 At 2.31 A Resolution Length = 356
 Score =  118 bits (294), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 71/380 (18%), Positives = 123/380 (32%), Gaps = 39/380 (10%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           T + +  L  LI  PS++ ++  A   L N ++  G          +  + V  L   F 
Sbjct: 10  TAEAVSLLKSLISIPSISREETQAADFLQNYIEAEGXQT------GRKGNNVWCLSPXFD 63

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
            + P ++   HID V     N W   PF+     GK+YG G  D   S+   +    +  
Sbjct: 64  LKKPTILLNSHIDTV--KPVNGWRKDPFTPREENGKLYGLGSNDAGASVVSLLQVFLQLC 121

Query: 122 PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
              +N+  I L    +E          +              IVGEPT            
Sbjct: 122 RTSQNYNLIYLASCEEEVSGKEGIESVLPG-----LPPVSFAIVGEPTEXQP------AI 170

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
               L         +   A     +N I  ++  +    +  F+  +    P    +T I
Sbjct: 171 AEKGLXVLDVTATGKAGHAARDEGDNAIYKVLNDIAWFRDYRFEKESPLLGPVKXSVTVI 230

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
           +      NV+P +     +IR N+L++ + L  EIR  +    +      ++        
Sbjct: 231 NA-GTQHNVVPDKCTFVVDIRSNELYSNEDLFAEIRKHIACDAKARSFRLNS-------- 281

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLV-GRTMHAL 360
              +           K      G+  L       SD          ++ G       H  
Sbjct: 282 -SRIDEKHPFVQKAVKXGRIPFGSPTL-------SDQALXS--FASVKIGPGRSSRSHTA 331

Query: 361 NENASLQDLEDLTCIYENFL 380
            E   L+++E+   IY + L
Sbjct: 332 EEYIXLKEIEEAIGIYLDLL 351