BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780782|ref|YP_003065195.1| succinyl-diaminopimelate
desuccinylase [Candidatus Liberibacter asiaticus str. psy62]
         (389 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780782|ref|YP_003065195.1| succinyl-diaminopimelate desuccinylase [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040459|gb|ACT57255.1| succinyl-diaminopimelate desuccinylase [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 389

 Score =  317 bits (811), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 389/389 (100%), Positives = 389/389 (100%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF
Sbjct: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF
Sbjct: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120

Query: 121 IPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
           IPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI
Sbjct: 121 IPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT
Sbjct: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV 300
           IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV
Sbjct: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV 300

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL 360
           SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL
Sbjct: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL 360

Query: 361 NENASLQDLEDLTCIYENFLQNWFITPSQ 389
           NENASLQDLEDLTCIYENFLQNWFITPSQ
Sbjct: 361 NENASLQDLEDLTCIYENFLQNWFITPSQ 389


>gi|163867354|ref|YP_001608548.1| succinyl-diaminopimelate desuccinylase [Bartonella tribocorum CIP
           105476]
 gi|238055171|sp|A9ILD7|DAPE_BART1 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|161016995|emb|CAK00553.1| succinyl-diaminopimelate desuccinylase [Bartonella tribocorum CIP
           105476]
          Length = 390

 Score =  281 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 213/385 (55%), Positives = 264/385 (68%), Gaps = 3/385 (0%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D L+ L  LI+CPSVTP + GA   L   LK +GF +E   F  KNT  V+NLYA+ G E
Sbjct: 6   DPLQLLQALIRCPSVTPHEAGALSALEQFLKKMGFHVERPIFTDKNTDNVENLYAKMGNE 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVPPG    WTYPPF A I +GK+YGRG VDMKG IACFIAA+AR + K
Sbjct: 66  GPHLMFAGHTDVVPPGALEDWTYPPFEAVIDQGKLYGRGAVDMKGGIACFIAALARVLEK 125

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               G +SLLITGDEEG AINGT K+L W EKKGEKW A +VGEPT    +GD IKIGRR
Sbjct: 126 RSIKGRVSLLITGDEEGTAINGTVKLLKWAEKKGEKWTAALVGEPTSVKTVGDIIKIGRR 185

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS+SG IT+ G+QGHVA+P    NP+     L+  LT I  D G   F P+N+E+TTID 
Sbjct: 186 GSISGIITVKGRQGHVAFPERAANPLPLASKLIQALTQIALDQGTENFQPSNLELTTIDT 245

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRL---IKGIQNVPKLSHTVHFSSPV 300
           GN + NVIPAQ  + FNIR+NDLW ++TL EEI  RL    +   +     + + +   +
Sbjct: 246 GNLAVNVIPAQTTVRFNIRYNDLWTKETLMEEIEKRLSLVQEKNNSGQYPFYQLEWIPSL 305

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL 360
             VFLT + KL  +LS +I + TG++P  STSGGTSDARFIKDYCPV+EFGL G+TMH +
Sbjct: 306 GDVFLTKNDKLIQVLSNAIKSVTGSLPECSTSGGTSDARFIKDYCPVVEFGLPGQTMHMV 365

Query: 361 NENASLQDLEDLTCIYENFLQNWFI 385
           +E  +L  +E LT IYE F+ ++F+
Sbjct: 366 DECVALDAVETLTAIYERFIIDFFV 390


>gi|209965578|ref|YP_002298493.1| succinyl-diaminopimelate desuccinylase [Rhodospirillum centenum SW]
 gi|238064798|sp|B6IPH8|DAPE_RHOCS RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|209959044|gb|ACI99680.1| succinyl-diaminopimelate desuccinylase [Rhodospirillum centenum SW]
          Length = 386

 Score =  279 bits (712), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 186/386 (48%), Positives = 240/386 (62%), Gaps = 7/386 (1%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M PD +     LI+CPSVTP D GA   + + L+ LGF+     FQ   T  V NLYAR 
Sbjct: 1   MAPDPIALARDLIRCPSVTPADAGALDRVQSVLEGLGFTCHRLPFQEPGTERVDNLYARL 60

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G + P+  FAGH DVVP GD   WT  PF   I +G++YGRG  DMKG +A FIAAV  F
Sbjct: 61  GDKGPNFCFAGHTDVVPAGDAAAWTVDPFGGEIIDGRLYGRGAADMKGGVAAFIAAVGSF 120

Query: 121 IPKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + +     GSISLLITGDEEGPA+NGT+K+L W+   GE+ DAC+VGEPT    +GD IK
Sbjct: 121 LERNGPPAGSISLLITGDEEGPAVNGTRKVLDWMAAAGERIDACLVGEPTNPRALGDMIK 180

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           +GRRGSL+  +T  G QGH AYPHL +NP+  L   LH L +   D G   F P+ + +T
Sbjct: 181 VGRRGSLTATLTALGAQGHTAYPHLADNPLPRLAEALHLLASSPLDMGTPHFQPSTLALT 240

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           +IDVGNP+ NVIPA+    FNIRFNDL   ++L+  IR  L +           +   + 
Sbjct: 241 SIDVGNPASNVIPARGTARFNIRFNDLHTPESLEAHIRDVLEEVGGA-----WELALQTS 295

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
                      L+ +++ ++   TG  P LSTSGGTSDARFIKD+CPV+EFGLVG +MH 
Sbjct: 296 GVAFLTPP-GALSDIVAAAVEAHTGRTPELSTSGGTSDARFIKDHCPVVEFGLVGASMHK 354

Query: 360 LNENASLQDLEDLTCIYENFLQNWFI 385
           ++EN ++ DL +LT IY   L+ WF 
Sbjct: 355 VDENVAVADLLELTAIYRTVLERWFA 380


>gi|148258518|ref|YP_001243103.1| succinyl-diaminopimelate desuccinylase [Bradyrhizobium sp. BTAi1]
 gi|238055174|sp|A5ESQ3|DAPE_BRASB RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|146410691|gb|ABQ39197.1| succinyldiaminopimelate desuccinylase [Bradyrhizobium sp. BTAi1]
          Length = 384

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 188/387 (48%), Positives = 244/387 (63%), Gaps = 5/387 (1%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT D L     LI+CPSVTP D GA  +L   LK  GF+     F    T+ + NLYAR 
Sbjct: 1   MT-DALTITRDLIRCPSVTPADAGALGVLEALLKQAGFTTHRITFSEAGTADIDNLYARI 59

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GTE PH+ FAGH DVVPPGD   W+ P FS  + +G IYGRG VDMKG IAC +AA   +
Sbjct: 60  GTEGPHITFAGHTDVVPPGDEAAWSLPAFSGEVRDGYIYGRGAVDMKGGIACSVAAALDY 119

Query: 121 IPKY--KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           +  +  +  GSIS LITGDEE  +INGT K+L W  ++GEK+D C++GEP+   ++GD I
Sbjct: 120 LRDHDGQPKGSISFLITGDEEDVSINGTIKLLQWAAERGEKFDHCVLGEPSNQEVMGDCI 179

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGS SG + + G+QGHVAYPH  ENP+  +  L+  L++   D G+  F P+N+E 
Sbjct: 180 KIGRRGSQSGTLIVEGRQGHVAYPHRAENPVPDISRLIVALSDEPLDHGSAQFQPSNLEF 239

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           T++DVGN + NVIP   +  FNIR+ND   + +L+  +  RL K   N  +    + +  
Sbjct: 240 TSVDVGNTASNVIPGLARAKFNIRYNDCHTQDSLRALVEERLAKACGNRIRAH--IDWLP 297

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
             S VFLT     T L   +I + TG  P LST+GGTSDARFI  YCPVIEFGLVG+TMH
Sbjct: 298 SNSKVFLTKPGPFTDLAVAAIESVTGRKPELSTTGGTSDARFIASYCPVIEFGLVGQTMH 357

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            ++E AS+ D+  LT IY   L  +F 
Sbjct: 358 QIDERASVADIATLTKIYRGILDRYFA 384


>gi|240849727|ref|YP_002971115.1| succinyl-diaminopimelate desuccinylase [Bartonella grahamii as4aup]
 gi|240266850|gb|ACS50438.1| succinyl-diaminopimelate desuccinylase [Bartonella grahamii as4aup]
          Length = 390

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 212/385 (55%), Positives = 262/385 (68%), Gaps = 3/385 (0%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D L+ L +LI+CPSVTP + GA   L   LK +GF +E   F  KNT  V+NLYA+ G E
Sbjct: 6   DPLQLLQRLIRCPSVTPHEAGALSTLEQFLKKMGFHVERPIFTDKNTDNVENLYAKMGNE 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVPPG  + WTY PF A I +GK+YGRG VDMKG IACFIAA+AR + K
Sbjct: 66  GPHLMFAGHTDVVPPGALDEWTYSPFEAVIDQGKLYGRGAVDMKGGIACFIAALARVLEK 125

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               G +S LITGDEEGPA+NGT K+L W EKKGEKW A +VGEPT    +GD IKIGRR
Sbjct: 126 RSIKGMVSFLITGDEEGPAVNGTVKLLKWAEKKGEKWTAALVGEPTSVKTVGDVIKIGRR 185

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS+SG IT+ G+QGHVA+P    NP+     L+  LT    D G   F P+N+E+T+ID 
Sbjct: 186 GSISGIITVRGRQGHVAFPERAANPLPLASKLIQALTQTALDKGTEDFQPSNLELTSIDT 245

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRL---IKGIQNVPKLSHTVHFSSPV 300
           GN + NVIPAQ  + FNIR+NDLW ++TL EEI+ RL             S+ + +   +
Sbjct: 246 GNLAVNVIPAQTTVHFNIRYNDLWTKETLMEEIKKRLALVQSKNNGDQYPSYQLEWIPSL 305

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL 360
             VFLT + KL   LS +I + TGNIP  STSGGTSDARFIKDYCPV+EFGL G+TMH +
Sbjct: 306 GDVFLTKNDKLIQTLSNAIKSVTGNIPECSTSGGTSDARFIKDYCPVVEFGLPGQTMHMV 365

Query: 361 NENASLQDLEDLTCIYENFLQNWFI 385
           +E  +L  +E LT IYE F+ ++F 
Sbjct: 366 DECVALDAVETLTTIYERFIVDFFA 390


>gi|319407921|emb|CBI81575.1| succinyl-diaminopimelate desuccinylase [Bartonella schoenbuchensis
           R1]
          Length = 390

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 203/385 (52%), Positives = 256/385 (66%), Gaps = 3/385 (0%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D ++ L  LI+CPSVTP + GA   L + L  LGF++E   F  KNT  V+NLYA+ G +
Sbjct: 6   DPIQLLQALIRCPSVTPHEAGALSTLEHFLTKLGFTVERPVFVDKNTEDVENLYAKIGNK 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVPPG+  +WTYPPF   I +GK+YGRG VDMKG IACFIAA+AR   K
Sbjct: 66  GPHLMFAGHSDVVPPGELGNWTYPPFKGVIDQGKLYGRGAVDMKGGIACFIAALARVFKK 125

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               G+IS LITGDEEGPA+NGT K+L W  +KGEKW A IVGEPT   ++GD IKIGRR
Sbjct: 126 QPIKGTISFLITGDEEGPALNGTVKLLKWAVEKGEKWTAAIVGEPTSVKVVGDMIKIGRR 185

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS+SG I + G+QGHVA+P    NP+     L+  L     D G   F  +N+E+T+ID 
Sbjct: 186 GSISGIIRVQGRQGHVAFPERAANPLPLAHKLVQALIQTPLDQGTKNFQASNLELTSIDT 245

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKL---SHTVHFSSPV 300
           GN S N+IP    + FNIR+NDLW  +TL  E+ +RL              + + +   +
Sbjct: 246 GNCSVNIIPMHTVIRFNIRYNDLWTRETLIAEVENRLASVQSENNHNELPCYQLEWVPNL 305

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL 360
             VFLT + KL   LS +I + TGN P LSTSGGTSDARFIKDYCPV+EFGL G+TMH +
Sbjct: 306 GSVFLTQNGKLIETLSNAIESMTGNRPELSTSGGTSDARFIKDYCPVVEFGLPGQTMHMV 365

Query: 361 NENASLQDLEDLTCIYENFLQNWFI 385
           +E  +L  LE+LT IYE F+ ++F 
Sbjct: 366 DECVTLDALENLTSIYERFIVDFFA 390


>gi|146337889|ref|YP_001202937.1| succinyl-diaminopimelate desuccinylase [Bradyrhizobium sp. ORS278]
 gi|238055175|sp|A4YLC3|DAPE_BRASO RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|146190695|emb|CAL74699.1| Succinyl-diaminopimelate desuccinylase (SDAP) [Bradyrhizobium sp.
           ORS278]
          Length = 384

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 187/387 (48%), Positives = 240/387 (62%), Gaps = 5/387 (1%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT D L     LI+CPSVTP D GA  +L   LK  GF+     F    T+ + NLYAR 
Sbjct: 1   MT-DALTITRDLIRCPSVTPADAGALGVLEALLKQAGFTTHRVTFSEPGTADIDNLYARI 59

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GTE PH+ FAGH DVVPPGD   W+ P FS  + +G IYGRG VDMKG IAC +AA   +
Sbjct: 60  GTEGPHITFAGHTDVVPPGDEASWSLPAFSGEVKDGYIYGRGAVDMKGGIACSVAAALDY 119

Query: 121 IPKY--KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           +  +  +  GSIS LITGDEE  +INGT K+L W   +GE +D C++GEP+   ++GD I
Sbjct: 120 LRDHGSQPKGSISFLITGDEEDVSINGTIKLLQWAADRGETFDHCVLGEPSNQEVMGDCI 179

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGS SG + + GKQGHVAYPH   NP+  +  L+  L++   D G+  F P+N+E 
Sbjct: 180 KIGRRGSQSGTLIVEGKQGHVAYPHRASNPVPDISRLIVALSDEPLDNGSAQFQPSNLEF 239

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           TT+DVGN + NVI    +  FNIR+ND   +++L+  +  RL K   N  +    + +  
Sbjct: 240 TTVDVGNTATNVIAGIARAKFNIRYNDCHTQESLRALVEQRLAKACGNRIRAH--IDWLP 297

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
             S VFLT     T L   +I   TG  P LST+GGTSDARFI  YCPVIEFGLVG+TMH
Sbjct: 298 SNSDVFLTKPGPFTDLAVAAIEEVTGRKPELSTTGGTSDARFISSYCPVIEFGLVGQTMH 357

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            ++E AS+ D+  LT IY   L  +F 
Sbjct: 358 QIDERASVADIATLTKIYRGILDRYFA 384


>gi|188580855|ref|YP_001924300.1| succinyl-diaminopimelate desuccinylase [Methylobacterium populi
           BJ001]
 gi|238064790|sp|B1ZGA7|DAPE_METPB RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|179344353|gb|ACB79765.1| succinyl-diaminopimelate desuccinylase [Methylobacterium populi
           BJ001]
          Length = 387

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 200/389 (51%), Positives = 250/389 (64%), Gaps = 5/389 (1%)

Query: 1   MTPD-CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           M+    L     LI+CPSVTP++GGA   L   L   GFS+E   F    T  ++NLYAR
Sbjct: 1   MSDQSPLALAHALIRCPSVTPEEGGALSFLAERLTEAGFSVERPVFSEAGTPDIENLYAR 60

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT  P L+FAGH DVVPPG+   WT+ PFS  I +G +YGRG VDMKG IAC +AA   
Sbjct: 61  IGTAGPVLVFAGHTDVVPPGEAASWTHGPFSGEITDGFLYGRGAVDMKGGIACMLAATLS 120

Query: 120 FIPKYKNF--GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDT 177
           F+ ++     GSI+ LITGDEEGPA+NGT K+L W + +GE++D C++GEPT    +G+ 
Sbjct: 121 FLDRHGPDFGGSIAFLITGDEEGPAVNGTVKLLDWAKARGERFDHCLLGEPTNPDSLGEM 180

Query: 178 IKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNME 237
           IKIGRRGSL+G IT+HG+QGHVAYPH  ENPI GL+ L   L     D G   F  +N+E
Sbjct: 181 IKIGRRGSLTGRITVHGRQGHVAYPHRAENPIPGLLRLASALIAEPLDGGTAHFDASNLE 240

Query: 238 ITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFS 297
            TTIDVGNP+ NVIPA  K  FN+RFND W  +TL  EIR RL         +  ++   
Sbjct: 241 FTTIDVGNPATNVIPASAKAVFNVRFNDDWTAETLGAEIRKRLEA--AAGNAVRFSLDLQ 298

Query: 298 SPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTM 357
              SP FLT       L++ +I   TG  P LST+GGTSDARFIKD CPVIEFGLVGRTM
Sbjct: 299 PSNSPAFLTQPDAFVDLVADAIAAETGRRPALSTTGGTSDARFIKDACPVIEFGLVGRTM 358

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFIT 386
           H  +E  ++ DL+ LT IY   L+ +F +
Sbjct: 359 HETDERVAVADLDRLTAIYGRVLERYFSS 387


>gi|116250205|ref|YP_766043.1| succinyl-diaminopimelate desuccinylase [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|238064796|sp|Q1MM75|DAPE_RHIL3 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|115254853|emb|CAK05927.1| putative succinyl-diaminopimelate desuccinylase [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 397

 Score =  275 bits (703), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 215/393 (54%), Positives = 276/393 (70%), Gaps = 8/393 (2%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT  D + +L  LI+CPSVTP +GGA   L   L  LGF+++      + T  ++NLYAR
Sbjct: 1   MTATDPVANLQTLIRCPSVTPAEGGALSALEAMLAPLGFTVDRVKASEEGTPDIENLYAR 60

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+ PHLMFAGH DVVP GD   WT+PPF+A I++G+++GRG VDMKG IACF+AAVAR
Sbjct: 61  LGTDGPHLMFAGHTDVVPVGDEAAWTHPPFAAEISKGELFGRGAVDMKGGIACFVAAVAR 120

Query: 120 FIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
            I K     GSIS LITGDEEGPAINGT K+L W  ++GE+WDAC+VGEPT    +GD I
Sbjct: 121 HIEKSGQPKGSISFLITGDEEGPAINGTIKLLQWAAERGERWDACLVGEPTNPDRLGDMI 180

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGSLSG+IT+HG QGH AYPHL +NP+RG++ + H L +  FD G   F P+N+E+
Sbjct: 181 KIGRRGSLSGKITVHGVQGHAAYPHLADNPVRGMLQMTHALMDPPFDGGTDDFQPSNLEV 240

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLI------KGIQNVPKLSH 292
           TT+DVGNP+ NVIPA+   SFNIRFND W  +TL+ EI  RL       +       + +
Sbjct: 241 TTVDVGNPATNVIPAKASASFNIRFNDSWTVETLRAEILRRLDAAAGNGELRPGRDPVKY 300

Query: 293 TVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGL 352
            + ++   S VFLT +  L + LS ++ + +G  P LST+GGTSDARFIKDYCPV+EFGL
Sbjct: 301 DIVWADRPSHVFLTRNNALIASLSSAVESVSGQSPKLSTTGGTSDARFIKDYCPVVEFGL 360

Query: 353 VGRTMHALNENASLQDLEDLTCIYENFLQNWFI 385
           VG+TMH ++E  ++ DLE LT IYE F+  WF 
Sbjct: 361 VGQTMHMVDERVAVADLETLTAIYETFIARWFA 393


>gi|222147378|ref|YP_002548335.1| succinyl-diaminopimelate desuccinylase [Agrobacterium vitis S4]
 gi|238055204|sp|B9JZL9|DAPE_AGRVS RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|221734368|gb|ACM35331.1| succinyl-diaminopimelate desuccinylase [Agrobacterium vitis S4]
          Length = 404

 Score =  275 bits (703), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 219/388 (56%), Positives = 271/388 (69%), Gaps = 7/388 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +++L  LI+CPSVTP +GGA   L   L+ LGF++E    + + T  V+NLYAR GTE
Sbjct: 12  DPVDNLQTLIRCPSVTPAEGGALSALAAMLEPLGFTVERMVAREEGTPDVENLYARLGTE 71

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVP G+   WTYPPFSA IA G++YGRG VDMKG IACF+AA+AR I  
Sbjct: 72  GPHLMFAGHTDVVPVGNEADWTYPPFSAEIAGGELYGRGAVDMKGGIACFVAAIARHIES 131

Query: 124 YK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
                GSIS LITGDEEGP+INGT K+L W   KGE+WDAC+VGEPT    +GD IKIGR
Sbjct: 132 QGAPKGSISFLITGDEEGPSINGTTKLLEWAAAKGERWDACLVGEPTNPDQLGDMIKIGR 191

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSLSGEI + G QGH AYPHL +NP+RG+I L   L +  FD G   F P+N+E+TTID
Sbjct: 192 RGSLSGEIIVKGVQGHAAYPHLADNPVRGMIKLAEALMHPAFDAGTENFQPSNLEVTTID 251

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQN------VPKLSHTVHF 296
           VGN + NVIPA+    FNIRFND W  +TL+ EI +RL     +       P +++ + +
Sbjct: 252 VGNAATNVIPARASAKFNIRFNDTWTAETLRTEIIARLDTASADPLLRPGRPPIAYELVW 311

Query: 297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRT 356
           +   S VFLT +  L S LS +I   TG  P LST+GGTSDARFIKDYCPV+EFGLVG+T
Sbjct: 312 ADRPSQVFLTRNNALISSLSAAIEKMTGKTPALSTTGGTSDARFIKDYCPVVEFGLVGQT 371

Query: 357 MHALNENASLQDLEDLTCIYENFLQNWF 384
           MH ++E  ++ DLE LT IY  F+ +WF
Sbjct: 372 MHMVDERVAVSDLEALTGIYGAFISSWF 399


>gi|319898241|ref|YP_004158334.1| succinyl-diaminopimelate desuccinylase [Bartonella clarridgeiae 73]
 gi|319402205|emb|CBI75736.1| succinyl-diaminopimelate desuccinylase [Bartonella clarridgeiae 73]
          Length = 388

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 209/383 (54%), Positives = 266/383 (69%), Gaps = 1/383 (0%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D ++ L  LI+CPSVTP + G    L + L+ +GF +E   F  KNT  V+NLYA+ G+E
Sbjct: 6   DPVQLLQALIRCPSVTPHEAGVLSTLEHFLRKMGFCVERPVFVDKNTEDVENLYAKIGSE 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVPPG+  +WTYPPF   I +G++YGRG VDMKG IACFIAA+ARF+ K
Sbjct: 66  GPHLMFAGHSDVVPPGELENWTYPPFEGVINQGRLYGRGAVDMKGGIACFIAALARFLKK 125

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               G +S LITGDEEGPAINGT K+L W  KKGEKW+A IVGEPT  +I+GDTIKIGRR
Sbjct: 126 KSLKGMVSFLITGDEEGPAINGTVKLLEWAVKKGEKWNAAIVGEPTSINIVGDTIKIGRR 185

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS+SG IT+ G QGHVA+P    NP+     L+  LT    D G   F  +++E+T+ID 
Sbjct: 186 GSISGIITVKGYQGHVAFPERAANPLPLANKLIQALTQNALDQGTKDFQASHLELTSIDT 245

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGI-QNVPKLSHTVHFSSPVSP 302
           GN S N+IPAQ  + FNIR+NDLW ++TL  EI  RL     +N     + + +   +  
Sbjct: 246 GNFSVNIIPAQTVIRFNIRYNDLWTKETLIAEIEKRLAFVHSKNDQVPYYQLEWIYGLGG 305

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNE 362
           VFLT + KL  +LS +I + TGNIP  STSGGTSDARFIKDYCPV+EFGL G+TMH ++E
Sbjct: 306 VFLTKNDKLVGILSNAIKSITGNIPECSTSGGTSDARFIKDYCPVVEFGLPGQTMHMVDE 365

Query: 363 NASLQDLEDLTCIYENFLQNWFI 385
             +L  +E+LT IYE F+ ++F 
Sbjct: 366 YVTLDAIENLTSIYERFITDFFA 388


>gi|298293966|ref|YP_003695905.1| succinyl-diaminopimelate desuccinylase [Starkeya novella DSM 506]
 gi|296930477|gb|ADH91286.1| succinyl-diaminopimelate desuccinylase [Starkeya novella DSM 506]
          Length = 397

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 194/389 (49%), Positives = 249/389 (64%), Gaps = 8/389 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +E L  LI+CPS+TP++GGA   L + L+  GF++      + NT  V+NLYARFG +
Sbjct: 8   DPVEILRALIRCPSITPEEGGALAFLESLLRAAGFTVHRVKLTSPNTPDVENLYARFGDK 67

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            P+L FAGH DVVPPGD  HW +PPF   I +G IYGRG VDMKG +A FIAA   F   
Sbjct: 68  GPNLCFAGHTDVVPPGDPEHWRFPPFEGAIHDGLIYGRGAVDMKGGVAAFIAAGLDFAGA 127

Query: 124 YKN------FGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDT 177
                     GSIS LITGDEEGPAINGT+K+L W+  + E+ D C++GEP+    +GD 
Sbjct: 128 NGWSGDGALPGSISFLITGDEEGPAINGTEKLLRWLADRDERIDHCVLGEPSSRAALGDM 187

Query: 178 IKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNME 237
           +KIGRRGSLSG +T+HGKQGHV YPHL ENPI G++ LL  L     D G   F  +N+E
Sbjct: 188 VKIGRRGSLSGSLTVHGKQGHVGYPHLAENPIPGMVKLLAGLQAEPLDRGTEHFQASNLE 247

Query: 238 ITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFS 297
           + ++DVGNP+ NVIPA+ +  FNIRFN+LW   TL  EI  RL     N  + S  +   
Sbjct: 248 VVSVDVGNPAFNVIPAEARARFNIRFNELWTPATLTAEIERRLKAAAGNEVRFSLAIEPR 307

Query: 298 SPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTM 357
           +     FLT   +   L+  +I   TG  P LST+GGTSDARFIKDYCPV+EFGLVG TM
Sbjct: 308 NS--DSFLTAPGEFVDLVVDAIATATGQKPELSTTGGTSDARFIKDYCPVVEFGLVGTTM 365

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFIT 386
           H ++E   + ++E LT +Y   +  +F  
Sbjct: 366 HQVDEATPVDEVERLTDVYAGIIARYFAA 394


>gi|325291804|ref|YP_004277668.1| succinyl-diaminopimelate desuccinylase [Agrobacterium sp. H13-3]
 gi|325059657|gb|ADY63348.1| succinyl-diaminopimelate desuccinylase [Agrobacterium sp. H13-3]
          Length = 398

 Score =  274 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 215/390 (55%), Positives = 271/390 (69%), Gaps = 7/390 (1%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           T D + +L  LI+CPSVTP +GGA  +L   L  LGF++E+       T  V+NLYAR G
Sbjct: 3   TTDPVANLAALIRCPSVTPAEGGALSLLDTLLSPLGFAVEKMVATEAGTPDVENLYARLG 62

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
           TE PHLM AGH DVVP GD   W++PPF+A IA G+++GRG VDMKG IACF+AA+AR+I
Sbjct: 63  TEGPHLMLAGHTDVVPVGDEAAWSHPPFAAEIAGGEMFGRGAVDMKGGIACFVAAIARYI 122

Query: 122 PKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
            K+ K  GS+S LITGDEEGP+INGT K+L W   KGE WDAC+VGEPT    +G+ IKI
Sbjct: 123 EKHGKPKGSVSFLITGDEEGPSINGTSKLLEWAAAKGETWDACVVGEPTNPDQLGEMIKI 182

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGS+SG IT+HG QGH AYPHL +NPIRGL+ L H L    FD G   F P+N+E+TT
Sbjct: 183 GRRGSISGRITVHGVQGHAAYPHLADNPIRGLLQLTHALMYPPFDHGTDDFQPSNLEVTT 242

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLI------KGIQNVPKLSHTV 294
           ID GN + NVIPA+   SFNIRFND W  ++L+ EI  RL       +   +   + + +
Sbjct: 243 IDTGNAATNVIPARATASFNIRFNDSWTVESLRAEIIRRLDAAAAEGELRPDRSPVKYEI 302

Query: 295 HFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVG 354
            ++   + VFLT +  L S LS ++   TG  P LST+GGTSDARFIKDYCPV+EFGLVG
Sbjct: 303 VWADRPAHVFLTRNNALISSLSGAVEAVTGKEPKLSTTGGTSDARFIKDYCPVVEFGLVG 362

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNWF 384
           +TMH ++E   + DLE LT IYE F++ WF
Sbjct: 363 QTMHMVDERVEIADLETLTRIYETFIERWF 392


>gi|110632750|ref|YP_672958.1| succinyl-diaminopimelate desuccinylase [Mesorhizobium sp. BNC1]
 gi|122966267|sp|Q11LD2|DAPE_MESSB RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|110283734|gb|ABG61793.1| succinyldiaminopimelate desuccinylase [Chelativorans sp. BNC1]
          Length = 395

 Score =  274 bits (699), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 216/392 (55%), Positives = 270/392 (68%), Gaps = 8/392 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           +  D  ++L  LI+C SVTP +GGA   L   L+ LG  ++   F  +  + V+NLYAR 
Sbjct: 3   LPTDPAQNLASLIRCRSVTPVEGGALTALEAMLRPLGARVDRPVFSEEGEADVENLYARI 62

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G + PHLMFAGH DVVPPGD + WT+PPF+A IA G+++GRG VDMKG IACF+AA+AR 
Sbjct: 63  GKDGPHLMFAGHTDVVPPGDEDAWTHPPFAAEIAGGEMFGRGAVDMKGGIACFVAALARH 122

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +       GS+S LITGDEEGP++NG+ K+L W   +GE+WDA +VGEPT    +GD +K
Sbjct: 123 LEVSGTPKGSVSFLITGDEEGPSVNGSVKLLEWAAARGERWDAALVGEPTNVETLGDMVK 182

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGSLSG IT+ G+QGHVAYPHL +NP RGL+ LL  L    FD G   F PTN+EIT
Sbjct: 183 IGRRGSLSGRITLFGRQGHVAYPHLADNPSRGLVALLEALMEPAFDQGTADFPPTNLEIT 242

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLS-------H 292
           TIDVGNPS NVIPA+   +FN+RFND W+ +TL+ EI +RL +                 
Sbjct: 243 TIDVGNPSVNVIPARATAAFNVRFNDTWSVETLQAEIHNRLDRAAAENRLRPGRTEPVSF 302

Query: 293 TVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGL 352
            + +    SPVFLT D KL + L+ SI   TG  P LST+GGTSDARFIKDYCPVIEFGL
Sbjct: 303 ELEWRDRPSPVFLTRDDKLVATLAASIEAVTGRKPQLSTTGGTSDARFIKDYCPVIEFGL 362

Query: 353 VGRTMHALNENASLQDLEDLTCIYENFLQNWF 384
           VG+TMH ++E   L DLE LT IY+ FL+NWF
Sbjct: 363 VGQTMHMVDEKVPLSDLETLTRIYQRFLENWF 394


>gi|327191112|gb|EGE58160.1| succinyl-diaminopimelate desuccinylase protein [Rhizobium etli
           CNPAF512]
          Length = 396

 Score =  273 bits (697), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 218/392 (55%), Positives = 269/392 (68%), Gaps = 7/392 (1%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT  D + +L  LI+CPSVTP +GGA   L   L  LGF I+        T  ++NLYAR
Sbjct: 1   MTATDPVANLQTLIRCPSVTPAEGGALTALEAMLAPLGFKIDRVKASEDGTPDIENLYAR 60

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            G + PHLMFAGH DVVP GD   WT+PPF+A IA+G+++GRG VDMKG IACF+AAVAR
Sbjct: 61  LGRDGPHLMFAGHTDVVPVGDEAAWTHPPFAAEIAKGELFGRGAVDMKGGIACFVAAVAR 120

Query: 120 FIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
            I K    GSISLLITGDEEGPAINGT K+L W  ++GE+WDAC+VGEPT    +GD IK
Sbjct: 121 HIEKNGPAGSISLLITGDEEGPAINGTIKLLQWATERGERWDACLVGEPTNPDRLGDMIK 180

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGSLSG IT+HG QGH AYPHL +NP+RG++ L   L +  FD G   F P+N+E+T
Sbjct: 181 IGRRGSLSGRITVHGVQGHAAYPHLADNPVRGIVQLTQALMDPPFDGGTDDFQPSNLEVT 240

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKG------IQNVPKLSHT 293
           T+DVGNP+ NVIPA+   SFNIRFND W   TL+ EI  RL               + + 
Sbjct: 241 TVDVGNPATNVIPAKASASFNIRFNDSWTVDTLRAEILRRLDAAAGNGQLRPGREPVKYD 300

Query: 294 VHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLV 353
           + ++   S VFLT +  L + LS +I +  G  P LST+GGTSDARFIKDYCPV+EFGLV
Sbjct: 301 IVWADRPSHVFLTRNNALIASLSSAIESVAGRSPALSTTGGTSDARFIKDYCPVVEFGLV 360

Query: 354 GRTMHALNENASLQDLEDLTCIYENFLQNWFI 385
           G+TMH ++E  ++ DLE LT IYE F+  WF 
Sbjct: 361 GQTMHMVDERVAVADLETLTAIYETFIDRWFA 392


>gi|300021567|ref|YP_003754178.1| succinyl-diaminopimelate desuccinylase [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299523388|gb|ADJ21857.1| succinyl-diaminopimelate desuccinylase [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 390

 Score =  273 bits (697), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 186/385 (48%), Positives = 243/385 (63%), Gaps = 4/385 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +     LI+C SVTP +GGA  +L N L+  GF+     F    T  V NLYAR G+ 
Sbjct: 7   DPVTLTQALIRCESVTPDEGGALTLLQNVLEPAGFTCHRLVFSEPGTPDVDNLYARLGSG 66

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHL FAGH DVVP GD   WT PPFS  I +GK+YGRG VDMKG +A F++A  ++I  
Sbjct: 67  RPHLSFAGHTDVVPVGDEKVWTVPPFSGDIRDGKVYGRGAVDMKGCVAAFVSAALKYIHH 126

Query: 124 YK--NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
           +     GS+S LITGDEEGP+INGT K+L W++ + E  DAC+VGEP+    +GD I+IG
Sbjct: 127 HNGLPRGSLSFLITGDEEGPSINGTMKILDWLKSRDEVVDACLVGEPSNPKALGDEIRIG 186

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGS++ EI +HGKQGH AYP L +NP+  L  L+ +L+    D G   F P+N+++T I
Sbjct: 187 RRGSVNAEIVVHGKQGHSAYPQLADNPVPKLARLIDRLSTAKLDDGTPDFQPSNLQVTVI 246

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
            V N + NVIP Q     NIR+NDLW+  T++  +R +L      V          S   
Sbjct: 247 SVPNTATNVIPGQAVAKINIRYNDLWHRPTIEAWVRDKLAHAAAEVGAKYEV--SFSGTG 304

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALN 361
            VFLT    L S L+ ++ + TG IP L+T GGTSDARFIKD CPV+EFGLV  T+H ++
Sbjct: 305 DVFLTKPGPLVSTLTDAVQSVTGRIPKLTTGGGTSDARFIKDICPVVEFGLVNATIHQVD 364

Query: 362 ENASLQDLEDLTCIYENFLQNWFIT 386
           E+ S+ DLE LT IY  F+ N+F T
Sbjct: 365 EHTSIVDLEQLTEIYGRFITNYFRT 389


>gi|49474876|ref|YP_032917.1| succinyl-diaminopimelate desuccinylase [Bartonella henselae str.
           Houston-1]
 gi|81648343|sp|Q6G567|DAPE_BARHE RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|49237681|emb|CAF26868.1| Succinyl-diaminopimelate desuccinylase [Bartonella henselae str.
           Houston-1]
          Length = 390

 Score =  272 bits (696), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 207/385 (53%), Positives = 258/385 (67%), Gaps = 3/385 (0%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D L+ L  LI+CPSVTP + GA   L   L  +GF +E   F  KNT  V+NLYA+ G E
Sbjct: 6   DPLQILQALIRCPSVTPHEAGALSTLEQFLTKMGFHVERPIFADKNTEDVENLYAKMGKE 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVPPGD  +W YPPF   I +GK+YGRG VDMKG IACF+AA AR + K
Sbjct: 66  GPHLMFAGHTDVVPPGDLENWKYPPFEGVIDQGKLYGRGAVDMKGGIACFVAAFARVLEK 125

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               G +SLLITGDEEGPA+NGT K+L W E+KGEKW A +VGEPT    +GD IKIGRR
Sbjct: 126 RTIKGRVSLLITGDEEGPALNGTVKLLKWAEQKGEKWTAALVGEPTSVKTVGDVIKIGRR 185

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS+SG +T+ G+QGHVA+P    NP+     L+  L     D G   F P+N+E+T ID 
Sbjct: 186 GSISGIMTVKGRQGHVAFPERAANPLPLASKLIQSLIQTTLDEGTENFQPSNLELTAIDT 245

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRL---IKGIQNVPKLSHTVHFSSPV 300
           GNP+ NVIPAQ  + FNIR+NDLW ++ L  EI +RL        N     + + +   +
Sbjct: 246 GNPAMNVIPAQATVHFNIRYNDLWTKEMLMAEIENRLALVQSKNNNGQYPYYQLEWIPSL 305

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL 360
             VFLT + KL + LS +I + TGNIP  STSGGTSDARFIKDYCPVIEFGL G+TMH +
Sbjct: 306 GDVFLTKNDKLINTLSNAIKSVTGNIPECSTSGGTSDARFIKDYCPVIEFGLPGQTMHMV 365

Query: 361 NENASLQDLEDLTCIYENFLQNWFI 385
           +E  ++  +E LT IYE F+ ++F 
Sbjct: 366 DECVTVDAMETLTSIYECFIVDFFA 390


>gi|121602384|ref|YP_989585.1| succinyl-diaminopimelate desuccinylase [Bartonella bacilliformis
           KC583]
 gi|238055170|sp|A1UUD2|DAPE_BARBK RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|120614561|gb|ABM45162.1| acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase
           [Bartonella bacilliformis KC583]
          Length = 390

 Score =  272 bits (695), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 203/385 (52%), Positives = 260/385 (67%), Gaps = 3/385 (0%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D ++ L  LI+CPS+TP + GA  IL   L+ +GFS+E   F  KNT+ V+NLYA+ G +
Sbjct: 6   DPVQLLQALIRCPSITPNEAGALSILEQFLRKMGFSVERPIFSDKNTADVENLYAKMGNK 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVPPG+ ++W YPPF   I +GKIYGRG VDMKG+IACFIAA+AR + K
Sbjct: 66  GPHLMFAGHSDVVPPGELDNWMYPPFEGIINQGKIYGRGAVDMKGAIACFIAALARVLEK 125

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               G++SLLITGDEEGPAINGT K+L W  +KGEKW+A IVGEPT    +GD IKIGRR
Sbjct: 126 QPIKGAVSLLITGDEEGPAINGTVKLLKWAAQKGEKWNAAIVGEPTSVKRVGDMIKIGRR 185

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS+SG IT+ G+QGHVA+P    NP+     L+  LT+   D G   F  +N+E+TTID 
Sbjct: 186 GSISGIITVKGRQGHVAFPERAANPLPLAHKLIQALTDTALDQGTKNFQASNLELTTIDT 245

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRL---IKGIQNVPKLSHTVHFSSPV 300
           GN + N+IPAQ  + FNIR+NDLW ++ L  EI  RL        +     + + +   +
Sbjct: 246 GNSATNIIPAQTVIRFNIRYNDLWTKEALIAEIEKRLALVHSENNSNQYPYYQLEWIQNL 305

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL 360
             VFL  +  L  +LS +I   TG  P  STSGGTSDARFIKDYCPV+EFGL G TMH +
Sbjct: 306 GSVFLIKNDHLIEILSNAIEIVTGKRPECSTSGGTSDARFIKDYCPVVEFGLPGNTMHMV 365

Query: 361 NENASLQDLEDLTCIYENFLQNWFI 385
           +E  +L  +E LT IYE F+ ++F 
Sbjct: 366 DECVTLDAMESLTVIYERFIIDFFA 390


>gi|319403534|emb|CBI77115.1| succinyl-diaminopimelate desuccinylase [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 388

 Score =  272 bits (695), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 210/383 (54%), Positives = 267/383 (69%), Gaps = 1/383 (0%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D ++ L  LI+CPSVTP + GA   L + L+ +GF +E   F  KN   V+NLYA+ G+E
Sbjct: 6   DPVQILQTLIRCPSVTPHEAGALSTLEHFLRKMGFCVERPIFVDKNAEDVENLYAKIGSE 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVPPG+  +WTYPPF   I++GK+YGRG VDMKG IACFIAA+ARF+ K
Sbjct: 66  GPHLMFAGHSDVVPPGELENWTYPPFEGVISQGKLYGRGAVDMKGGIACFIAAMARFLKK 125

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               G +S LITGDEEGPAINGT K+L W  +KGEKW+A IVGEPT  +I+GD IKIGRR
Sbjct: 126 KTLKGMVSFLITGDEEGPAINGTVKLLEWAVQKGEKWNAAIVGEPTSVNIVGDMIKIGRR 185

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS+SG ITI G QGHVA+P    NP+     L+  LT    D G   F  +++E+T+ID 
Sbjct: 186 GSISGIITIKGCQGHVAFPERAANPLPLASKLIQALTQTALDQGTKDFQASHLELTSIDT 245

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGI-QNVPKLSHTVHFSSPVSP 302
           GN S N+IPAQ  + FNIR+NDLW ++TL  EI  RL     +N   L + + +   +  
Sbjct: 246 GNLSVNIIPAQTVIRFNIRYNDLWTKETLVAEIEKRLASVHSENDQVLYYQLEWICSLGD 305

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNE 362
           VFLT + KL  +LS +I + TGNIP  STSGGTSDARFIKDYCPV+EFGL G+TMH ++E
Sbjct: 306 VFLTKNDKLIGILSNAIKSVTGNIPECSTSGGTSDARFIKDYCPVVEFGLPGQTMHMVDE 365

Query: 363 NASLQDLEDLTCIYENFLQNWFI 385
             +L  +E+LT IYE F+ ++F 
Sbjct: 366 CVTLDAIENLTSIYERFITDFFA 388


>gi|241202832|ref|YP_002973928.1| succinyl-diaminopimelate desuccinylase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240856722|gb|ACS54389.1| succinyl-diaminopimelate desuccinylase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 397

 Score =  272 bits (695), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 214/393 (54%), Positives = 272/393 (69%), Gaps = 8/393 (2%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT  D + +L  LI+CPSVTP +GGA   L   L  LGF+++      + T  ++NLYAR
Sbjct: 1   MTATDPVANLQTLIRCPSVTPAEGGALTALEAMLAPLGFALDRVKASEEGTPEIENLYAR 60

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            G + PHLMFAGH DVVP GD   WT+PPF A I++G+++GRG VDMKG IACF+AAVAR
Sbjct: 61  LGKDGPHLMFAGHTDVVPVGDEAAWTHPPFEAQISKGELFGRGAVDMKGGIACFVAAVAR 120

Query: 120 FIPKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
            I K     GSIS LITGDEEGPAINGT K+L W  ++GE+WDAC+VGEPT    +GD I
Sbjct: 121 HIEKNGPPNGSISFLITGDEEGPAINGTIKLLQWAAERGERWDACLVGEPTNPDRLGDMI 180

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGSLSG+IT+HG QGH AYPHL +NP+RG++ L   L +  FD G   F P+N+E+
Sbjct: 181 KIGRRGSLSGKITVHGVQGHAAYPHLADNPVRGMLQLTQALMDPPFDAGTGDFQPSNLEV 240

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKG------IQNVPKLSH 292
           TT+DVGNP+ NVIPA+   SFNIRFND W  +TL+ EI  RL               +++
Sbjct: 241 TTVDVGNPATNVIPAKASASFNIRFNDSWTVETLRAEILRRLEAAAGNGALRPGRDPVAY 300

Query: 293 TVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGL 352
            + ++   S VFLT +  L + LS ++ +  G  P LST+GGTSDARFIKDYCPV+EFGL
Sbjct: 301 DIVWADRPSHVFLTRNNALIASLSSAVESVAGQSPRLSTTGGTSDARFIKDYCPVVEFGL 360

Query: 353 VGRTMHALNENASLQDLEDLTCIYENFLQNWFI 385
           VG+TMH ++E  ++ DLE LT IYE F+  WF 
Sbjct: 361 VGQTMHMVDERVAVADLETLTAIYETFIARWFA 393


>gi|114762093|ref|ZP_01441561.1| succinyl-diaminopimelate desuccinylase [Pelagibaca bermudensis
           HTCC2601]
 gi|114545117|gb|EAU48120.1| succinyl-diaminopimelate desuccinylase [Roseovarius sp. HTCC2601]
          Length = 381

 Score =  272 bits (694), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 165/387 (42%), Positives = 222/387 (57%), Gaps = 9/387 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT D +     LI+CPSVTP +GGA  +L   L+  GF+    D      +   NLYAR+
Sbjct: 1   MTTDPVALTADLIRCPSVTPDEGGALVLLQGLLEEAGFACTRVD-----RNGTSNLYARW 55

Query: 61  GTEA--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
           G +       F GH DVVP GD   W+  PF A I +G ++GRG  DMK  +A F AA  
Sbjct: 56  GEKGHARSFGFNGHTDVVPVGDAAAWSCDPFGAEIRDGVMFGRGATDMKSGVAAFAAAAM 115

Query: 119 RFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
            F+      G+I L ITGDEEG A +GT  +L W+ ++ E+   C+VGEPTC   +GD +
Sbjct: 116 DFVTDTPPDGAIVLAITGDEEGDATDGTVALLDWMAEQDERMSVCLVGEPTCPSEMGDMM 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGSLS   T+ G QGH AYPH   NP+  +  L+ +L +   DTG   F  + + +
Sbjct: 176 KIGRRGSLSAWFTVTGTQGHAAYPHRALNPMPAMARLMDRLASHELDTGTDHFDASTLAV 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
            TID GNP+ NVIPAQ + + NIRFND+     L + +R    K        +  V    
Sbjct: 236 VTIDTGNPATNVIPAQSRGTVNIRFNDIHTGAALSDWLREEAAKVDA-AFGTTTEVKIKI 294

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
                FLT    L+ L++ ++   TG  P LSTSGGTSDARF+KD+CPV+EFGLVG+TMH
Sbjct: 295 SG-ESFLTPPGPLSDLVAAAVEAETGRTPELSTSGGTSDARFVKDHCPVVEFGLVGKTMH 353

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            ++EN  +  +  L  IY   L+++F 
Sbjct: 354 QVDENVPVDQIARLKEIYTRILRDYFA 380


>gi|78485635|ref|YP_391560.1| succinyl-diaminopimelate desuccinylase [Thiomicrospira crunogena
           XCL-2]
 gi|123555413|sp|Q31G37|DAPE_THICR RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|78363921|gb|ABB41886.1| succinyldiaminopimelate desuccinylase [Thiomicrospira crunogena
           XCL-2]
          Length = 378

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 171/387 (44%), Positives = 234/387 (60%), Gaps = 13/387 (3%)

Query: 3   PDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT 62
            + ++   +LI+  SVTP D G   ++ + LK LGF IE   F       V+NL+AR G 
Sbjct: 2   SETIQLAQKLIQTESVTPNDNGCQTLIADYLKPLGFDIEPMPFGE-----VENLWARAGK 56

Query: 63  EAPHLMFAGHIDVVPPGDFNHWTYPPFSATIA-EGKIYGRGIVDMKGSIACFIAAVARFI 121
           + P ++FAGH DVVP G    WT+PPFSA I  +G +YGRG  DMK SIACF+ A  +FI
Sbjct: 57  DGPVIVFAGHTDVVPTGPEEKWTHPPFSAHIDADGIMYGRGTADMKSSIACFMVATKQFI 116

Query: 122 PKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
            +Y +F GSI+ LIT DEEGPA+NGT K++  +E + EK++ C+VGEP+ ++ +GD+IK 
Sbjct: 117 KQYPDFKGSIAFLITSDEEGPAVNGTVKVIEALEARNEKFEYCLVGEPSSSNTLGDSIKN 176

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGSLSG +TI G QGH+AYP L ENPI  L P L  + N  +D GN  F PT+ +++ 
Sbjct: 177 GRRGSLSGHLTIKGIQGHIAYPQLAENPIHTLSPALSDMVNKVWDKGNDYFPPTSFQVSN 236

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV 300
           I  G  + NVIP    + FN RF+     ++LK  I   L     +  +L++ + ++   
Sbjct: 237 IHSGTGATNVIPGDCVVDFNFRFSTEQTPESLKAGIHQIL-----DSHQLNYDLDWNLSG 291

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHA 359
            P     D +L   +SK+I    G  P LST GGTSD RFI      VIE G +  T+H 
Sbjct: 292 LPFITPADGELIQAVSKAIEQEMGTTPELSTGGGTSDGRFIAQTGAQVIELGPLNDTIHK 351

Query: 360 LNENASLQDLEDLTCIYENFLQNWFIT 386
           ++E  S+ DLE LT IY N L N  +T
Sbjct: 352 IDERVSVSDLEKLTQIYRNTLINLLVT 378


>gi|49473730|ref|YP_031772.1| succinyl-diaminopimelate desuccinylase [Bartonella quintana str.
           Toulouse]
 gi|81647447|sp|Q6G1H9|DAPE_BARQU RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|49239233|emb|CAF25553.1| Succinyl-diaminopimelate desuccinylase [Bartonella quintana str.
           Toulouse]
          Length = 390

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 204/385 (52%), Positives = 258/385 (67%), Gaps = 3/385 (0%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D L+ L  LI+CPSVTP + GA   L   L  +GF+++   F  KNT  V+NLYA+ G E
Sbjct: 6   DPLQLLQALIRCPSVTPYEAGALSTLEQILTKMGFNVKRPVFTDKNTEDVENLYAKMGGE 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
             HLMFAGH DVVPPG    WTYPPF   I +GK+YGRG VDMKG IACF+AA+AR + K
Sbjct: 66  GRHLMFAGHTDVVPPGALEDWTYPPFEGVIDQGKLYGRGAVDMKGGIACFVAALARILEK 125

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               G +SLLITGDEEGPA+NGT K+L W E+KGEKW A +VGEPT    +GD IKIGRR
Sbjct: 126 RSIKGMVSLLITGDEEGPALNGTVKLLKWAEQKGEKWTAALVGEPTSVKTVGDVIKIGRR 185

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSLSG +T+ G+QGHVA+P    NP+     L+  LT    D G   F P+N+E+TTID 
Sbjct: 186 GSLSGVVTVKGRQGHVAFPERAANPLPLAGKLIQALTQTALDRGTENFQPSNLELTTIDT 245

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGI---QNVPKLSHTVHFSSPV 300
            NP+ NVIPAQ  + FNIR+ND+W ++TL  EI  RL        +     + + +   +
Sbjct: 246 DNPAVNVIPAQTTIRFNIRYNDVWTKETLMTEIEKRLASVQLKNNDYQYPYYQLEWIPSL 305

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL 360
             VF+T + KL   LS +I + TGNIP  STSGGTSDARFIKDYCPV+EFGL G+TMH +
Sbjct: 306 GSVFITKNDKLIKTLSNAIESVTGNIPEYSTSGGTSDARFIKDYCPVVEFGLPGQTMHMV 365

Query: 361 NENASLQDLEDLTCIYENFLQNWFI 385
           +E  +L  +E LT +YE F+ ++F 
Sbjct: 366 DECVTLDAIETLTSVYERFIVDFFA 390


>gi|15887721|ref|NP_353402.1| succinyl-diaminopimelate desuccinylase [Agrobacterium tumefaciens
           str. C58]
 gi|238055203|sp|A9CKC4|DAPE_AGRT5 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|15155282|gb|AAK86187.1| succinyl-diaminopimelate desuccinylase [Agrobacterium tumefaciens
           str. C58]
          Length = 398

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 218/391 (55%), Positives = 269/391 (68%), Gaps = 7/391 (1%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           T D + +L  LI+CPSVTP +GGA  +L   L  LGF++E        T  V+NLYAR G
Sbjct: 3   TTDPVANLAALIRCPSVTPAEGGALSLLDTLLSPLGFAVERVMATEDGTPDVENLYARLG 62

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
           TE PHLMFAGH DVVP GD   W++PPFSA IA G++YGRG VDMKG IACF+AA+AR I
Sbjct: 63  TEGPHLMFAGHTDVVPVGDEAAWSHPPFSADIAGGEMYGRGAVDMKGGIACFVAAIARHI 122

Query: 122 -PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
               K  GS+S LITGDEEGP+INGT K+L W   KGE WDAC+VGEPT    +GD IKI
Sbjct: 123 GKHGKPQGSVSFLITGDEEGPSINGTSKLLEWAAAKGETWDACVVGEPTNPDQLGDMIKI 182

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGSLSG IT+ G QGH AYPHL +NPIRGL+ L H L +  FD G   F P+N+E+TT
Sbjct: 183 GRRGSLSGRITVQGVQGHAAYPHLADNPIRGLLQLTHALMHPAFDHGTDDFQPSNLEVTT 242

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLI------KGIQNVPKLSHTV 294
           +D GN + NVIPA+   +FNIRFND W  ++L+ EI  RL       +   +   + + +
Sbjct: 243 VDTGNAATNVIPARATAAFNIRFNDSWTAESLRAEIIRRLDAAANEGELRPDRAPVKYEI 302

Query: 295 HFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVG 354
            ++   S VFLT +  L S LS +I   TG  P LST+GGTSDARFIKDYCPV+EFGLVG
Sbjct: 303 VWADRPSHVFLTRNNALISSLSGAIETVTGKEPKLSTTGGTSDARFIKDYCPVVEFGLVG 362

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNWFI 385
           +TMH ++E  ++ DLE LT IYE F++ WF 
Sbjct: 363 QTMHMVDERVAVADLETLTRIYETFIERWFA 393


>gi|91762403|ref|ZP_01264368.1| succinyl-diaminopimelate desuccinylase [Candidatus Pelagibacter
           ubique HTCC1002]
 gi|91718205|gb|EAS84855.1| succinyl-diaminopimelate desuccinylase [Candidatus Pelagibacter
           ubique HTCC1002]
          Length = 385

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 177/380 (46%), Positives = 237/380 (62%), Gaps = 3/380 (0%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           +    +LI+ PS+TP D G    L   L  +GF  +  +F+ KN+  VKNLYAR G   P
Sbjct: 7   ITLAKELIRFPSITPIDAGVMKFLAKKLTTIGFKCKILEFKDKNSKPVKNLYARLGNTQP 66

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIA-AVARFIPKY 124
           + MFAGH+DVVPPG+   WT  PFS TI +  + GRG  DMK +IA ++       +   
Sbjct: 67  NFMFAGHLDVVPPGNIQDWTIKPFSPTIKKNHLIGRGANDMKSAIASWVVAVNNYVLTNK 126

Query: 125 KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           K  GSISLLITGDEEG AINGTKK++ +++KK EK D C+VGEPT  + +G+ IKIGRRG
Sbjct: 127 KINGSISLLITGDEEGIAINGTKKVVDYLKKKKEKIDFCLVGEPTNPNKLGEMIKIGRRG 186

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           S++ E+TI G QGHVAYPH  +NP   LI +L+++  I FD G   F PTN+E+T I++ 
Sbjct: 187 SVNVELTIIGTQGHVAYPHRAKNPSTSLIKILNEIKEIKFDKGTKDFQPTNLEVTKININ 246

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
           N + NVIP   + +FNIRFN+     +LK  +     K  +   K +  V +       F
Sbjct: 247 NTADNVIPGLARATFNIRFNNKHTSSSLKNRLNKIFKKITKKD-KSNFKVEYRVSGEA-F 304

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENA 364
           LT   K T ++   I   T   P LST+GGTSDARFI+   P +EFGLVG+TMH ++E  
Sbjct: 305 LTKPNKTTYMIQDVIKKITKIKPQLSTTGGTSDARFIRKIAPCLEFGLVGKTMHKVDEAV 364

Query: 365 SLQDLEDLTCIYENFLQNWF 384
           S+ DL+ LT IY N L+N+F
Sbjct: 365 SISDLKKLTKIYYNILENYF 384


>gi|319406448|emb|CBI80088.1| succinyl-diaminopimelate desuccinylase [Bartonella sp. 1-1C]
          Length = 388

 Score =  271 bits (692), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 210/383 (54%), Positives = 265/383 (69%), Gaps = 1/383 (0%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D ++ L  LI+CPSVTP + GA   L + LK +GF +E   F  KNT  V+NLYA+ G+E
Sbjct: 6   DPVQILQTLIRCPSVTPHEAGALSTLEHFLKKMGFCVERPIFVDKNTEDVENLYAKIGSE 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVPPG   +WTYPPF   I++GK+YGRG VDMKG IACFIAA+ARF+ K
Sbjct: 66  GPHLMFAGHSDVVPPGKLENWTYPPFEGVISQGKLYGRGAVDMKGGIACFIAALARFLKK 125

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               G +S LIT DEEGPAINGT K+L W  +KGEKW+A IVGEPT  +I+GD IKIGRR
Sbjct: 126 KTLKGMVSFLITSDEEGPAINGTVKLLEWAVQKGEKWNAAIVGEPTSVNIVGDMIKIGRR 185

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS+SG ITI G QGHVA+P    NP+     L+  LT    D G   F  +++E+T+ID 
Sbjct: 186 GSISGIITIKGCQGHVAFPERAANPLPLASKLIQALTQTALDQGTKDFQASHLELTSIDT 245

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGI-QNVPKLSHTVHFSSPVSP 302
           GN S N+IPAQ  + FNIR+NDLW ++TL  EI  RL     +N     + + +   +  
Sbjct: 246 GNFSVNIIPAQTVIRFNIRYNDLWTKETLVAEIEKRLASVHSENDQVPYYQLEWIYGLGG 305

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNE 362
           VFLT + KL  +LS +I + TGNIP  STSGGTSDARFIKDYCPV+EFGL G+TMH ++E
Sbjct: 306 VFLTKNDKLIGILSNAIKSVTGNIPECSTSGGTSDARFIKDYCPVVEFGLPGQTMHMIDE 365

Query: 363 NASLQDLEDLTCIYENFLQNWFI 385
             +L  +E+LT IYE F+ ++F 
Sbjct: 366 CVTLDAIENLTSIYERFITDFFA 388


>gi|238064826|sp|B7KVW2|DAPE_METC4 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 385

 Score =  270 bits (689), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 198/381 (51%), Positives = 248/381 (65%), Gaps = 4/381 (1%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           L     LI+CPSVTP++GGA   L + L   GFS+E   F    T  ++NLYAR GT  P
Sbjct: 7   LALAQALIRCPSVTPEEGGALSFLADRLSRAGFSVERPVFSEPGTPDIQNLYARIGTAGP 66

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            L+FAGH DVVPPG+   WT+ PFS  +A+G +YGRG VDMKG IAC +AA   F+ +++
Sbjct: 67  VLVFAGHTDVVPPGETEAWTHGPFSGEVADGFLYGRGAVDMKGGIACMLAATLAFLDRHR 126

Query: 126 NF--GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               GSI+ L+TGDEEGPA+NGT K+L W + +GE++D C++GEPT    +G+ IKIGRR
Sbjct: 127 PDFGGSIAFLVTGDEEGPAVNGTVKLLDWAKARGERFDHCLLGEPTNPDTLGEMIKIGRR 186

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL+G IT+HG+QGHVAYPH  ENPI GL+ L   LT    D G   F  +N+E TTIDV
Sbjct: 187 GSLTGRITVHGRQGHVAYPHRAENPIPGLLRLASALTADPLDGGTAHFDASNLEFTTIDV 246

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GNP+ NVIPA  K  FN+RFND W   TL  EIR RL         +  ++      SP 
Sbjct: 247 GNPATNVIPASAKAVFNVRFNDDWTADTLGAEIRRRLEA--AAGNAVRFSLDLQPSNSPA 304

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           FLT        ++ +I   TG  P LST+GGTSDARFIKD CPVIEFGLVGRTMH  +E 
Sbjct: 305 FLTQPDAFVDRVADAIEAETGRRPALSTTGGTSDARFIKDACPVIEFGLVGRTMHETDER 364

Query: 364 ASLQDLEDLTCIYENFLQNWF 384
            ++ DL+ LT IY   L  +F
Sbjct: 365 VAVADLDRLTAIYGRVLDAYF 385


>gi|218529890|ref|YP_002420706.1| succinyl-diaminopimelate desuccinylase [Methylobacterium
           chloromethanicum CM4]
 gi|218522193|gb|ACK82778.1| succinyl-diaminopimelate desuccinylase [Methylobacterium
           chloromethanicum CM4]
          Length = 388

 Score =  270 bits (689), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 198/381 (51%), Positives = 248/381 (65%), Gaps = 4/381 (1%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           L     LI+CPSVTP++GGA   L + L   GFS+E   F    T  ++NLYAR GT  P
Sbjct: 10  LALAQALIRCPSVTPEEGGALSFLADRLSRAGFSVERPVFSEPGTPDIQNLYARIGTAGP 69

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            L+FAGH DVVPPG+   WT+ PFS  +A+G +YGRG VDMKG IAC +AA   F+ +++
Sbjct: 70  VLVFAGHTDVVPPGETEAWTHGPFSGEVADGFLYGRGAVDMKGGIACMLAATLAFLDRHR 129

Query: 126 NF--GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               GSI+ L+TGDEEGPA+NGT K+L W + +GE++D C++GEPT    +G+ IKIGRR
Sbjct: 130 PDFGGSIAFLVTGDEEGPAVNGTVKLLDWAKARGERFDHCLLGEPTNPDTLGEMIKIGRR 189

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL+G IT+HG+QGHVAYPH  ENPI GL+ L   LT    D G   F  +N+E TTIDV
Sbjct: 190 GSLTGRITVHGRQGHVAYPHRAENPIPGLLRLASALTADPLDGGTAHFDASNLEFTTIDV 249

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GNP+ NVIPA  K  FN+RFND W   TL  EIR RL         +  ++      SP 
Sbjct: 250 GNPATNVIPASAKAVFNVRFNDDWTADTLGAEIRRRLEA--AAGNAVRFSLDLQPSNSPA 307

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           FLT        ++ +I   TG  P LST+GGTSDARFIKD CPVIEFGLVGRTMH  +E 
Sbjct: 308 FLTQPDAFVDRVADAIEAETGRRPALSTTGGTSDARFIKDACPVIEFGLVGRTMHETDER 367

Query: 364 ASLQDLEDLTCIYENFLQNWF 384
            ++ DL+ LT IY   L  +F
Sbjct: 368 VAVADLDRLTAIYGRVLDAYF 388


>gi|254560754|ref|YP_003067849.1| N-succinyl-diaminopimelate deacylase [Methylobacterium extorquens
           DM4]
 gi|254268032|emb|CAX23903.1| N-succinyl-diaminopimelate deacylase (dapE) [Methylobacterium
           extorquens DM4]
          Length = 388

 Score =  270 bits (689), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 197/381 (51%), Positives = 245/381 (64%), Gaps = 4/381 (1%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           L     LI+CPSVTP++GGA   L + L   GFS+E   F    T  ++NLYAR GT  P
Sbjct: 10  LALAQALIRCPSVTPEEGGALSFLADRLSRAGFSVERPVFSEPGTPDIQNLYARIGTAGP 69

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            L+FAGH DVVPPG+   WT+ PFS  + +G +YGRG VDMKG IAC +AA   F+ ++ 
Sbjct: 70  VLVFAGHTDVVPPGETEAWTHGPFSGEVTDGFLYGRGAVDMKGGIACMLAATLAFLDRHG 129

Query: 126 NF--GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               GSI+ L+TGDEEGPA+NGT K+L W + +GE +D C++GEPT    +G+ IKIGRR
Sbjct: 130 PDFGGSIAFLVTGDEEGPAVNGTVKLLDWAKARGECFDHCLLGEPTNPDTLGEMIKIGRR 189

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL+G IT+HG+QGHVAYPH  ENPI GL+ L   LT    D G   F  +N+E TTIDV
Sbjct: 190 GSLTGRITVHGRQGHVAYPHRAENPIPGLLRLASALTADPLDGGTAHFDASNLEFTTIDV 249

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GNP+ NVIPA  K  FN+RFND W   TL  EIR RL         +  ++      SP 
Sbjct: 250 GNPATNVIPASAKAVFNVRFNDDWTADTLGAEIRRRLEA--AAGNAVRFSLDLQPSNSPA 307

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           FLT        ++ +I   TG  P LST+GGTSDARFIKD CPVIEFGLVGRTMH  +E 
Sbjct: 308 FLTQPDAFVDRVADAIEAETGRRPALSTTGGTSDARFIKDACPVIEFGLVGRTMHETDER 367

Query: 364 ASLQDLEDLTCIYENFLQNWF 384
            ++ DL+ LT IY   L  +F
Sbjct: 368 VAVADLDRLTAIYGRVLDAYF 388


>gi|240138194|ref|YP_002962666.1| N-succinyl-diaminopimelate deacylase (dapE) [Methylobacterium
           extorquens AM1]
 gi|240008163|gb|ACS39389.1| N-succinyl-diaminopimelate deacylase (dapE) [Methylobacterium
           extorquens AM1]
          Length = 388

 Score =  270 bits (689), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 198/381 (51%), Positives = 247/381 (64%), Gaps = 4/381 (1%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           L     LI+CPSVTP++GGA   L + L   GFS+E   F    T  ++NLYAR GT  P
Sbjct: 10  LALAQALIRCPSVTPEEGGALSFLADRLSRAGFSVERPVFSEPGTPDIQNLYARIGTAGP 69

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            L+FAGH DVVPPG+   WT+ PFS  +A+G +YGRG VDMKG IAC +AA   F+ ++ 
Sbjct: 70  VLVFAGHTDVVPPGETEAWTHGPFSGEVADGFLYGRGAVDMKGGIACMLAATLAFLDRHG 129

Query: 126 NF--GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               GSI+ L+TGDEEGPA+NGT K+L W + +GE++D C++GEPT    +G+ IKIGRR
Sbjct: 130 PDFGGSIAFLVTGDEEGPAVNGTVKLLDWAKARGERFDHCLLGEPTNPDTLGEMIKIGRR 189

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL+G IT+HG+QGHVAYPH  ENPI GL+ L   LT    D G   F  +N+E TTIDV
Sbjct: 190 GSLTGRITVHGRQGHVAYPHRAENPIPGLLRLASALTADPLDGGTAHFDASNLEFTTIDV 249

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GNP+ NVIPA  K  FN+RFND W   TL  EIR RL         +  ++      SP 
Sbjct: 250 GNPATNVIPASAKAVFNVRFNDDWTADTLGAEIRRRLEA--AAGNAVRFSLDLQPSNSPA 307

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           FLT        ++ +I   TG  P LST+GGTSDARFIKD CPVIEFGLVGRTMH  +E 
Sbjct: 308 FLTQPDAFVDRVADAIEAETGRRPALSTTGGTSDARFIKDACPVIEFGLVGRTMHETDER 367

Query: 364 ASLQDLEDLTCIYENFLQNWF 384
            ++ DL+ LT IY   L  +F
Sbjct: 368 VAVADLDRLTAIYGRVLDAYF 388


>gi|75677247|ref|YP_319668.1| succinyl-diaminopimelate desuccinylase [Nitrobacter winogradskyi
           Nb-255]
 gi|123612579|sp|Q3SN25|DAPE_NITWN RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|74422117|gb|ABA06316.1| succinyldiaminopimelate desuccinylase [Nitrobacter winogradskyi
           Nb-255]
          Length = 389

 Score =  270 bits (689), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 182/391 (46%), Positives = 242/391 (61%), Gaps = 8/391 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D L     LI+CPSVTP D GA  +L   LK  GF +    F     + + NLYAR 
Sbjct: 1   MGNDALSIARDLIRCPSVTPADAGALGVLEPLLKNAGFDVHRITFSEPGVADIDNLYARI 60

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G+  PH+ FAGH DVVPPGD   WT   FS  + +G +YGRG VDMKG +AC +AA   +
Sbjct: 61  GSGRPHIAFAGHTDVVPPGDEAAWTRGAFSGDVVDGFLYGRGAVDMKGGVACGVAAALDY 120

Query: 121 IPKYKNF------GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHII 174
           +  +         GSIS LITGDEE  A+NGT K+L W   +GEK+D C++GEP+    +
Sbjct: 121 LAAHGGRPGKDGSGSISFLITGDEEDIAVNGTVKLLQWAAARGEKFDHCVLGEPSNVEEL 180

Query: 175 GDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPT 234
           GD IKIGRRGS SG + + G QGHVAYPH   NPI  +  L+  L +   D G++ F P+
Sbjct: 181 GDCIKIGRRGSQSGTLYVDGVQGHVAYPHRASNPIPEIAALITALVSEPLDQGSSQFQPS 240

Query: 235 NMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTV 294
           N+E T++DVGNP+ NVIP Q +  FNIRFND  ++++L+  + +R+     +  ++   +
Sbjct: 241 NLEFTSVDVGNPAANVIPGQARARFNIRFNDHHDQQSLRALVEARV--AGASGNRVRTRI 298

Query: 295 HFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVG 354
            +    + VFLT     T L++ ++ + TG  P LST GGTSDARFIKDYCPVIEFGLVG
Sbjct: 299 VWEPSNADVFLTEPGPFTDLVAAAVEDVTGRRPELSTGGGTSDARFIKDYCPVIEFGLVG 358

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNWFI 385
           RTMH ++E   + DLE LT +Y   L  +F 
Sbjct: 359 RTMHQIDERVPIADLEKLTRVYRGVLDRYFA 389


>gi|115522680|ref|YP_779591.1| succinyl-diaminopimelate desuccinylase [Rhodopseudomonas palustris
           BisA53]
 gi|122297687|sp|Q07TX3|DAPE_RHOP5 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|115516627|gb|ABJ04611.1| succinyldiaminopimelate desuccinylase [Rhodopseudomonas palustris
           BisA53]
          Length = 387

 Score =  270 bits (689), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 185/386 (47%), Positives = 240/386 (62%), Gaps = 4/386 (1%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           TPD L     L++CPSVTP D GA  +L   L+  GF +    F     + + NLYAR G
Sbjct: 4   TPDALSIARDLLRCPSVTPADAGALDVLDRLLRGAGFEVHRVTFSEPGAADIDNLYARIG 63

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAA--VAR 119
           T APHLMFAGH DVVPPGD + W++  F+  +A+G++YGRG VDMKG IAC +AA  V  
Sbjct: 64  TGAPHLMFAGHTDVVPPGDVSAWSHGAFAGEVADGQLYGRGAVDMKGGIACAVAAVLVYL 123

Query: 120 FIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
                +  GSIS LITGDEE  A+NGT K+L W + +GE +D CIVGEP+    +GD IK
Sbjct: 124 AACGGQPKGSISFLITGDEEDIAVNGTVKLLQWADARGENFDHCIVGEPSNVEELGDCIK 183

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGSLSG + + G QGHVAYP    NP+  +  L+  L++   D G   F P+N+E T
Sbjct: 184 IGRRGSLSGTLIVDGVQGHVAYPQRAVNPVPDIATLIVALSHEPLDHGTAQFQPSNLEFT 243

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           ++DVGN + NVIPAQ +  FNIRFND  + K+L+  I   L     N  +    + +   
Sbjct: 244 SVDVGNAATNVIPAQARAKFNIRFNDQHSIKSLQALIEHHLAAACGNRIRAR--IEWLPS 301

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
            +  F+T     T L++ +I   TG  P L+T GGTSDARFI  YCPVIEFGLVG+TMH 
Sbjct: 302 NAGAFVTKPGPFTDLVTAAIEQVTGRRPELNTGGGTSDARFITHYCPVIEFGLVGQTMHK 361

Query: 360 LNENASLQDLEDLTCIYENFLQNWFI 385
           ++E   + DLE LT IY   L+ +F 
Sbjct: 362 VDERTPVSDLEKLTAIYRGVLERYFA 387


>gi|85717148|ref|ZP_01048107.1| succinyl-diaminopimelate desuccinylase [Nitrobacter sp. Nb-311A]
 gi|85696039|gb|EAQ33938.1| succinyl-diaminopimelate desuccinylase [Nitrobacter sp. Nb-311A]
          Length = 389

 Score =  270 bits (689), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 183/391 (46%), Positives = 244/391 (62%), Gaps = 8/391 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  + L     L++CPSVTP D GA  +L   LK  GF +    F     + + NLYAR 
Sbjct: 1   MENNALSIARDLVRCPSVTPADAGALGVLETLLKGAGFDVHRITFSEPGAADIDNLYARI 60

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT  PH+ FAGH DVVPPGD + WT   FS  + +G +YGRG VDMKG IAC +AA   +
Sbjct: 61  GTTGPHIAFAGHTDVVPPGDESAWTRGAFSGDVVDGFLYGRGAVDMKGGIACGVAAALDY 120

Query: 121 IPKYKNF------GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHII 174
           +  +         GSIS LITGDEE  A+NGT K++ W + +GEK+D C++GEP+    +
Sbjct: 121 LAAHGGQPGKDGNGSISFLITGDEEDIAVNGTVKLMQWADARGEKFDHCVLGEPSNVEEL 180

Query: 175 GDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPT 234
           GD IKIGRRGS SG + + G QGHVAYPH   NPI  +  L+  L +   D G+  F P+
Sbjct: 181 GDCIKIGRRGSQSGTLYVDGVQGHVAYPHRASNPIPDIAALITALVSEPLDQGSAQFQPS 240

Query: 235 NMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTV 294
           N+E T++DVGNP+ NVIP Q +  FNIRFND  ++++L+  I +R+ K   +  ++   +
Sbjct: 241 NLEFTSVDVGNPAANVIPGQARAKFNIRFNDHHSQESLRALIEARVAK--ASGNRIRTRI 298

Query: 295 HFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVG 354
            +    + VFLT     T L++ ++ + TG  P LST GGTSDARFIKDYCPVIEFGLVG
Sbjct: 299 VWEPSNADVFLTKPGPFTDLVAAAVEDVTGRRPELSTGGGTSDARFIKDYCPVIEFGLVG 358

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNWFI 385
           +TMH ++E   + DLE LT IY   L  +F 
Sbjct: 359 QTMHQIDERTPVTDLERLTRIYRGVLDRYFA 389


>gi|163757851|ref|ZP_02164940.1| putative succinyl-diaminopimelate desuccinylase [Hoeflea
           phototrophica DFL-43]
 gi|162285353|gb|EDQ35635.1| putative succinyl-diaminopimelate desuccinylase [Hoeflea
           phototrophica DFL-43]
          Length = 398

 Score =  270 bits (689), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 213/392 (54%), Positives = 268/392 (68%), Gaps = 8/392 (2%)

Query: 1   MT-PDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           M   D  + L  LI+CPSVTP++GGA   L   L  LGF+ +   F  + T  V+NLY+R
Sbjct: 1   MKLTDPTQTLTALIRCPSVTPEEGGALTELAGMLSELGFANDRVTFSDEGTPDVENLYSR 60

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            G+E PHLMFAGH DVVP GD   WT  PFSA I +G++YGRG VDMKG IACF++A+AR
Sbjct: 61  LGSEGPHLMFAGHTDVVPVGDAEAWTQGPFSADIVDGEMYGRGAVDMKGGIACFVSALAR 120

Query: 120 FIPKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
            I +     GS+SLLITGDEEGP+INGT+K+L     KGE+WDA +VGEPT    +GD I
Sbjct: 121 LIERKGPLKGSVSLLITGDEEGPSINGTEKLLVHAAGKGERWDAAVVGEPTNPDQLGDMI 180

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGSLSG +T+ G QGHVAYPHL +NP+ G++ L   L +   D GN  F P+N+EI
Sbjct: 181 KIGRRGSLSGTLTVEGVQGHVAYPHLADNPLPGMMALASALIDPPLDAGNERFPPSNLEI 240

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKG------IQNVPKLSH 292
           T+ID GN + NVIPA+    FNIRFND W  ++LK E+R+R+ +            K+ +
Sbjct: 241 TSIDTGNTATNVIPARCTAKFNIRFNDQWTAESLKAELRARIEQASGGGSSRTGQEKVRY 300

Query: 293 TVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGL 352
           TV F+   S  FLTHD  L   LS ++   TG  P LST+GGTSDARFIKDYCPV+EFGL
Sbjct: 301 TVKFADRPSSSFLTHDAPLIEALSNAVTEATGRTPALSTTGGTSDARFIKDYCPVVEFGL 360

Query: 353 VGRTMHALNENASLQDLEDLTCIYENFLQNWF 384
           VG+TMH ++E  ++ DLE LT IYE FL+ WF
Sbjct: 361 VGKTMHMVDERVAVSDLEALTGIYELFLERWF 392


>gi|71083168|ref|YP_265887.1| succinyl-diaminopimelate desuccinylase [Candidatus Pelagibacter
           ubique HTCC1062]
 gi|123647068|sp|Q4FNF5|DAPE_PELUB RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|71062281|gb|AAZ21284.1| succinyl-diaminopimelate desuccinylase [Candidatus Pelagibacter
           ubique HTCC1062]
          Length = 384

 Score =  270 bits (689), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 176/380 (46%), Positives = 236/380 (62%), Gaps = 3/380 (0%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           +    +LI+ PS+TP D G    L   L  +GF  +  +F+ KN+  VKNLYAR G   P
Sbjct: 7   ITLAKELIRFPSITPIDAGVMKFLAKKLTTIGFKCKILEFKDKNSKPVKNLYARLGNTQP 66

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIA-AVARFIPKY 124
           + MFAGH+DVVPPG+   WT  PFS TI +  + GRG  DMK +IA ++       +   
Sbjct: 67  NFMFAGHLDVVPPGNIQDWTIKPFSPTIKKNHLIGRGANDMKSAIASWVVAVNNYVLTNK 126

Query: 125 KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           K  GSISLLITGDEEG AINGTKK++ +++KK EK D C+VGEPT  + +G+ IKIGRRG
Sbjct: 127 KINGSISLLITGDEEGVAINGTKKVVDYLKKKKEKIDFCLVGEPTNPNKLGEMIKIGRRG 186

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           S++ E+TI G QGHVAYPH  +NP   LI +L+++  I FD G   F PTN+E+T I++ 
Sbjct: 187 SINAELTIIGTQGHVAYPHRAKNPSTSLIKILNEIKEIKFDKGTKDFQPTNLEVTKININ 246

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
           N + NVIP   + +FNIRFN+     +LK  +     K  +   K +  V +       F
Sbjct: 247 NTADNVIPGLARATFNIRFNNKHTSSSLKNRLNKIFKKITKKD-KSNFKVEYRVSGEA-F 304

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENA 364
           LT   K T ++   I   T   P LST+GGTSDARFI+   P +EFGLVG+TMH ++E  
Sbjct: 305 LTKPNKTTYMIQDVIKKITKIKPQLSTTGGTSDARFIRKIAPCLEFGLVGKTMHKVDEAV 364

Query: 365 SLQDLEDLTCIYENFLQNWF 384
           S+ DL+ LT IY   L+N+F
Sbjct: 365 SISDLKKLTKIYSEILKNYF 384


>gi|90419796|ref|ZP_01227705.1| succinyl-diaminopimelate desuccinylase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335837|gb|EAS49585.1| succinyl-diaminopimelate desuccinylase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 410

 Score =  269 bits (688), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 200/390 (51%), Positives = 257/390 (65%), Gaps = 7/390 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +  L +LI+CPSVTP +GGA   L   L  LGF++E   F   +T  V+NL+AR G  
Sbjct: 19  DPVAILTRLIRCPSVTPAEGGALAALQEILAPLGFAVERPVFSDIDTPDVENLFARAGAA 78

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHL+FAGH DVVPPGD + W   PFSA I +G++YGRG VDMKG IA F+AA AR + +
Sbjct: 79  GPHLVFAGHTDVVPPGDQSDWREGPFSAAIVDGELYGRGAVDMKGGIAAFVAAYARQVER 138

Query: 124 YKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
             +  G +SLLITGDEEGPA+NGT K+L W   +GE++DAC+VGEPT    +GD IKIGR
Sbjct: 139 AGHPAGQVSLLITGDEEGPAVNGTVKLLDWASARGERFDACVVGEPTNPAAMGDMIKIGR 198

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSLS E+ I G QGHVAYPHL +NP+R L  +   L +   D G+  F  +N+EIT+ID
Sbjct: 199 RGSLSAELRITGVQGHVAYPHLADNPLRTLTAIAEALMDEPLDAGSAEFPASNLEITSID 258

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKL------SHTVHF 296
            GN S NVIPA+ ++ FN+RF+D W   +LK E+  R+     +          +  + +
Sbjct: 259 TGNGSVNVIPARARLFFNVRFSDRWTPDSLKVELTRRIEAAAASGRFREGRDAANVEIVW 318

Query: 297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRT 356
            +  S  FLT D  LT  L+ ++   TG  P LSTSGGTSDARFIKD+CPV+EFGLVG+T
Sbjct: 319 RARPSESFLTRDDALTQALAGAVKAVTGRQPQLSTSGGTSDARFIKDFCPVVEFGLVGKT 378

Query: 357 MHALNENASLQDLEDLTCIYENFLQNWFIT 386
           MH  NE   ++DLE LT IYE F+  WF  
Sbjct: 379 MHMSNERVPVEDLETLTRIYETFIARWFAA 408


>gi|209547673|ref|YP_002279590.1| succinyl-diaminopimelate desuccinylase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|238064797|sp|B5ZN23|DAPE_RHILW RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|209533429|gb|ACI53364.1| succinyl-diaminopimelate desuccinylase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 397

 Score =  269 bits (687), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 215/393 (54%), Positives = 273/393 (69%), Gaps = 8/393 (2%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT  D + +L  LI+CPSVTP +GGA   L   L  LGF++++       T+ ++NLYAR
Sbjct: 1   MTATDPVANLQTLIRCPSVTPAEGGALSALDAMLAPLGFTVDKVKASEAGTADIENLYAR 60

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            G + PHLMFAGH DVVP GD   WT+PPF+A I++G+++GRG VDMKG IACFIAAVAR
Sbjct: 61  LGKDGPHLMFAGHTDVVPVGDEADWTHPPFAAEISKGELFGRGAVDMKGGIACFIAAVAR 120

Query: 120 FIPKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
            I K     GSIS LITGDEEGPAINGT K+L W  ++GE+WDAC+VGEPT    +GD I
Sbjct: 121 HIEKNGPPKGSISFLITGDEEGPAINGTIKLLRWAAERGERWDACLVGEPTNPDRLGDMI 180

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGSLSG+IT+HG QGH AYPHL +NP+RG++ L   L +  FD G   F P+N+E+
Sbjct: 181 KIGRRGSLSGKITVHGVQGHAAYPHLADNPVRGMLQLTQALMDPPFDGGTDDFQPSNLEV 240

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKG------IQNVPKLSH 292
           TT+DVGNP+ NVIPA+   SFNIRFND W  +TL+ EI  RL               + +
Sbjct: 241 TTVDVGNPATNVIPAKASASFNIRFNDSWTAETLRAEILRRLDAAAGDGRLRPGREPVKY 300

Query: 293 TVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGL 352
            + ++   S VFLT +  L + LS ++    G  P LST+GGTSDARFIKDYCPV+EFGL
Sbjct: 301 DIVWADRPSHVFLTRNNALIASLSSAVEGVIGRSPKLSTTGGTSDARFIKDYCPVVEFGL 360

Query: 353 VGRTMHALNENASLQDLEDLTCIYENFLQNWFI 385
           VG+TMH ++E  ++ DLE LT IYE F+ +WF 
Sbjct: 361 VGQTMHMVDERVAVSDLETLTAIYETFIAHWFA 393


>gi|86356074|ref|YP_467966.1| succinyl-diaminopimelate desuccinylase [Rhizobium etli CFN 42]
 gi|86280176|gb|ABC89239.1| succinyl-diaminopimelate desuccinylase protein [Rhizobium etli CFN
           42]
          Length = 409

 Score =  269 bits (687), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 215/393 (54%), Positives = 273/393 (69%), Gaps = 8/393 (2%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT  D + +L  LI+CPSVTP +GGA   L   L  LGF+++    + + T+ ++NLYAR
Sbjct: 13  MTATDPVANLQTLIRCPSVTPAEGGALTALDAMLTPLGFTVDRVTAREEGTAAIENLYAR 72

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            G + PHLMFAGH DVVP GD   WT+PPF+A I+ G+++GRG VDMKG IACF+AAVAR
Sbjct: 73  LGRDGPHLMFAGHTDVVPVGDEAAWTHPPFAAEISNGELFGRGAVDMKGGIACFVAAVAR 132

Query: 120 FIPKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
            I K     GSIS L+TGDEEGPAINGT K+L W  ++GE+WDAC+VGEPT    +GD I
Sbjct: 133 HIEKSGPPAGSISFLVTGDEEGPAINGTIKLLQWAAERGERWDACLVGEPTNPDRLGDMI 192

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGSLSG+IT+HG QGH AYPHL +NP+RGL+ L   L +  FD G   F P+N+E+
Sbjct: 193 KIGRRGSLSGKITVHGVQGHAAYPHLADNPVRGLLQLTQALMDPPFDGGTDDFQPSNLEV 252

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKG------IQNVPKLSH 292
           TT+DVGNP+ NVIPA+   SFNIRFND W  +TL+ EI  RL             P   +
Sbjct: 253 TTVDVGNPATNVIPAKASASFNIRFNDSWTVETLRAEILRRLEAAAGNGQLRPGRPPAKY 312

Query: 293 TVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGL 352
            + ++   S VFLT +  L + LS +I +  G  P LST+GGTSDARFIKDYCPV+EFGL
Sbjct: 313 DIVWADRPSHVFLTRNNALIASLSSAIESVAGRSPALSTTGGTSDARFIKDYCPVVEFGL 372

Query: 353 VGRTMHALNENASLQDLEDLTCIYENFLQNWFI 385
           VG+TMH ++E  ++ DLE LT IY+ F+  WF 
Sbjct: 373 VGQTMHMVDERVAVADLETLTAIYQTFIDRWFA 405


>gi|323137570|ref|ZP_08072647.1| succinyl-diaminopimelate desuccinylase [Methylocystis sp. ATCC
           49242]
 gi|322397196|gb|EFX99720.1| succinyl-diaminopimelate desuccinylase [Methylocystis sp. ATCC
           49242]
          Length = 386

 Score =  269 bits (687), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 186/382 (48%), Positives = 244/382 (63%), Gaps = 4/382 (1%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            +     LI+CPSVTP D GA  ++  TLK +GF      F    T  + NL+A+ G  A
Sbjct: 7   AVSLARDLIRCPSVTPADAGALDVVEKTLKAVGFETHRLTFSEPGTPDIDNLFAKIGAGA 66

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           PHL FAGH DVVP GD   W   PF+  IA+G+IYGRG  DMKG+IA F+AA   ++ K+
Sbjct: 67  PHLAFAGHTDVVPTGDVARWRCDPFAGEIADGRIYGRGASDMKGAIAAFLAATLAYVEKH 126

Query: 125 K-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               G+IS LITGDEEGP+INGT K+L W   +GEK+D CIVGEPT    +GDTIKIGRR
Sbjct: 127 GAPKGAISFLITGDEEGPSINGTVKLLEWARARGEKFDHCIVGEPTNVSALGDTIKIGRR 186

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL+G I + GKQGHVAYPH  ENP+  +  ++  L+   FD G T F  TN+E+++IDV
Sbjct: 187 GSLNGRIRVLGKQGHVAYPHRAENPVPVIARIVAALSAHEFDRGTTHFDRTNLEVSSIDV 246

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GNP+ NVIPA+ +  FNIRFND W    L+E + + + +           V F    +  
Sbjct: 247 GNPAVNVIPAEARAQFNIRFNDAWTIPALQEHVSAVVREA---AGATKAEVEFLPSNAIS 303

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           F+T     T L+S ++ + TG  P LSTSGGTSDARFI  YCPV+EFGL   T+HA++EN
Sbjct: 304 FITEPGDFTELVSHAVKDMTGVTPELSTSGGTSDARFITRYCPVVEFGLTNETIHAVDEN 363

Query: 364 ASLQDLEDLTCIYENFLQNWFI 385
            S++D++ L  +YE  +  +F 
Sbjct: 364 VSVEDIDVLAAVYERIMTRYFA 385


>gi|227820648|ref|YP_002824618.1| succinyl-diaminopimelate desuccinylase [Sinorhizobium fredii
           NGR234]
 gi|227339647|gb|ACP23865.1| succinyl-diaminopimelate desuccinylase [Sinorhizobium fredii
           NGR234]
          Length = 397

 Score =  269 bits (686), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 218/388 (56%), Positives = 273/388 (70%), Gaps = 7/388 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D + +L  LI+CPSVTP +GGA   L   L  LGFS++    +   T  ++NLYAR G E
Sbjct: 5   DPISNLAALIRCPSVTPAEGGALTALEAMLAPLGFSVDRVVAKEAGTPDIENLYARLGAE 64

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVP GD   W++PPFSA IA G++YGRG VDMKG IACF+AAVAR I K
Sbjct: 65  GPHLMFAGHTDVVPVGDEAAWSHPPFSAAIARGEMYGRGAVDMKGGIACFVAAVARHIEK 124

Query: 124 Y-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
           + +  GSIS LITGDEEGPAINGT K+L W  +KGE+WDAC+VGEPT    +GD IKIGR
Sbjct: 125 HGRPKGSISFLITGDEEGPAINGTVKLLEWAAQKGERWDACLVGEPTNPESLGDMIKIGR 184

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSLSG IT+HG QGH AYPHL +NP+RG++ L   L +  FD G  TF P+N+E+TTID
Sbjct: 185 RGSLSGRITVHGVQGHAAYPHLADNPVRGILQLTQALMDSAFDAGTDTFQPSNLEVTTID 244

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQN------VPKLSHTVHF 296
           VGN + NVIPA+   +FNIRFND W  ++LK EI +RL +  ++         + + + +
Sbjct: 245 VGNAAVNVIPARASAAFNIRFNDHWTAESLKAEIVARLDRAAKDETLRPGRQPVKYDIVW 304

Query: 297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRT 356
           +   S VFLT +  L   LS ++   TG  P LST+GGTSDARFIKDYCPV+EFGLVG+T
Sbjct: 305 NERPSHVFLTRNNALIDSLSGAVEAVTGRQPKLSTTGGTSDARFIKDYCPVVEFGLVGQT 364

Query: 357 MHALNENASLQDLEDLTCIYENFLQNWF 384
           MH ++E  ++ DLE LT IYE F+  WF
Sbjct: 365 MHMVDERVAIADLETLTGIYEAFVARWF 392


>gi|238064831|sp|Q2KD47|DAPE_RHIEC RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 397

 Score =  269 bits (686), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 215/393 (54%), Positives = 273/393 (69%), Gaps = 8/393 (2%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT  D + +L  LI+CPSVTP +GGA   L   L  LGF+++    + + T+ ++NLYAR
Sbjct: 1   MTATDPVANLQTLIRCPSVTPAEGGALTALDAMLTPLGFTVDRVTAREEGTAAIENLYAR 60

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            G + PHLMFAGH DVVP GD   WT+PPF+A I+ G+++GRG VDMKG IACF+AAVAR
Sbjct: 61  LGRDGPHLMFAGHTDVVPVGDEAAWTHPPFAAEISNGELFGRGAVDMKGGIACFVAAVAR 120

Query: 120 FIPKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
            I K     GSIS L+TGDEEGPAINGT K+L W  ++GE+WDAC+VGEPT    +GD I
Sbjct: 121 HIEKSGPPAGSISFLVTGDEEGPAINGTIKLLQWAAERGERWDACLVGEPTNPDRLGDMI 180

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGSLSG+IT+HG QGH AYPHL +NP+RGL+ L   L +  FD G   F P+N+E+
Sbjct: 181 KIGRRGSLSGKITVHGVQGHAAYPHLADNPVRGLLQLTQALMDPPFDGGTDDFQPSNLEV 240

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKG------IQNVPKLSH 292
           TT+DVGNP+ NVIPA+   SFNIRFND W  +TL+ EI  RL             P   +
Sbjct: 241 TTVDVGNPATNVIPAKASASFNIRFNDSWTVETLRAEILRRLEAAAGNGQLRPGRPPAKY 300

Query: 293 TVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGL 352
            + ++   S VFLT +  L + LS +I +  G  P LST+GGTSDARFIKDYCPV+EFGL
Sbjct: 301 DIVWADRPSHVFLTRNNALIASLSSAIESVAGRSPALSTTGGTSDARFIKDYCPVVEFGL 360

Query: 353 VGRTMHALNENASLQDLEDLTCIYENFLQNWFI 385
           VG+TMH ++E  ++ DLE LT IY+ F+  WF 
Sbjct: 361 VGQTMHMVDERVAVADLETLTAIYQTFIDRWFA 393


>gi|238064825|sp|A9W376|DAPE_METEP RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 385

 Score =  269 bits (686), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 199/381 (52%), Positives = 247/381 (64%), Gaps = 4/381 (1%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           L     LI+CPSVTP++GGA   L + L   GFS+E   F    T  ++NLYAR GT  P
Sbjct: 7   LALAQALIRCPSVTPEEGGALSFLADRLSRAGFSVERPVFSEPGTPDIQNLYARIGTAGP 66

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            L+FAGH DVVPPG+   WT+ PFS  +AEG +YGRG VDMKG IAC +AA   F+ ++ 
Sbjct: 67  VLVFAGHTDVVPPGEVGSWTHGPFSGEVAEGFLYGRGAVDMKGGIACMLAATLAFLDRHG 126

Query: 126 NF--GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               GSI+ L+TGDEEGPA+NGT K+L W + +GE++D C++GEPT    +G+ IKIGRR
Sbjct: 127 PDFGGSIAFLVTGDEEGPAVNGTVKLLDWAKARGERFDHCLLGEPTNPDTLGEMIKIGRR 186

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL+G IT+HG+QGHVAYPH  ENPI GL+ L   LT    D G   F  +N+E TTIDV
Sbjct: 187 GSLTGRITVHGRQGHVAYPHRAENPIPGLLRLASALTADPLDGGTAHFDASNLEFTTIDV 246

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GNP+ NVIPA  K  FN+RFND W   TL  EIR RL         +  ++      SP 
Sbjct: 247 GNPATNVIPASAKAVFNVRFNDDWTADTLGAEIRRRLEA--AAGNAVRFSLDLQPSNSPA 304

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           FLT        ++ +I   TG  P LST+GGTSDARFIKD CPVIEFGLVGRTMH  +E 
Sbjct: 305 FLTQPDAFVDRVADAIEAETGRRPALSTTGGTSDARFIKDACPVIEFGLVGRTMHETDER 364

Query: 364 ASLQDLEDLTCIYENFLQNWF 384
            ++ DL+ LT IY   L  +F
Sbjct: 365 VAVADLDRLTAIYGRVLDAYF 385


>gi|163851060|ref|YP_001639103.1| succinyl-diaminopimelate desuccinylase [Methylobacterium extorquens
           PA1]
 gi|163662665|gb|ABY30032.1| succinyl-diaminopimelate desuccinylase [Methylobacterium extorquens
           PA1]
          Length = 403

 Score =  269 bits (686), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 199/381 (52%), Positives = 247/381 (64%), Gaps = 4/381 (1%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           L     LI+CPSVTP++GGA   L + L   GFS+E   F    T  ++NLYAR GT  P
Sbjct: 25  LALAQALIRCPSVTPEEGGALSFLADRLSRAGFSVERPVFSEPGTPDIQNLYARIGTAGP 84

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            L+FAGH DVVPPG+   WT+ PFS  +AEG +YGRG VDMKG IAC +AA   F+ ++ 
Sbjct: 85  VLVFAGHTDVVPPGEVGSWTHGPFSGEVAEGFLYGRGAVDMKGGIACMLAATLAFLDRHG 144

Query: 126 NF--GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               GSI+ L+TGDEEGPA+NGT K+L W + +GE++D C++GEPT    +G+ IKIGRR
Sbjct: 145 PDFGGSIAFLVTGDEEGPAVNGTVKLLDWAKARGERFDHCLLGEPTNPDTLGEMIKIGRR 204

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL+G IT+HG+QGHVAYPH  ENPI GL+ L   LT    D G   F  +N+E TTIDV
Sbjct: 205 GSLTGRITVHGRQGHVAYPHRAENPIPGLLRLASALTADPLDGGTAHFDASNLEFTTIDV 264

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GNP+ NVIPA  K  FN+RFND W   TL  EIR RL         +  ++      SP 
Sbjct: 265 GNPATNVIPASAKAVFNVRFNDDWTADTLGAEIRRRLEA--AAGNAVRFSLDLQPSNSPA 322

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           FLT        ++ +I   TG  P LST+GGTSDARFIKD CPVIEFGLVGRTMH  +E 
Sbjct: 323 FLTQPDAFVDRVADAIEAETGRRPALSTTGGTSDARFIKDACPVIEFGLVGRTMHETDER 382

Query: 364 ASLQDLEDLTCIYENFLQNWF 384
            ++ DL+ LT IY   L  +F
Sbjct: 383 VAVADLDRLTAIYGRVLDAYF 403


>gi|296447779|ref|ZP_06889693.1| succinyl-diaminopimelate desuccinylase [Methylosinus trichosporium
           OB3b]
 gi|296254698|gb|EFH01811.1| succinyl-diaminopimelate desuccinylase [Methylosinus trichosporium
           OB3b]
          Length = 385

 Score =  268 bits (685), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 182/382 (47%), Positives = 240/382 (62%), Gaps = 4/382 (1%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L     L++CPSVTP D GA  +L   LK  GF+     F  + T  + NL+A+ G   
Sbjct: 6   ALSITRDLLRCPSVTPADAGALGVLEQRLKEAGFTTHRLVFSEEGTPDINNLFAKIGEGR 65

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           PHL+FAGH DVVP GD   W + PFS  IA+GKI+GRG  DMKG IA F AA   F+ ++
Sbjct: 66  PHLVFAGHTDVVPSGDPARWRFDPFSGEIADGKIFGRGASDMKGGIAAFAAAAIDFVREH 125

Query: 125 K-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               G+IS LITGDEEGPA+NGT KML W   +GE +D  IVGEPT    IGDTIKIGRR
Sbjct: 126 GVPRGAISFLITGDEEGPAVNGTVKMLDWARAQGEVFDHSIVGEPTNLEAIGDTIKIGRR 185

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL+G + + GKQGH A+PH  +NP   +  ++  L+   FD G   F  +N+E+T+ID+
Sbjct: 186 GSLNGRLVVRGKQGHSAHPHRADNPTPAVARIVTALSTHRFDEGTEHFDRSNLEVTSIDI 245

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GN + NVIP + +  FNIRFN+ W  +TL+ EIR  + +           V F    S  
Sbjct: 246 GNQAANVIPGEARARFNIRFNNSWTLETLQAEIRRVIDEAAAGA---RVEVEFLPCNSLP 302

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           FLT     T+L++ +I   TG  P LSTSGGTSDARFI   CPV+EFGLV  ++HA++E+
Sbjct: 303 FLTAPGDFTALVAGAIEEVTGRRPGLSTSGGTSDARFITRECPVLEFGLVNESIHAVDEH 362

Query: 364 ASLQDLEDLTCIYENFLQNWFI 385
           A L+D++ LT +Y+  L+ +F 
Sbjct: 363 ARLEDVDRLTAVYKRILEKYFA 384


>gi|316932093|ref|YP_004107075.1| succinyl-diaminopimelate desuccinylase [Rhodopseudomonas palustris
           DX-1]
 gi|315599807|gb|ADU42342.1| succinyl-diaminopimelate desuccinylase [Rhodopseudomonas palustris
           DX-1]
          Length = 385

 Score =  268 bits (685), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 192/386 (49%), Positives = 245/386 (63%), Gaps = 4/386 (1%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT   LE    L++CPSVTP D GA  +L   LK  GF +    F    T+ + NLYAR 
Sbjct: 1   MTATALEIAQALLRCPSVTPADAGALGVLETLLKGAGFDVHRITFSEPGTADIDNLYARI 60

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT APHL FAGH DVVP GD + WT+  FS  +A+G +YGRG VDMKG IAC +AA   +
Sbjct: 61  GTSAPHLCFAGHTDVVPAGDTDAWTHDAFSGDVADGLLYGRGAVDMKGGIACAVAATLDY 120

Query: 121 I--PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           +   + K  GSIS LITGDEE  A+NGT K+L W  ++GEK+D CIVGEP+    IGDTI
Sbjct: 121 LAANEGKPKGSISFLITGDEEDVAVNGTVKLLQWAAERGEKFDHCIVGEPSNVEAIGDTI 180

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGS SG + + G QGHVAYPH   NP+  +  L+  L +   D G+  F P+N+E 
Sbjct: 181 KIGRRGSQSGVLIVDGTQGHVAYPHRAANPVPDIARLITALNDEPLDAGSAQFQPSNLEF 240

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           T++DVGNP+ NVIPAQ +  FNIRFND   + TLK  +  RL     N  +    + +  
Sbjct: 241 TSVDVGNPATNVIPAQARAKFNIRFNDHHTQDTLKALVEQRLAAACGNRIRAR--IEWLP 298

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
             + VF+T     T L+S SI + TG  P L+T GGTSDARFI  +CPV+EFGLVG+TMH
Sbjct: 299 SNADVFVTKPGAFTDLVSASIADVTGRTPDLNTGGGTSDARFIAKFCPVVEFGLVGQTMH 358

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E   + DL+ LT IY   L+ +F
Sbjct: 359 QIDERTPMSDLDKLTAIYRGVLERYF 384


>gi|27383217|ref|NP_774746.1| succinyl-diaminopimelate desuccinylase [Bradyrhizobium japonicum
           USDA 110]
 gi|81734107|sp|Q89BP2|DAPE_BRAJA RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|27356391|dbj|BAC53371.1| succinyl-diaminopimelate desuccinylase [Bradyrhizobium japonicum
           USDA 110]
          Length = 388

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 183/390 (46%), Positives = 241/390 (61%), Gaps = 9/390 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT D L     LI+CPSVTP D GA  +L N L   GF+     F    T+ V NLYAR 
Sbjct: 1   MT-DALSIARDLIRCPSVTPADAGALGVLENALNAAGFTCHRVTFSEPGTADVDNLYARI 59

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G+E PH+ FAGH DVVP GD + W+   FS  + +G ++GRG VDMKG IAC +AAV   
Sbjct: 60  GSEGPHITFAGHTDVVPAGDESAWSVGAFSGEVKDGFLHGRGAVDMKGGIACSVAAVLEH 119

Query: 121 I------PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHII 174
           +      P+    GSIS LITGDEE  +INGT K+L W  ++GE +D C++GEP+    +
Sbjct: 120 LAANGGKPRGDGTGSISFLITGDEEDVSINGTIKLLKWAAERGETFDHCVLGEPSNVETL 179

Query: 175 GDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPT 234
           GDTIK+GRRGS SG + + G QGHVAYPH   NP+  +  L+  +++   D G+  F  +
Sbjct: 180 GDTIKVGRRGSQSGTLYVDGVQGHVAYPHRASNPVPDISRLIVAISDEPLDHGSAQFQAS 239

Query: 235 NMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTV 294
           N+E T++DVGN + NVIP + +  FNIR+ND   + +L+E + +RL K   N  K    +
Sbjct: 240 NLEFTSVDVGNKANNVIPGEARAKFNIRYNDNHTQASLRELVETRLAKACGNRIKAR--I 297

Query: 295 HFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVG 354
            +    S VF+T     T L   +I   TG  P LSTSGGTSDARFI  YCPVIEFGLVG
Sbjct: 298 VWEPSNSNVFVTKPGPFTDLAVSAIEEITGRKPELSTSGGTSDARFISSYCPVIEFGLVG 357

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNWF 384
           +TMH ++E   ++DLE LT +Y   L  +F
Sbjct: 358 QTMHQVDERVPVKDLEKLTQVYRGILTRYF 387


>gi|254473705|ref|ZP_05087100.1| succinyl-diaminopimelate desuccinylase [Pseudovibrio sp. JE062]
 gi|211957091|gb|EEA92296.1| succinyl-diaminopimelate desuccinylase [Pseudovibrio sp. JE062]
          Length = 401

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 191/382 (50%), Positives = 251/382 (65%), Gaps = 4/382 (1%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            ++    LI+CPSVTP +GGA   L N L   GF +    F  ++T  V+NL+A  G   
Sbjct: 20  AVQICRDLIRCPSVTPAEGGALSTLENLLAGAGFDVSRVTFTDEDTPDVENLFATIGKGK 79

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           PH +FAGH DVVP GD   WT+ PF  TIA+G ++GRG  DMKG +A F AA   ++  +
Sbjct: 80  PHFVFAGHTDVVPVGDEAAWTHGPFDGTIADGMLHGRGTADMKGGVAAFAAAALDYVKAH 139

Query: 125 KN--FGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
            +   G IS LITGDEEGPAINGT K+L W +++G ++DACIVGEPT   ++GD IK+GR
Sbjct: 140 PDGIPGQISFLITGDEEGPAINGTVKLLEWAKEQGHEFDACIVGEPTNPDVLGDAIKVGR 199

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSL+G I ++G QGHVAY HL +NP+ G++ LL  +  +  D GN  F P+N+EITT+D
Sbjct: 200 RGSLTGTIKVNGTQGHVAYQHLADNPVPGMLKLLSAVAEVELDKGNERFQPSNLEITTVD 259

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
           VGN + NVIPA V   FNIRFND W+ K+L E +   L         L  ++ ++   + 
Sbjct: 260 VGNTATNVIPAHVMAKFNIRFNDQWSVKSLSEHVTKLLSDAAPEG--LDWSIEYAKEATD 317

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNE 362
            FLTHD  L   LS SI   TG  P LST GGTSDARFIK+YC V+EFGLVG+TMH ++E
Sbjct: 318 SFLTHDEALIQTLSNSIKTVTGRTPELSTGGGTSDARFIKNYCAVVEFGLVGQTMHKVDE 377

Query: 363 NASLQDLEDLTCIYENFLQNWF 384
           + ++ D+E L  IY  FLQ++F
Sbjct: 378 HVAVADIEQLADIYLRFLQDYF 399


>gi|238064822|sp|Q1QH74|DAPE_NITHX RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 389

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 181/391 (46%), Positives = 239/391 (61%), Gaps = 8/391 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D L     L++CPSVTP D GA  +L   L   GF +    F     + + NLYAR 
Sbjct: 1   MATDALSIARDLVRCPSVTPADAGALGVLEKLLGDAGFEVHRVTFSEPGAADIDNLYARI 60

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   PH+ FAGH DVVPPGD + WT+  FS  + +G +YGRG VDMKG IAC  AA   +
Sbjct: 61  GATGPHIAFAGHTDVVPPGDESAWTHGAFSGEVKDGFLYGRGTVDMKGGIACSAAATLEY 120

Query: 121 IPKYK------NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHII 174
           +  +         GSIS LITGDEE  A+NGT K++ W   +GEK+D C++GEP+    +
Sbjct: 121 LEAHGGRPGKDGNGSISFLITGDEEDIAVNGTVKLMQWAAARGEKFDHCVLGEPSNVAEL 180

Query: 175 GDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPT 234
           GD IKIGRRGS SG + + G QGHVAYPH   NPI  +  L+  L +   D G+  F P+
Sbjct: 181 GDCIKIGRRGSQSGTLYVEGVQGHVAYPHRASNPIPDIAALITALVSEPLDQGSAQFQPS 240

Query: 235 NMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTV 294
           N+  T++DVGNP+ NVIP Q +  FN+RFND  N+++L+  I +R+ K   +  ++   +
Sbjct: 241 NLAFTSVDVGNPANNVIPGQARAKFNVRFNDHHNQESLRALIEARVAKV--SGNRIRTRI 298

Query: 295 HFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVG 354
            +    + VF+T     T L+  +I   TG  P L+T GGTSDARFIKDYCPVIEFGLVG
Sbjct: 299 VWEPSNADVFVTRPGPFTDLVVAAIEEVTGRRPELNTGGGTSDARFIKDYCPVIEFGLVG 358

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNWFI 385
           +TMH ++E A + DLE LT IY   L  +F 
Sbjct: 359 QTMHQIDERAPVADLEKLTRIYHGVLDRYFA 389


>gi|192289058|ref|YP_001989663.1| succinyl-diaminopimelate desuccinylase [Rhodopseudomonas palustris
           TIE-1]
 gi|238064799|sp|B3QCH4|DAPE_RHOPT RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|192282807|gb|ACE99187.1| succinyl-diaminopimelate desuccinylase [Rhodopseudomonas palustris
           TIE-1]
          Length = 387

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 186/386 (48%), Positives = 242/386 (62%), Gaps = 4/386 (1%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           TP  L     L++CPSVTP D GA  +L   LK  GF++    F    T+ + NLYAR G
Sbjct: 4   TPTALSIAQDLLRCPSVTPADAGALDVLETLLKGAGFTVHRVTFSEPGTADIDNLYARIG 63

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
             +PHL FAGH DVVPPGD + WT+  F+  +A+G +YGRG VDMKG IAC +AA   ++
Sbjct: 64  NTSPHLCFAGHTDVVPPGDASAWTHGAFAGDVADGLLYGRGAVDMKGGIACAVAATLDYL 123

Query: 122 --PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
                +  GSIS LITGDEE  A+NGT K+L W  ++GE++D CIVGEP+    IGDTIK
Sbjct: 124 AANGGQPKGSISFLITGDEEDVAVNGTVKLLQWAAERGEQFDHCIVGEPSNVETIGDTIK 183

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGS SG + + G QGHVAYPH   NP+  +  L+  L +   D G+  F P+N+E T
Sbjct: 184 IGRRGSQSGVLIVDGVQGHVAYPHRAANPVPDIARLITTLNDEPLDHGSAQFQPSNLEFT 243

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           ++DVGNP+ NVIPAQ +  FNIRFND   ++TLK  +  RL     N  +    + +   
Sbjct: 244 SVDVGNPATNVIPAQARAKFNIRFNDHHTQETLKALVEQRLAAACGNRIRAH--IEWLPS 301

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
            + VF+T     T L+  +I   TG  P L+T GGTSDARFI  YC V+EFGLVG+TMH 
Sbjct: 302 NADVFVTKPGAFTDLVGAAIAEVTGRTPELNTGGGTSDARFIAKYCQVVEFGLVGQTMHQ 361

Query: 360 LNENASLQDLEDLTCIYENFLQNWFI 385
           ++E   + DL+ LT IY   LQ +F 
Sbjct: 362 IDERTPVSDLDKLTAIYRGVLQRYFA 387


>gi|288957349|ref|YP_003447690.1| succinyl-diaminopimelate desuccinylase [Azospirillum sp. B510]
 gi|288909657|dbj|BAI71146.1| succinyl-diaminopimelate desuccinylase [Azospirillum sp. B510]
          Length = 390

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 185/380 (48%), Positives = 244/380 (64%), Gaps = 7/380 (1%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT D +     LI+CPSVTP+D GA  +L   L  +GF+     FQ + T  V+NLYAR 
Sbjct: 9   MTIDPVALAQDLIRCPSVTPRDDGALGVLEAALTPMGFTCHRLRFQQEGTEPVENLYARL 68

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GTE P+  FAGH DVVPPGD   WT  PF+  +  G+++GRG VDMKG+IA F+AAV+R 
Sbjct: 69  GTEGPNFCFAGHTDVVPPGDR-GWTVDPFAGAVMGGRLFGRGAVDMKGAIAAFVAAVSRR 127

Query: 121 IPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
           +      GSISLLITGDEEG A+NGT+K+L W+ ++GE+ DAC+VGEPT    +GD IKI
Sbjct: 128 LQDGPPAGSISLLITGDEEGVAVNGTRKVLDWMTERGERIDACVVGEPTNPKALGDMIKI 187

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGSL+G +T+ G QGHVAYPHL +NP+  L+ +L  +T    D G   F P+ + +TT
Sbjct: 188 GRRGSLTGFLTVFGAQGHVAYPHLADNPLPRLVRMLAAITEQPMDEGTEHFQPSTLALTT 247

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV 300
           IDV N + NVIPAQ K +FNIRFND      ++  +R              + +      
Sbjct: 248 IDVDNAATNVIPAQGKATFNIRFNDAHTPAGIEAWLRRTFDAVGGA-----YELEVYCSG 302

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL 360
                     LT L+++++   TG  P  ST+GGTSDARFIK+ CPV+EFGLVG+TMH +
Sbjct: 303 DSFVTPP-GPLTELVAEAVEGVTGRRPDYSTTGGTSDARFIKNVCPVVEFGLVGQTMHKV 361

Query: 361 NENASLQDLEDLTCIYENFL 380
           +E  S++DL  LT IYE+ L
Sbjct: 362 DEYCSVEDLRQLTAIYESIL 381


>gi|77464709|ref|YP_354213.1| succinyl-diaminopimelate desuccinylase [Rhodobacter sphaeroides
           2.4.1]
 gi|123590846|sp|Q3IYS2|DAPE_RHOS4 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|77389127|gb|ABA80312.1| succinyldiaminopimelate desuccinylase [Rhodobacter sphaeroides
           2.4.1]
          Length = 380

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 153/387 (39%), Positives = 220/387 (56%), Gaps = 9/387 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D +     L++CPSVTP++GGA  ++   L   GF     D      + V NL+AR+
Sbjct: 1   MPIDPVALTADLVRCPSVTPEEGGALDLIERILSGAGFDCTRVD-----RNGVPNLFARW 55

Query: 61  GTEA--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
           G +       F GH DVVP GD   WT  PF   IA+G ++GRG  DMK  +A F+AA  
Sbjct: 56  GRKGANRTFGFNGHTDVVPVGDAAAWTRDPFGGEIADGWLWGRGATDMKSGVAAFVAAAV 115

Query: 119 RFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
            F+ +    G++ L ITGDEEG + +GT  +L W+  +GE    C+VGEPTC   +G+ +
Sbjct: 116 DFVQETPPDGAVVLTITGDEEGDSTDGTVALLDWMAAEGEAMSVCLVGEPTCPERLGEMM 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGS++   T  G QGH AYPH  +NP+  L  L+ +L++   D G   F  + + +
Sbjct: 176 KIGRRGSMTAFFTARGVQGHSAYPHRAKNPVAALARLIDRLSSHDLDYGTEHFDASTLAV 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           TT D GNP+ NVIPA  + + NIRFND  +  +L   +     +   +           S
Sbjct: 236 TTFDTGNPATNVIPALCRATVNIRFNDAHSGASLTRWLEEEAARVAADTGVEIALSAKIS 295

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
                FLT   +L+ L+++++   TG  P  STSGGTSDARF++ +CPV+EFGLVG+TMH
Sbjct: 296 G--ESFLTPPGELSELVARAVEAETGLRPEPSTSGGTSDARFVRAHCPVVEFGLVGKTMH 353

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            ++E   +  +E L  IY   L+++F 
Sbjct: 354 QVDERVEVAQIEPLKAIYLRILKDYFA 380


>gi|126463549|ref|YP_001044663.1| succinyl-diaminopimelate desuccinylase [Rhodobacter sphaeroides
           ATCC 17029]
 gi|238064803|sp|A3PNH5|DAPE_RHOS1 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|126105213|gb|ABN77891.1| succinyldiaminopimelate desuccinylase [Rhodobacter sphaeroides ATCC
           17029]
          Length = 380

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 154/387 (39%), Positives = 219/387 (56%), Gaps = 9/387 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D +     L++CPSVTP++GGA  ++   L   GF     D      + V NL+AR+
Sbjct: 1   MPIDPVALTADLVRCPSVTPEEGGALDLIERILSGAGFDCTRVD-----RNGVPNLFARW 55

Query: 61  GTEA--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
           G +       F GH DVVP GD   WT  PF   IA+G ++GRG  DMK  +A F+AA  
Sbjct: 56  GRKGANRTFGFNGHTDVVPVGDAAAWTRDPFGGEIADGWLWGRGATDMKSGVAAFVAAAV 115

Query: 119 RFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
            F+ +    G++ L ITGDEEG A +GT  +L W+  +GE    C+VGEPTC   +G+ +
Sbjct: 116 DFVQETPPDGAVVLTITGDEEGDATDGTVALLDWMAAEGEAMSVCLVGEPTCPERLGEMM 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGS++   T  G QGH AYPH  +NP+  L  L+ +L++   D G   F  + + +
Sbjct: 176 KIGRRGSMTAFFTARGVQGHSAYPHRAKNPVAALARLIDRLSSHDLDQGTEHFDASTLAV 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           TT D GNP+ NVIPA  + + NIRFND  +  +L   +     +               S
Sbjct: 236 TTFDTGNPATNVIPALCRATVNIRFNDAHSGASLASWLEEEAARVTAETGVEIALSAKIS 295

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
                FLT   +L+ L+++++   TG  P  STSGGTSDARF++ +CPV+EFGLVG+TMH
Sbjct: 296 G--ESFLTPPGELSELVARAVEAETGLRPEPSTSGGTSDARFVRAHCPVVEFGLVGKTMH 353

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            ++E   +  +E L  IY   L+++F 
Sbjct: 354 QVDERVEVAQIEPLKAIYLRILKDYFA 380


>gi|218673647|ref|ZP_03523316.1| succinyl-diaminopimelate desuccinylase [Rhizobium etli GR56]
          Length = 400

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 217/393 (55%), Positives = 275/393 (69%), Gaps = 8/393 (2%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT  D + +L  LI+CPSVTP +GGA   L   L  LGF++++   + + T+ ++NLYAR
Sbjct: 4   MTATDPVANLQTLIRCPSVTPAEGGALTALDAMLAPLGFTVDKVTAREEGTADIENLYAR 63

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            G E PHLMFAGH DVVP GD   WT+PPF+A I++G+++GRG VDMKG IACF+AAVAR
Sbjct: 64  LGGEGPHLMFAGHTDVVPVGDEAAWTHPPFAAEISKGELFGRGAVDMKGGIACFVAAVAR 123

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
            I K     GSISLLITGDEEGPAINGT K+L W  ++GE+WDAC+VGEPT    +GD I
Sbjct: 124 HIEKNGAPAGSISLLITGDEEGPAINGTVKLLQWATERGERWDACLVGEPTNPDRLGDMI 183

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGSLSG IT+HG QGH AYPHL +NP+RG++ L   L +  FD G   F P+N+E+
Sbjct: 184 KIGRRGSLSGRITVHGVQGHAAYPHLADNPVRGIVQLTQALMDPPFDGGTDDFQPSNLEV 243

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKG------IQNVPKLSH 292
           TT+DVGNP+ NVIPA+   SFNIRFND W   TL+ EI  RL               + +
Sbjct: 244 TTVDVGNPATNVIPAKASASFNIRFNDSWTVDTLRAEILRRLDAAAGNGQLRPGREPVKY 303

Query: 293 TVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGL 352
            + ++   S VFLT +  L + LS ++ + TG  P LST+GGTSDARFIKDYCPV+EFGL
Sbjct: 304 DIVWADRPSHVFLTRNNALIASLSSAVESVTGRSPTLSTTGGTSDARFIKDYCPVVEFGL 363

Query: 353 VGRTMHALNENASLQDLEDLTCIYENFLQNWFI 385
           VG+TMH ++E  ++ DLE LT IYE F+  WF 
Sbjct: 364 VGQTMHMVDERVAVADLETLTAIYETFIDRWFA 396


>gi|254501028|ref|ZP_05113179.1| succinyl-diaminopimelate desuccinylase [Labrenzia alexandrii
           DFL-11]
 gi|222437099|gb|EEE43778.1| succinyl-diaminopimelate desuccinylase [Labrenzia alexandrii
           DFL-11]
          Length = 390

 Score =  267 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 193/386 (50%), Positives = 245/386 (63%), Gaps = 5/386 (1%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+P        LI+CPSVTP++GGA   L   LK  GF ++   FQ  +T  V+NL+A  
Sbjct: 6   MSPAT-AIARNLIRCPSVTPKEGGALSALETLLKDAGFRVDRVVFQDDDTPDVENLFASV 64

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSI--ACFIAAVA 118
           G+ APH +FAGH DVVP G    WT+ PF   +  G +YGRG VDMKG I      A   
Sbjct: 65  GSGAPHFVFAGHTDVVPAGSEADWTHGPFEGEVDSGVLYGRGAVDMKGGIASFAAAALEF 124

Query: 119 RFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
                    G+IS LITGDEEGPAINGT K+L W +K+G ++DACIVGEPT    +GD I
Sbjct: 125 VDQNGTDFGGTISFLITGDEEGPAINGTVKLLEWADKQGHRFDACIVGEPTNPAALGDAI 184

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K+GRRGSLSG +T+ G QGH AYPHL +NPI GL  L+  L ++  D GN  F P+N+EI
Sbjct: 185 KVGRRGSLSGIVTVTGVQGHAAYPHLADNPIPGLTNLMAALNDLKLDEGNERFQPSNLEI 244

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
            T+DVGN + NVIPA+ +  FNIR+ND W   +LK +I   L     N+  L   + F  
Sbjct: 245 VTVDVGNTAFNVIPARAEFRFNIRYNDAWTLDSLKAKILETL--ETVNLGSLKMNIEFKR 302

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
             S  FLT D  L   LSK++   TG  P LST GGTSDARFIK+YCPV+EFGLVG+TMH
Sbjct: 303 DASESFLTKDETLIEALSKAVSEETGRTPELSTGGGTSDARFIKNYCPVVEFGLVGQTMH 362

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E  +++DL+ L  IY  FL ++F
Sbjct: 363 KVDECVAVEDLDRLAAIYHRFLVSYF 388


>gi|304392395|ref|ZP_07374336.1| succinyl-diaminopimelate desuccinylase [Ahrensia sp. R2A130]
 gi|303295499|gb|EFL89858.1| succinyl-diaminopimelate desuccinylase [Ahrensia sp. R2A130]
          Length = 404

 Score =  266 bits (680), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 191/391 (48%), Positives = 247/391 (63%), Gaps = 12/391 (3%)

Query: 7   EHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPH 66
             L  LI CPSVTP++GGA  +L   L+ LGF++E +      T  V+NLYAR G  +P+
Sbjct: 9   ALLRDLIACPSVTPEEGGALTVLQKRLEPLGFTVERRVSTAPGTPDVENLYARLGNASPN 68

Query: 67  LMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFI-AAVARFIPKYK 125
           L FAGH DVVP GD   WT  PF   + +G++ GRG VDMKG IACF+ A          
Sbjct: 69  LCFAGHTDVVPTGDEAAWTSGPFQGDVVDGEMIGRGAVDMKGGIACFLAAVEQHIAAGKP 128

Query: 126 NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGS 185
             GSIS LITGDEEGPA+NGT  +L W+ ++GEK DAC+VGEPT  + +GD IKIGRRGS
Sbjct: 129 VPGSISFLITGDEEGPAVNGTSAVLDWLVERGEKIDACVVGEPTNPNQLGDAIKIGRRGS 188

Query: 186 LSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGN 245
           +SG +T+HG QGH AYPHL +NP RG++ L + L    FD G   F PTN+E+T+ID+GN
Sbjct: 189 VSGTVTVHGTQGHAAYPHLADNPARGIVALCNALMAEPFDEGTEDFQPTNLEVTSIDIGN 248

Query: 246 PSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQ-----------NVPKLSHTV 294
           P+ NV+  Q    FNIRFND W   ++K EI  RL    +             P +   V
Sbjct: 249 PAFNVVAQQATARFNIRFNDTWTADSVKAEIERRLAVASESNAVRPDLPDGARPPVRFDV 308

Query: 295 HFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVG 354
            ++   S VFLT D  L   L+ ++ +  G  P  ST GGTSDARFIKD C V+EFGLVG
Sbjct: 309 VYTERPSHVFLTRDDTLIDSLAGAVEDVIGRRPETSTGGGTSDARFIKDVCSVVEFGLVG 368

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNWFI 385
           +TMH ++E  +L DL+ LT IY  F++++F 
Sbjct: 369 QTMHQVDERVALADLDQLTAIYARFIESYFA 399


>gi|332559602|ref|ZP_08413924.1| succinyl-diaminopimelate desuccinylase [Rhodobacter sphaeroides
           WS8N]
 gi|332277314|gb|EGJ22629.1| succinyl-diaminopimelate desuccinylase [Rhodobacter sphaeroides
           WS8N]
          Length = 380

 Score =  266 bits (680), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 154/387 (39%), Positives = 218/387 (56%), Gaps = 9/387 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D +     L++CPSVTP++GGA  ++   L   GF     D      + V NL+AR+
Sbjct: 1   MPIDPVALTADLVRCPSVTPEEGGALDLIERILSGAGFDCTRVD-----RNGVPNLFARW 55

Query: 61  GTEA--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
           G +       F GH DVVP GD   WT  PF   IA+G ++GRG  DMK  +A F+AA  
Sbjct: 56  GRKGANRTFGFNGHTDVVPVGDAAAWTRDPFGGEIADGWLWGRGATDMKSGVAAFVAAAV 115

Query: 119 RFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
            F+ +    G++ L ITGDEEG A +GT  +L W+  +GE    C+VGEPTC   +G+ +
Sbjct: 116 DFVQETPPDGAVVLTITGDEEGDATDGTVALLDWMAAEGEAMSVCLVGEPTCPERLGEMM 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGS++   T  G QGH AYPH  +NP+  L  L+ +L++   D G   F  + + +
Sbjct: 176 KIGRRGSMTAFFTARGVQGHSAYPHRAKNPVAALARLIDRLSSHDLDQGTEHFDASTLAV 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           TT D GNP+ NVIPA  + + NIRFND  +  +L   +                     S
Sbjct: 236 TTFDTGNPATNVIPALCRATVNIRFNDAHSGASLTRWLEEEAAGVTAETGVEIALSAKIS 295

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
                FLT   +L+ L+++++   TG  P  STSGGTSDARF++ +CPV+EFGLVG+TMH
Sbjct: 296 G--ESFLTPPGELSELVARAVEAETGLRPEPSTSGGTSDARFVRAHCPVVEFGLVGKTMH 353

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            ++E   +  +E L  IY   L+++F 
Sbjct: 354 QVDERVEVAQIEPLKAIYLRILKDYFA 380


>gi|319404960|emb|CBI78562.1| succinyl-diaminopimelate desuccinylase [Bartonella sp. AR 15-3]
          Length = 388

 Score =  266 bits (680), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 208/383 (54%), Positives = 263/383 (68%), Gaps = 1/383 (0%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D ++ L  LI+CPS+TP + GA   L + L+ +GF +E   F  KNT  V+NLYA+ G+E
Sbjct: 6   DPVQLLQILIRCPSITPHEAGALSTLEHFLRKMGFCVERPVFVDKNTEDVENLYAKIGSE 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVPPG   +WTYPPF   I +GK+YGRG VDMKG IACFIAA+ARF+ K
Sbjct: 66  GPHLMFAGHSDVVPPGKLENWTYPPFEGVINQGKLYGRGAVDMKGGIACFIAALARFLEK 125

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               G +S LITGDEEGPAINGT K+L W  +KGEKW+A IVGEPT  +I+GD IKIGRR
Sbjct: 126 KTLKGKVSFLITGDEEGPAINGTVKLLEWAVQKGEKWNAAIVGEPTSVNIVGDVIKIGRR 185

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS+SG ITI G QGHVA+P    NP+     L+  LT    D G   F  +++E+T+ID 
Sbjct: 186 GSISGIITIKGCQGHVAFPERAVNPLPLANKLIQALTQNALDQGTKDFQASHLELTSIDT 245

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGI-QNVPKLSHTVHFSSPVSP 302
           GN S N+IPAQ  + FNIR+NDLW ++ L  EI  RL     +N     + + +   +  
Sbjct: 246 GNFSVNIIPAQTVIRFNIRYNDLWTKEALVAEIEKRLASVHSKNDQLPYYQLEWIYGLGG 305

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNE 362
           VFLT + KL  +LS +I + TGNIP  STSGGTSDARFIKDYCPV+EFGL G TMH ++E
Sbjct: 306 VFLTKNDKLVGILSNAIKSVTGNIPECSTSGGTSDARFIKDYCPVVEFGLPGLTMHMVDE 365

Query: 363 NASLQDLEDLTCIYENFLQNWFI 385
             +L  +E+LT IYE F+ ++F 
Sbjct: 366 CVTLDAIENLTSIYERFITDFFA 388


>gi|13474060|ref|NP_105628.1| succinyl-diaminopimelate desuccinylase [Mesorhizobium loti
           MAFF303099]
 gi|81778660|sp|Q98D57|DAPE_RHILO RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|14024812|dbj|BAB51414.1| succinyl-diaminopimelate desuccinylase [Mesorhizobium loti
           MAFF303099]
          Length = 397

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 213/384 (55%), Positives = 263/384 (68%), Gaps = 8/384 (2%)

Query: 9   LIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLM 68
           L  LI+C SVTP +GGA   L   LK LGF ++   F    T  ++NLYAR     PHLM
Sbjct: 11  LAALIRCASVTPAEGGALGALETMLKPLGFLVDRPVFSEDGTPDIENLYARRSGNGPHLM 70

Query: 69  FAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY-KNF 127
           FAGH DVVP GD   WT+PPF+A IA G++YGRG VDMKG IACF+AA+AR +       
Sbjct: 71  FAGHTDVVPVGDEAAWTHPPFAAEIANGEMYGRGAVDMKGGIACFVAAIARHVENNGGPK 130

Query: 128 GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLS 187
           GS+SLLITGDEEGPAINGT K+L W   +GEKWDA IVGEPT    +GD IKIGRRGSLS
Sbjct: 131 GSVSLLITGDEEGPAINGTVKLLEWAASRGEKWDASIVGEPTNPDTLGDMIKIGRRGSLS 190

Query: 188 GEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPS 247
           G IT++G+QGH AYP L +NP+RGL+ L+  L +  FD G   F PTN+E+T+IDVGNP+
Sbjct: 191 GSITVNGRQGHAAYPQLADNPVRGLMGLVDALLHPVFDKGTKDFQPTNLEVTSIDVGNPA 250

Query: 248 KNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLS-------HTVHFSSPV 300
            NVIPA+   +FNIRFND W  +T++ EI +RL +  +             + + +    
Sbjct: 251 TNVIPAKATATFNIRFNDTWTAETVQAEIHNRLDQAAKRKKYRPGKKTPVDYDLVWRDRP 310

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL 360
           S VFLT D KL   L+ SI    G  P LSTSGGTSDARFIKDYCPV+EFGLVG+TMH +
Sbjct: 311 SHVFLTRDDKLVDTLAGSIKAAVGKEPTLSTSGGTSDARFIKDYCPVVEFGLVGKTMHMV 370

Query: 361 NENASLQDLEDLTCIYENFLQNWF 384
           +E  +L DLE LT IY+ F+++WF
Sbjct: 371 DERVALADLETLTRIYQRFIEDWF 394


>gi|86747802|ref|YP_484298.1| succinyl-diaminopimelate desuccinylase [Rhodopseudomonas palustris
           HaA2]
 gi|123408898|sp|Q2J2C3|DAPE_RHOP2 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|86570830|gb|ABD05387.1| succinyldiaminopimelate desuccinylase [Rhodopseudomonas palustris
           HaA2]
          Length = 389

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 186/390 (47%), Positives = 244/390 (62%), Gaps = 8/390 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT   LE    L++CPSVTP D GA  +L   L+  GF+     F    T+ + NLYAR 
Sbjct: 1   MTATALEIAQALLRCPSVTPADAGALGVLEALLQDAGFATHRVTFSEPGTADIDNLYARI 60

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G  APHL FAGH DVVPPG+   W++  F+  +  G +YGRG VDMKG IAC +AA   +
Sbjct: 61  GDGAPHLCFAGHTDVVPPGEETAWSHGAFAGDVEGGLLYGRGAVDMKGGIACAVAATLDY 120

Query: 121 I------PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHII 174
           +      P+    GSIS LITGDEE  A+NGT K+L W  ++GE++D CIVGEP+    I
Sbjct: 121 LAANGGQPQQSGKGSISFLITGDEEDVAVNGTVKLLQWAAERGERFDHCIVGEPSNVEAI 180

Query: 175 GDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPT 234
           GDTIKIGRRGS SG + + G+QGHVAYPH   NPI  +  L+  L +   D G+  F P+
Sbjct: 181 GDTIKIGRRGSQSGVLIVDGRQGHVAYPHRASNPIPDIATLITALNDEPLDQGSAQFQPS 240

Query: 235 NMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTV 294
           N+E T++DVGNP+ NVIPAQ +  FNIRFND   ++TL+  +  RL     N  +    +
Sbjct: 241 NLEFTSVDVGNPATNVIPAQARAKFNIRFNDHHTQETLRALVEQRLAAACGNRIRAR--I 298

Query: 295 HFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVG 354
            +    + VF+T     T L+S +I + TG  P L+T GGTSDARFI  YCPV+EFGLVG
Sbjct: 299 EWLPSNADVFVTKPGGFTDLVSAAIADITGRSPDLNTGGGTSDARFIAKYCPVVEFGLVG 358

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNWF 384
           +TMH ++E   + DL+ LT IY   L+ +F
Sbjct: 359 QTMHQIDERTPVSDLDKLTAIYRGVLERYF 388


>gi|23010393|ref|ZP_00051097.1| COG0624: Acetylornithine deacetylase/Succinyl-diaminopimelate
           desuccinylase and related deacylases [Magnetospirillum
           magnetotacticum MS-1]
          Length = 382

 Score =  265 bits (678), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 197/380 (51%), Positives = 244/380 (64%), Gaps = 6/380 (1%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           +TP  L     LI+CPSVTP++GGA   L   L   GF IE   F    T  ++NLYAR 
Sbjct: 7   LTP--LALAQALIRCPSVTPEEGGALSFLAEVLARAGFRIERPVFSQDGTPDIENLYARI 64

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   P L+ AGH DVVPPG+   WT+ PFS  +A G +YGRG VDMKG IAC +AA   F
Sbjct: 65  GGGGPVLLLAGHTDVVPPGEVGAWTHGPFSGEVAGGFLYGRGAVDMKGGIACMLAATLAF 124

Query: 121 IPK--YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           + +      GS++ LITGDEEGPAINGT K+L W +++GE++D C++GEPT    +GD I
Sbjct: 125 LDRKGPDFGGSLAFLITGDEEGPAINGTVKLLDWAKRRGERFDHCLLGEPTNPDALGDMI 184

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGSL+G +T+HG+QGHVAYPH  ENPI GL+ L   L     D G   F  +N+E 
Sbjct: 185 KIGRRGSLTGRLTVHGRQGHVAYPHRAENPIPGLLRLASALIAEPLDGGTAHFDASNLEF 244

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           TTIDVGNP+ NVIPA  K  FN+RFND W  +TL  EIR RL         +  ++    
Sbjct: 245 TTIDVGNPATNVIPASAKAVFNVRFNDDWTAETLGAEIRRRLEA--AAGNAVRFSLDLQP 302

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
             SP FLT       L++ +I   TG  P+LST+GGTSDARFIKD CPVIEFGLVG+TMH
Sbjct: 303 SNSPAFLTRPDAFVDLVADAIEAETGRRPVLSTTGGTSDARFIKDACPVIEFGLVGQTMH 362

Query: 359 ALNENASLQDLEDLTCIYEN 378
             +E  ++ DLE LT IY  
Sbjct: 363 ETDERVAVTDLERLTAIYAA 382


>gi|221640623|ref|YP_002526885.1| succinyl-diaminopimelate desuccinylase [Rhodobacter sphaeroides
           KD131]
 gi|238064805|sp|B9KP62|DAPE_RHOSK RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|221161404|gb|ACM02384.1| Succinyldiaminopimelate desuccinylase [Rhodobacter sphaeroides
           KD131]
          Length = 380

 Score =  265 bits (678), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 154/387 (39%), Positives = 219/387 (56%), Gaps = 9/387 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D +     L++CPSVTP++GGA  ++   L   GF     D      + V NL+AR+
Sbjct: 1   MPIDPVALTADLVRCPSVTPEEGGALDLIERILSGAGFDCTRVD-----RNGVPNLFARW 55

Query: 61  GTEA--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
           G +       F GH DVVP GD   WT  PF   IA+G ++GRG  DMK  +A F+AA  
Sbjct: 56  GRKGANRTFGFNGHTDVVPVGDAAAWTRDPFGGEIADGWLWGRGATDMKSGVAAFVAAAV 115

Query: 119 RFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
            F+ +    G++ L ITGDEEG A +GT  +L W+  +GE    C+VGEPTC   +G+ +
Sbjct: 116 DFVQETPPDGAVVLTITGDEEGDAADGTVALLDWMAAEGEAMSVCLVGEPTCPERLGEMM 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGS++   T  G QGH AYPH  +NP+  L  L+ +L++   D G   F  + + +
Sbjct: 176 KIGRRGSMTAFFTARGVQGHSAYPHRAKNPVAALARLIDRLSSHDLDRGTEHFDASTLAV 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           TT D GNP+ NVIPA  + + NIRFND  +  +L   +     +               S
Sbjct: 236 TTFDTGNPATNVIPALCRATVNIRFNDAHSGASLTRWLEEEAARVTAETGVEIALSAKIS 295

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
                FLT   +L+ L+++++   TG  P  STSGGTSDARF++ +CPV+EFGLVG+TMH
Sbjct: 296 G--ESFLTPPGELSELVARAVEAETGLRPEPSTSGGTSDARFVRAHCPVVEFGLVGKTMH 353

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            ++E   +  +E L  IY   L+++F 
Sbjct: 354 QVDERVEVGQIEPLKAIYLRILKDYFA 380


>gi|190890090|ref|YP_001976632.1| succinyl-diaminopimelate desuccinylase [Rhizobium etli CIAT 652]
 gi|190695369|gb|ACE89454.1| succinyl-diaminopimelate desuccinylase protein [Rhizobium etli CIAT
           652]
          Length = 409

 Score =  265 bits (677), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 217/393 (55%), Positives = 274/393 (69%), Gaps = 8/393 (2%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT  D + +L  LI+CPSVTP +GGA   L   L  LGF++++   + + T+ ++NLYAR
Sbjct: 13  MTATDPVANLQTLIRCPSVTPAEGGALTALDAMLTPLGFTVDKVTAREEGTADIENLYAR 72

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            G + PHLMFAGH DVVP GD   WT+PPF+A IA+G+++GRG VDMKG IACF+AAVAR
Sbjct: 73  LGRDGPHLMFAGHTDVVPVGDEAAWTHPPFAAEIAKGELFGRGAVDMKGGIACFVAAVAR 132

Query: 120 FIPKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
            I K     GSISLLITGDEEGPAINGT K+L W  ++GE+WDAC+VGEPT    +GD I
Sbjct: 133 HIEKNGPPAGSISLLITGDEEGPAINGTVKLLQWATERGERWDACLVGEPTNPDRLGDMI 192

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGSLSG IT+HG QGH AYPHL +NP+RG++ L   L +  FD G   F P+N+E+
Sbjct: 193 KIGRRGSLSGRITVHGVQGHAAYPHLADNPVRGIVQLTQALMDPPFDGGTDDFQPSNLEV 252

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKG------IQNVPKLSH 292
           TT+DVGNP+ NVIPA+   SFNIRFND W   TL+ EI  RL               + +
Sbjct: 253 TTVDVGNPATNVIPAKASASFNIRFNDSWTVDTLRAEILRRLDAAAGNGQLRPGREPVKY 312

Query: 293 TVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGL 352
            + ++   S VFLT +  L + LS +I +  G  P LST+GGTSDARFIKDYCPV+EFGL
Sbjct: 313 DIVWADRPSHVFLTRNNALIASLSSAIESVAGRSPALSTTGGTSDARFIKDYCPVVEFGL 372

Query: 353 VGRTMHALNENASLQDLEDLTCIYENFLQNWFI 385
           VG+TMH ++E  ++ DLE LT IYE F+  WF 
Sbjct: 373 VGQTMHMVDERVAVADLETLTAIYETFIDRWFA 405


>gi|23014944|ref|ZP_00054737.1| COG0624: Acetylornithine deacetylase/Succinyl-diaminopimelate
           desuccinylase and related deacylases [Magnetospirillum
           magnetotacticum MS-1]
          Length = 379

 Score =  265 bits (677), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 187/381 (49%), Positives = 242/381 (63%), Gaps = 9/381 (2%)

Query: 3   PDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT 62
            D ++    LI+CPSVTP+D GA  +L   L+ LGF+       T    I  NLYAR GT
Sbjct: 4   SDPVQLAQALIRCPSVTPEDAGALDVLAGALERLGFTCHHIRSSTGGPEIR-NLYARLGT 62

Query: 63  EAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIP 122
           E P+L FAGH DVVPPG    WT  PF   I +G+++GRG  DMKG+I CF+AAVAR + 
Sbjct: 63  EGPNLCFAGHTDVVPPG--KGWTLEPFDGGIDQGRLFGRGSADMKGAIGCFVAAVARMLK 120

Query: 123 KYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
                GSISLLITGDEEGPA++GT K+L W+  +GE+ D CIVGEPT    +GD +KIGR
Sbjct: 121 DGAPKGSISLLITGDEEGPAVDGTVKVLDWLAARGERLDCCIVGEPTNPRKLGDMMKIGR 180

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSL+  +T+ G QGH AYPHL +NPI  L+ +L  LT    D G   F  + + +TT+D
Sbjct: 181 RGSLNCRLTVFGTQGHSAYPHLADNPIPRLLEILRLLTEAPLDEGTPHFQASTLALTTVD 240

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
           VGNP+ NVIPA+ +  FNIRFNDL +  +L + IR  + K    V               
Sbjct: 241 VGNPATNVIPAEARAGFNIRFNDLHSGASLGKWIREIVAKAGGEVEAKIEV------SGE 294

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNE 362
            FLT   KL+  ++++ +  TG  P LSTSGGTSDARFIK++CPV+EFGLVG+TMH  +E
Sbjct: 295 SFLTPPGKLSEAIAQAAFEVTGLTPELSTSGGTSDARFIKNHCPVVEFGLVGQTMHKSDE 354

Query: 363 NASLQDLEDLTCIYENFLQNW 383
           + ++ D+E LT IY   L   
Sbjct: 355 HVAIADMEALTEIYRRVLVRL 375


>gi|170749554|ref|YP_001755814.1| succinyl-diaminopimelate desuccinylase [Methylobacterium
           radiotolerans JCM 2831]
 gi|238064792|sp|B1M6P0|DAPE_METRJ RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|170656076|gb|ACB25131.1| succinyl-diaminopimelate desuccinylase [Methylobacterium
           radiotolerans JCM 2831]
          Length = 392

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 185/382 (48%), Positives = 245/382 (64%), Gaps = 5/382 (1%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L     LI+CPSVTP+D GA  ++ + L+  GF+IE   F         NLYAR G   
Sbjct: 11  ALRLAQDLIRCPSVTPEDRGALDVVADALRPAGFAIERPVFAEPGYPDTPNLYARIGQNG 70

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P L+FAGH DVVP G+   W + PF+  +A+G +YGRG  DMKG +AC +AA   F+ + 
Sbjct: 71  PCLVFAGHTDVVPEGEGA-WRHDPFAGAVADGMLYGRGAADMKGGVACMLAATLAFLDRR 129

Query: 125 K--NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
                GSI+ LITGDEEGPA+NGT K+L W  ++GE++D C++GEPT    +G+ IKIGR
Sbjct: 130 GADFGGSIAFLITGDEEGPAVNGTVKLLDWARRRGERFDHCVLGEPTNPGRLGEMIKIGR 189

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSL+G++T+ G+QGHVAYPH  ENPI GL+ L   L     D G   F  +N+E TT+D
Sbjct: 190 RGSLTGKLTVLGRQGHVAYPHKAENPIPGLLRLASALIAEPLDRGTAHFDASNLEFTTVD 249

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
           VGNP+ NVIP+  + +FN+RFND W  ++L  EIR RL +       +  T+      +P
Sbjct: 250 VGNPATNVIPSTARATFNVRFNDDWTAESLGAEIRRRLEQ--AAGNAVRFTLDLQPSNAP 307

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNE 362
            FLT      +L++++I   TG  P LST+GGTSDARFIKD CPVIEFGLVG TMH ++E
Sbjct: 308 AFLTRPDAFVTLVAEAIRAETGLTPTLSTTGGTSDARFIKDACPVIEFGLVGETMHQVDE 367

Query: 363 NASLQDLEDLTCIYENFLQNWF 384
             ++ DLE LT IY   L  +F
Sbjct: 368 CVAVADLERLTAIYGRVLDAYF 389


>gi|92119154|ref|YP_578883.1| succinyl-diaminopimelate desuccinylase [Nitrobacter hamburgensis
           X14]
 gi|91802048|gb|ABE64423.1| succinyldiaminopimelate desuccinylase [Nitrobacter hamburgensis
           X14]
          Length = 411

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 180/388 (46%), Positives = 238/388 (61%), Gaps = 8/388 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D L     L++CPSVTP D GA  +L   L   GF +    F     + + NLYAR G  
Sbjct: 26  DALSIARDLVRCPSVTPADAGALGVLEKLLGDAGFEVHRVTFSEPGAADIDNLYARIGAT 85

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PH+ FAGH DVVPPGD + WT+  FS  + +G +YGRG VDMKG IAC  AA   ++  
Sbjct: 86  GPHIAFAGHTDVVPPGDESAWTHGAFSGEVKDGFLYGRGTVDMKGGIACSAAATLEYLEA 145

Query: 124 YK------NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDT 177
           +         GSIS LITGDEE  A+NGT K++ W   +GEK+D C++GEP+    +GD 
Sbjct: 146 HGGRPGKDGNGSISFLITGDEEDIAVNGTVKLMQWAAARGEKFDHCVLGEPSNVAELGDC 205

Query: 178 IKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNME 237
           IKIGRRGS SG + + G QGHVAYPH   NPI  +  L+  L +   D G+  F P+N+ 
Sbjct: 206 IKIGRRGSQSGTLYVEGVQGHVAYPHRASNPIPDIAALITALVSEPLDQGSAQFQPSNLA 265

Query: 238 ITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFS 297
            T++DVGNP+ NVIP Q +  FN+RFND  N+++L+  I +R+ K   +  ++   + + 
Sbjct: 266 FTSVDVGNPANNVIPGQARAKFNVRFNDHHNQESLRALIEARVAKV--SGNRIRTRIVWE 323

Query: 298 SPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTM 357
              + VF+T     T L+  +I   TG  P L+T GGTSDARFIKDYCPVIEFGLVG+TM
Sbjct: 324 PSNADVFVTRPGPFTDLVVAAIEEVTGRRPELNTGGGTSDARFIKDYCPVIEFGLVGQTM 383

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H ++E A + DLE LT IY   L  +F 
Sbjct: 384 HQIDERAPVADLEKLTRIYHGVLDRYFA 411


>gi|163857112|ref|YP_001631410.1| succinyl-diaminopimelate desuccinylase [Bordetella petrii DSM
           12804]
 gi|238055173|sp|A9IR81|DAPE_BORPD RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|163260840|emb|CAP43142.1| succinyl-diaminopimelate desuccinylase [Bordetella petrii]
          Length = 380

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 162/389 (41%), Positives = 212/389 (54%), Gaps = 15/389 (3%)

Query: 1   MTPD--CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYA 58
           MT D   L  + +LI  PSVTP D     +L   L+  GF  E           V NL+A
Sbjct: 1   MTADSAVLALVRELIARPSVTPDDVDCQLLLAQRLEHAGFRCETIARGD-----VTNLWA 55

Query: 59  RFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
           R G   P ++FAGH DVVPPG  + W   PF  T  +G +YGRG  DMK SIA F+ A  
Sbjct: 56  RRGNAGPLVVFAGHTDVVPPGPRDKWDSDPFVPTERDGYLYGRGAADMKSSIAAFVVAAE 115

Query: 119 RF-IPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDT 177
            F      + GSI+LL+T DEEGPA++GT  +   +  +GE+ D CIVGEPT   ++GDT
Sbjct: 116 EFTAAHPGHDGSIALLLTSDEEGPAVDGTVIVCDELRARGEQPDYCIVGEPTSGDVLGDT 175

Query: 178 IKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNME 237
            K GRRGSLSG +T+ G QGHVAYPHL  NP+  L P L ++    +D GN  F PT  +
Sbjct: 176 CKNGRRGSLSGRLTVKGIQGHVAYPHLARNPVHQLAPALAEMAATEWDRGNEYFPPTTFQ 235

Query: 238 ITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFS 297
           ++ +  G  + NV+P +  + FN RF+     + LK+ + + L K         + + + 
Sbjct: 236 VSNLRAGTGATNVVPGEAVVLFNFRFSTASTPEGLKQRVHALLDKHGLE-----YELDWE 290

Query: 298 SPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRT 356
               P FLT    LT  L  +I   TG    LST+GGTSD RFI   CP VIEFG    T
Sbjct: 291 LGGEP-FLTPRGPLTDALVAAIRAETGVAAELSTTGGTSDGRFIAKICPQVIEFGPCNAT 349

Query: 357 MHALNENASLQDLEDLTCIYENFLQNWFI 385
           +H +NE   L  LE L  IY   L+N  +
Sbjct: 350 IHKVNERIELASLEPLKNIYRRTLENLLL 378


>gi|238064827|sp|A6VUR6|DAPE_MARMS RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 377

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 157/387 (40%), Positives = 220/387 (56%), Gaps = 14/387 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+P  L+  + LI  PSVTP+D G   +++  LK +GF IE   F       VKN YA+ 
Sbjct: 1   MSP-TLKLALDLISRPSVTPEDAGCQDLMIERLKNIGFEIEYMPFGE-----VKNFYAKR 54

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   P+L FAGH DVVP G    W  PPF+  I +G +YGRG  DMKGS+A  + AV  F
Sbjct: 55  GNSGPNLCFAGHTDVVPTGPEAEWKIPPFAPEIVDGVLYGRGAADMKGSLAAMVTAVENF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + K+ N  G IS LIT DEEGP ++GT +++  + ++ E+ D CIVGEP+    +GD IK
Sbjct: 115 VAKHPNHSGQISFLITSDEEGPFVDGTTRVVDALMERNEQVDWCIVGEPSSTKTLGDIIK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS SG++T++GKQGHVAYPHL ENPI    P L ++ +  +D GN  F PT+ +++
Sbjct: 175 NGRRGSFSGDLTVYGKQGHVAYPHLAENPIHLAAPALAEMASSHWDDGNDFFPPTSFQVS 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  + NV+P ++   FN RF+   +   LK  +   L K       L + + ++  
Sbjct: 235 NIHSGTGATNVVPGKLNAQFNFRFSSELDFDALKVRVIEILDK-----HNLRYDIEWTYN 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P       +L   + +++  T    P LSTSGGTSD RFI      V+E G +  T+H
Sbjct: 290 GLPFLTRP-GELVDAIVEAVQATVNITPELSTSGGTSDGRFIAKMGTQVVELGPINATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            +NE    + L  L+ IY   L+N F 
Sbjct: 349 QINECVDAESLNQLSEIYARILENLFA 375


>gi|83312973|ref|YP_423237.1| succinyl-diaminopimelate desuccinylase [Magnetospirillum magneticum
           AMB-1]
 gi|123540742|sp|Q2W0E7|DAPE_MAGMM RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|82947814|dbj|BAE52678.1| Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase
           and related deacylase [Magnetospirillum magneticum
           AMB-1]
          Length = 379

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 191/385 (49%), Positives = 248/385 (64%), Gaps = 10/385 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +     LI+CPSVTP+D GA  +L   L+ LGF+       T    I  NLYAR GTE
Sbjct: 5   DPVPLAQALIRCPSVTPEDAGALDVLAGALEELGFACHHIRSATGGPEIR-NLYARLGTE 63

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
           AP+L FAGH DVVPPG    WT  PF+A I +G+++GRG  DMKG+IACF+AAVAR +  
Sbjct: 64  APNLCFAGHTDVVPPG--KGWTVEPFAAGIDQGRLFGRGSADMKGAIACFVAAVARLLED 121

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               GS+SLLITGDEEGPA++GT K+L W+  +GE+ D CIVGEPT    +GD +KIGRR
Sbjct: 122 GAPKGSLSLLITGDEEGPAVDGTVKVLDWLAARGERIDCCIVGEPTNPRKLGDMMKIGRR 181

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL+  +T+ G QGH AYPHL +NPI  L+ +L +LT    D G   F  + + +TT+DV
Sbjct: 182 GSLNCRLTVFGTQGHSAYPHLADNPIPRLLDILRRLTEAPLDEGTPHFQASTLALTTVDV 241

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GNP+ NVIPA+ +  FNIRFNDL +  +L+  IR  + +    V      +         
Sbjct: 242 GNPATNVIPAEARAGFNIRFNDLHSGASLERWIRDTVAQAGGEV-----EIKVEVSG-ES 295

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           FLT    L+  L+++ +  TG  P LSTSGGTSDARFIK++CPV+EFGLVG+TMH  +E+
Sbjct: 296 FLTPPGALSDALAEAAFEVTGLRPELSTSGGTSDARFIKNHCPVVEFGLVGQTMHKSDEH 355

Query: 364 ASLQDLEDLTCIYENFLQNWFITPS 388
            S+ D+E LT IY   L      PS
Sbjct: 356 VSVADMEALTEIYRRVLVR-LAAPS 379


>gi|332306433|ref|YP_004434284.1| succinyl-diaminopimelate desuccinylase [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332173762|gb|AEE23016.1| succinyl-diaminopimelate desuccinylase [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 376

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 158/387 (40%), Positives = 218/387 (56%), Gaps = 13/387 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+ + L    +LI   SVTP+D G   ++   L  LGF IE   F+        N++AR 
Sbjct: 1   MSCEVLALTEELINRQSVTPEDAGCQQLMAEYLAPLGFEIETMVFED-----TTNMWARK 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   P   FAGH DVVP G    WT+PPF AT  EG++YGRG  DMKGS+A  + A   F
Sbjct: 56  GKGDPVFCFAGHTDVVPSGPAEKWTFPPFEATQHEGQLYGRGSADMKGSLAAMLVATKAF 115

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + K+  + GSI+ LIT DEEGP INGT +++  +E + EK   C+VGEP+   ++GD +K
Sbjct: 116 VTKHPEHTGSIAFLITSDEEGPFINGTTRVIDTLEARNEKMTWCLVGEPSSTTLVGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+G+I I G QGHVAYPHL +NPI    P   +L    +D+GN +F PT+ +++
Sbjct: 176 NGRRGSLTGDIVIKGVQGHVAYPHLAKNPIHASAPAFAELAQTHWDSGNASFPPTSFQVS 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NVIP  +   FN RF+    +K L E + S L K         + + ++  
Sbjct: 236 NINSGTGAGNVIPGDLTACFNFRFSTEVTDKQLIERVISILDK-----YDFDYEIDWTFN 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P       KL      +I + TG    LST+GGTSD RFI      VIE G V  T+H
Sbjct: 291 GQPFLTD-SGKLVEATQDAIKDVTGRQTELSTAGGTSDGRFIAPTGAQVIELGPVNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            ++EN +++DL +L  IY+  LQ    
Sbjct: 350 KIDENVNIKDLAELAKIYQGILQRLLA 376


>gi|293606182|ref|ZP_06688546.1| succinyl-diaminopimelate desuccinylase [Achromobacter piechaudii
           ATCC 43553]
 gi|292815442|gb|EFF74559.1| succinyl-diaminopimelate desuccinylase [Achromobacter piechaudii
           ATCC 43553]
          Length = 379

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 162/386 (41%), Positives = 217/386 (56%), Gaps = 13/386 (3%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           T   L+ +  LI  PSVTP D      L   L+ +GF+ E           V NL+AR G
Sbjct: 3   TSAVLDLVKDLIARPSVTPADEDCQAALAARLERIGFTCETI-----AQGGVTNLWARRG 57

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
           + AP  +FAGH DVVPPG    W   PF  T  +G +YGRG  DMK SIA F+ A   F+
Sbjct: 58  SAAPLTVFAGHTDVVPPGPREKWDSDPFVPTERDGWLYGRGAADMKSSIAAFVVAAEEFV 117

Query: 122 PKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
             +    GSI+LLIT DEEGP+I+GT  +   ++ +GEK D CIVGEPT   ++GDT K 
Sbjct: 118 AAHPQHDGSIALLITSDEEGPSIDGTAIVCDALKARGEKLDYCIVGEPTSGDVLGDTCKN 177

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGSLSG++T+ G QGHVAYPHL  NP+  L P L ++  I +D GN  F PT  +++ 
Sbjct: 178 GRRGSLSGKLTVKGIQGHVAYPHLARNPVHQLSPALAEIVAIEWDQGNEYFPPTTFQVSN 237

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV 300
           ++ G  + NV+P +    FN RF+     ++LK  + + L K         + + +    
Sbjct: 238 LNSGTGATNVVPGEAVALFNFRFSTASTPESLKARVHAVLDKHGLE-----YELDWDLGG 292

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMHA 359
            P FLT    LT  L ++I+  TG    LST+GGTSD RFI   CP VIEFG    T+H 
Sbjct: 293 EP-FLTPRGSLTDALVQAIHAETGVTAELSTTGGTSDGRFIAKICPQVIEFGPGNATIHK 351

Query: 360 LNENASLQDLEDLTCIYENFLQNWFI 385
           +NE   +  L+ L  IY   L+N  +
Sbjct: 352 VNERIEVASLDPLKNIYRRTLENLLL 377


>gi|303249697|ref|ZP_07335902.1| succinyl-diaminopimelate desuccinylase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307253564|ref|ZP_07535432.1| Succinyl-diaminopimelate desuccinylase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|302651509|gb|EFL81660.1| succinyl-diaminopimelate desuccinylase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306858944|gb|EFM90989.1| Succinyl-diaminopimelate desuccinylase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
          Length = 377

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 145/388 (37%), Positives = 217/388 (55%), Gaps = 13/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  + +     LI+ PS++P D G   ++   L  LGF++E   F         NL+A+ 
Sbjct: 1   MKNNIINLAQDLIRRPSISPADQGCQQVIAERLAQLGFTLEWLPFGD-----TLNLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G+ +P + FAGH DVVP GD   WTYPPF A I +  +YGRG  DMKGS++  + A   F
Sbjct: 56  GSGSPVVAFAGHTDVVPVGDETQWTYPPFEARIVDNMLYGRGAADMKGSLSALVVAAEEF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G+++LLIT DEE  A +GT K++  +  +GE    C+VGEP+   ++GD IK
Sbjct: 116 VKANPNHTGTVALLITSDEEAAAKDGTVKVVETLMARGEPIHYCVVGEPSSGKVLGDVIK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++G++ I G QGHVAYPHL ENP+   +  L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITGDLYIEGVQGHVAYPHLAENPVHTALNFLTELTTYQWDNGNEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN+R+    +++ +K ++   L K         H + ++  
Sbjct: 236 NIKAGTGSNNVIPGELYVQFNLRYCTEVSDEIIKNKVAEMLAKHQLK-----HRISWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P    +  +L     +++ N T   P L TSGGTSD RFI      V+EFG +  T+H
Sbjct: 291 GKPFLAGN-GELVKAAVQAVENVTKITPRLDTSGGTSDGRFIALMGAEVVEFGPLNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFIT 386
            +NE  S++DL     +Y + L+    +
Sbjct: 350 KVNECVSVEDLGKCGEVYYHILERLLKS 377


>gi|39933701|ref|NP_945977.1| succinyl-diaminopimelate desuccinylase [Rhodopseudomonas palustris
           CGA009]
 gi|81564119|sp|Q6NC49|DAPE_RHOPA RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|39647547|emb|CAE26068.1| putative succinyl-diaminopimelate desuccinylase [Rhodopseudomonas
           palustris CGA009]
          Length = 387

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 184/385 (47%), Positives = 242/385 (62%), Gaps = 4/385 (1%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           TP  L     L++CPSVTP D GA  +L   LK  GF++    F    T+ + NLYAR G
Sbjct: 4   TPTALSIAQDLLRCPSVTPADAGALDVLETLLKGAGFTVHRVTFSEPGTADIDNLYARIG 63

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
             +PHL FAGH DVVPPGD + WT+  F+  +A+G +YGRG VDMKG IAC +AA   ++
Sbjct: 64  NTSPHLCFAGHTDVVPPGDASAWTHGAFAGDVADGLLYGRGAVDMKGGIACAVAATLDYL 123

Query: 122 --PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
                +  GSIS LITGDEE  A+NGT K+L W  ++GE++D CIVGEP+    IGDTIK
Sbjct: 124 AANGGQPKGSISFLITGDEEDVAVNGTVKLLQWAAERGEQFDHCIVGEPSNVETIGDTIK 183

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGS SG + + G QGHVAYPH   NP+  +  L+  L +   D G+  F P+N+E T
Sbjct: 184 IGRRGSQSGVLIVDGVQGHVAYPHRAANPVPDIAKLITALNDEPLDHGSAQFQPSNLEFT 243

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           ++DVGNP+ NVIPAQ +  FNIRFND   ++TLK  +  RL+    N  +    + +   
Sbjct: 244 SVDVGNPATNVIPAQARAKFNIRFNDHHTQETLKALVEHRLVAACGNRIRAH--IEWLPS 301

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
            + VF+T     T L+  +I   T   P L+T GGTSDARFI  YC V+EFGLVG+TMH 
Sbjct: 302 NADVFVTKPGAFTDLVGAAIAEVTRRTPELNTGGGTSDARFIAKYCQVVEFGLVGQTMHQ 361

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           ++E   + DL+ LT IY   L+ +F
Sbjct: 362 IDERTPVSDLDKLTAIYRGVLERYF 386


>gi|90422329|ref|YP_530699.1| succinyl-diaminopimelate desuccinylase [Rhodopseudomonas palustris
           BisB18]
 gi|122477312|sp|Q21B56|DAPE_RHOPB RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|90104343|gb|ABD86380.1| succinyldiaminopimelate desuccinylase [Rhodopseudomonas palustris
           BisB18]
          Length = 392

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 183/388 (47%), Positives = 241/388 (62%), Gaps = 8/388 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D L     L++CPSVTP D GA  +L   L   GF++    F    T+ + NLYAR GT 
Sbjct: 7   DALAIAQDLLRCPSVTPADAGALGVLERLLHAAGFAVHRVTFSEPGTADIDNLYARIGTT 66

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
           APH+ FAGH DVVPPGD   W++  F+  + +G +YGRG VDMKG IAC +AAV + +  
Sbjct: 67  APHICFAGHTDVVPPGDEAAWSHDAFAGEVHDGLLYGRGAVDMKGGIACSVAAVLQHLAT 126

Query: 124 YK------NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDT 177
           +         GSIS LITGDEE  A+NGT K+L W   +GE +D C++GEP+    +GDT
Sbjct: 127 HGGQPHESGQGSISFLITGDEEDVAVNGTVKLLQWAAARGETFDHCVLGEPSNVEALGDT 186

Query: 178 IKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNME 237
           IKIGRRGSLSG + + G QGHVAYPH   NP+  +  L+  L     D G  TF P+N+E
Sbjct: 187 IKIGRRGSLSGTLIVDGVQGHVAYPHRASNPVPDIAALIVALGAEPLDAGTDTFQPSNLE 246

Query: 238 ITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFS 297
            T++DVGNP+ NVIPAQ +  FNIRFND  + ++L+  I +R+     N  +    + + 
Sbjct: 247 FTSVDVGNPATNVIPAQARAKFNIRFNDRHSAESLQTLIEARVQAACGNRIRAR--IDWQ 304

Query: 298 SPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTM 357
              +  F+T     T L++ +I + TG  P L+T GGTSDARFI  YCPVIEFGLVG+TM
Sbjct: 305 PSNAGAFVTKPGAFTDLVAAAIEDVTGRKPELNTGGGTSDARFITHYCPVIEFGLVGQTM 364

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H ++E   + DLE LT IY   LQ +F 
Sbjct: 365 HKIDERTPVADLETLTQIYRGVLQRYFA 392


>gi|260461126|ref|ZP_05809375.1| succinyl-diaminopimelate desuccinylase [Mesorhizobium opportunistum
           WSM2075]
 gi|259033160|gb|EEW34422.1| succinyl-diaminopimelate desuccinylase [Mesorhizobium opportunistum
           WSM2075]
          Length = 397

 Score =  264 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 213/384 (55%), Positives = 262/384 (68%), Gaps = 8/384 (2%)

Query: 9   LIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLM 68
           L  LI+C SVTP +GGA   L   LK LGF +E   F    T  ++NLYAR     PHLM
Sbjct: 11  LATLIRCASVTPAEGGALGALETMLKPLGFLVERPVFSEDGTPDIENLYARRSGNGPHLM 70

Query: 69  FAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIP-KYKNF 127
           FAGH DVVP GD   WT+PPF+A IA G++YGRG VDMKG IACFIAAVAR +       
Sbjct: 71  FAGHTDVVPVGDEAAWTHPPFAAEIANGEMYGRGAVDMKGGIACFIAAVARHVEANGGPK 130

Query: 128 GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLS 187
           GS+SLLITGDEEGPAINGT K+L W   +GEKWDA IVGEPT    +GD IKIGRRGS+S
Sbjct: 131 GSVSLLITGDEEGPAINGTVKLLEWAASRGEKWDASIVGEPTNPDALGDMIKIGRRGSMS 190

Query: 188 GEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPS 247
           G +T++G+QGH AYP L +NP+RGL+ L+  L +  FD G   F PTN+E+T+IDVGNP+
Sbjct: 191 GAVTVNGRQGHAAYPQLADNPVRGLMSLVDALLHPVFDKGTRDFQPTNLEVTSIDVGNPA 250

Query: 248 KNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLS-------HTVHFSSPV 300
            NVIPA+    FNIRFND W  +TL+ EI +RL +                + + +    
Sbjct: 251 TNVIPAKAVAVFNIRFNDTWTAETLQAEIHNRLDQAAGRKKYRPGKKTPVDYDLVWRDRP 310

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL 360
           S VFLT D +L   L+ SI +  G  P LSTSGGTSDARFIKDYCPV+EFGLVG+TMH +
Sbjct: 311 SHVFLTRDDRLVETLAGSIKSAVGKEPTLSTSGGTSDARFIKDYCPVVEFGLVGKTMHMV 370

Query: 361 NENASLQDLEDLTCIYENFLQNWF 384
           +E  ++ DLE LT IY+ F+++WF
Sbjct: 371 DERVAIADLETLTRIYQRFIEDWF 394


>gi|260432272|ref|ZP_05786243.1| succinyl-diaminopimelate desuccinylase [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260416100|gb|EEX09359.1| succinyl-diaminopimelate desuccinylase [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 379

 Score =  264 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 161/387 (41%), Positives = 227/387 (58%), Gaps = 10/387 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT D +     LI+CPSVTP++GGA  +L   L   GF+    D        V NL+AR+
Sbjct: 1   MT-DPVNLTADLIRCPSVTPEEGGALVLLEEILSRAGFTCTRVD-----RGGVCNLFARW 54

Query: 61  GTEA--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
           G +       F GH DVVP GD   WT PPF A I +G +YGRG  DMK  +A F+AA  
Sbjct: 55  GDKGHARSFGFNGHTDVVPVGDEAAWTRPPFGAEIHDGILYGRGATDMKSGVAAFVAAAV 114

Query: 119 RFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
            F+      G+I L ITGDEEG A++GT  +L +++ + E+   C+VGEPTC + +G+ +
Sbjct: 115 DFVRDTPPDGAIILTITGDEEGDAVDGTTALLDYMQAQDERMSVCLVGEPTCPNEMGEMM 174

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGS++    + G QGH AYPH  +NP+  L  L+ +L +   D G   F  + + +
Sbjct: 175 KIGRRGSMTAWFEVTGVQGHSAYPHRAKNPLPALARLMDRLASHELDRGTDHFDASTLAV 234

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
            T+D GN + NVIPAQ + + NIRFNDL    +L + ++++             T    S
Sbjct: 235 VTMDTGNAATNVIPAQCRGAVNIRFNDLHTGASLSDWLKAQAADVAAEFGVQIDTRIKVS 294

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
                FLT    L+ L+++++   TG  P LST+GGTSDARFIKD+CPV+EFGLVGRTMH
Sbjct: 295 G--ESFLTPPGPLSDLVARAVEAETGRRPELSTTGGTSDARFIKDHCPVVEFGLVGRTMH 352

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            ++E+  ++ +  L  IY   L ++F 
Sbjct: 353 QVDESVPVEQIRQLKAIYARILADYFA 379


>gi|288940163|ref|YP_003442403.1| succinyl-diaminopimelate desuccinylase [Allochromatium vinosum DSM
           180]
 gi|288895535|gb|ADC61371.1| succinyl-diaminopimelate desuccinylase [Allochromatium vinosum DSM
           180]
          Length = 378

 Score =  264 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 152/387 (39%), Positives = 225/387 (58%), Gaps = 14/387 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+P  LE   +L++ PSVTP+D G   ++   L  +GF++E   F       V NL+AR 
Sbjct: 1   MSP-TLELACELVRRPSVTPEDQGCQELIAERLAAIGFTVEPMPFGE-----VTNLWARR 54

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G+E P L  AGH DVVP G  + W   PF   I +G ++GRG  DMKGS+A  + AV  F
Sbjct: 55  GSEGPLLCLAGHTDVVPAGPLDLWDSDPFDPVIRDGMLHGRGAADMKGSVAAMVTAVESF 114

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  +  + GS++ L+T DEEGPA+NGT K++  ++++GE  D  +VGEP+    +GD+IK
Sbjct: 115 VAAHPDHPGSLAFLLTSDEEGPAVNGTAKVIERLQQRGEHIDYALVGEPSSREQLGDSIK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSLSG +TIHGKQGHVAYPHL +NP       L  L  + +D GN  F PT+ +I 
Sbjct: 175 NGRRGSLSGFLTIHGKQGHVAYPHLAKNPFHAAADALAALCAVVWDQGNAYFPPTSFQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            +++G  ++NVIP Q++  FN+RF+   + +T+K  +R+ L +G  +     + + +   
Sbjct: 235 NLNMGTGAENVIPGQLEAQFNLRFSTELDPETIKRRVRAILDQGDFD-----YELSWRLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P   T   +L      +I    G    LSTSGGTSD RFI      V+E G +  T+H
Sbjct: 290 GHPFLTTP-GELVDAARSAIREVCGIETELSTSGGTSDGRFIAPTGAQVLELGPLNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            ++E  ++ DL+ L  IY   ++   +
Sbjct: 349 QVDECVAVADLDQLHRIYGRMIERLLL 375


>gi|325982874|ref|YP_004295276.1| succinyl-diaminopimelate desuccinylase [Nitrosomonas sp. AL212]
 gi|325532393|gb|ADZ27114.1| succinyl-diaminopimelate desuccinylase [Nitrosomonas sp. AL212]
          Length = 400

 Score =  264 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 170/391 (43%), Positives = 228/391 (58%), Gaps = 13/391 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D LE    LI   S+TP D G   IL++ L+ LGF IE+  F       V NL+AR 
Sbjct: 1   MPNDTLELAQTLIARRSLTPDDDGCQQILIDHLEKLGFHIEKMRF-----GNVDNLWARR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G  AP L FAGH DVVP G    W   PF+ TI +G++YGRG  DMK S+A FI A+  F
Sbjct: 56  GNTAPLLCFAGHTDVVPTGPLEQWDSDPFNPTIRDGRLYGRGAADMKSSLAAFITAIEAF 115

Query: 121 I-PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +     + GSI+LLIT DEEG AI+GT K++  ++ +GE  D CIVGEPTC   +GDTIK
Sbjct: 116 LAQHADHQGSIALLITSDEEGVAIDGTAKVVETLKARGELLDYCIVGEPTCTDKLGDTIK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSLSG +TI G QGH+AYPHL +NPI    P++ +L +  +D GN  F PT   I+
Sbjct: 176 NGRRGSLSGNLTIKGIQGHIAYPHLAKNPIHLAAPVIAELAHTEWDQGNEFFPPTTWHIS 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NVIP  + + FN RF+     ++L  +++  L K   +     + + +   
Sbjct: 236 NINAGTGATNVIPGTLNLLFNFRFSTANTVESLTTKVQETLDKHGLD-----YELQWELS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMH 358
             P +LT   +L   +S +I   T   P LSTSGGTSD RFI D C  V+EFG    T+H
Sbjct: 291 GKP-YLTPKAELADAISAAITKVTAVEPQLSTSGGTSDGRFIADICSQVVEFGPRNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFITPSQ 389
            LNE   + DL+ L+ IY   ++N   +  +
Sbjct: 350 KLNEYVDVDDLDQLSRIYLLTMENLLSSKKE 380


>gi|91974559|ref|YP_567218.1| succinyl-diaminopimelate desuccinylase [Rhodopseudomonas palustris
           BisB5]
 gi|123735883|sp|Q13F22|DAPE_RHOPS RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|91681015|gb|ABE37317.1| succinyldiaminopimelate desuccinylase [Rhodopseudomonas palustris
           BisB5]
          Length = 388

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 189/390 (48%), Positives = 240/390 (61%), Gaps = 6/390 (1%)

Query: 1   MTP--DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYA 58
           MT   D L     L++CPSVTP D GA  +L   LK  GF+     F     + + NLYA
Sbjct: 1   MTSSRDALSIAQALLRCPSVTPADAGALGVLETLLKDAGFTAHRVTFSEPGAADIDNLYA 60

Query: 59  RFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
           R G  APHL FAGH DVVPPGD + W++  FS  +  G +YGRG VDMKG IAC +AAV 
Sbjct: 61  RIGDGAPHLCFAGHTDVVPPGDADAWSHGAFSGDVEGGLLYGRGAVDMKGGIACAVAAVL 120

Query: 119 RFI--PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGD 176
             +     +  GSIS LITGDEE  A+NGT K+L W   +GE +D CIVGEP+    IGD
Sbjct: 121 DHLAAHGGRPKGSISFLITGDEEDVAVNGTVKLLQWAADRGETFDHCIVGEPSNVEAIGD 180

Query: 177 TIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNM 236
           TIKIGRRGS SG + + G QGHVAYPH   NPI  +  L+  L +   D G+  F P+N+
Sbjct: 181 TIKIGRRGSQSGMLIVDGLQGHVAYPHRASNPIPDIAALITALNDEPLDQGSAQFQPSNL 240

Query: 237 EITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHF 296
           E T++DVGNP+ NVIPAQ +  FNIRFND   + +LK  I  RL     N  +    + +
Sbjct: 241 EFTSVDVGNPATNVIPAQARAKFNIRFNDHHTQDSLKALIEQRLAAACGNRIRAR--IEW 298

Query: 297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRT 356
               + VF+T     T L++ SI + TG  P L+T GGTSDARFI  YCPV+EFGLVG+T
Sbjct: 299 LPSNADVFVTKPGNFTDLVTASIADVTGRTPDLNTGGGTSDARFIAKYCPVVEFGLVGQT 358

Query: 357 MHALNENASLQDLEDLTCIYENFLQNWFIT 386
           MH ++E   + DL+ LT IY   L+ +F +
Sbjct: 359 MHQIDERTPVADLDQLTAIYRGVLERYFKS 388


>gi|146276106|ref|YP_001166265.1| succinyl-diaminopimelate desuccinylase [Rhodobacter sphaeroides
           ATCC 17025]
 gi|238064804|sp|A4WNJ6|DAPE_RHOS5 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|145554347|gb|ABP68960.1| succinyldiaminopimelate desuccinylase [Rhodobacter sphaeroides ATCC
           17025]
          Length = 380

 Score =  263 bits (671), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 155/386 (40%), Positives = 222/386 (57%), Gaps = 9/386 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D +     L++CPSVTP++GGA  +L   L   GF     D      + V NL+AR+
Sbjct: 1   MPLDPVALTADLVRCPSVTPEEGGALVLLERILTEAGFDCRRVD-----RNGVPNLFARW 55

Query: 61  GTEA--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
           G +       F GH DVVP GD   WT  PF   IA+G ++GRG  DMK  +A F+AA  
Sbjct: 56  GRKGANRTFGFNGHTDVVPVGDAAAWTRDPFGGEIADGWLWGRGATDMKSGVAAFVAAAV 115

Query: 119 RFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
            F+ +    G++ L ITGDEEG +++GT  +L W+  +GE    C+VGEPTC   +G+ +
Sbjct: 116 DFVQETPPDGAVILTITGDEEGDSVDGTTALLDWMATEGEAMTVCLVGEPTCPERLGEMM 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGS++   T  G QGH AYPH  +NP+  +  L+ +L +   D G   F P+ + +
Sbjct: 176 KIGRRGSMTAFFTARGVQGHSAYPHRAKNPVSAMARLIDRLASHELDKGTGHFDPSTLAV 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           TTID GNP+ NVIPA  + + NIRFND  +  +L   +     +               S
Sbjct: 236 TTIDTGNPATNVIPALCRATVNIRFNDRHSGASLIRWLEQEAAEVAAETGVEIGLSAKIS 295

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
                FLT   +L+ L+++++   TG  P  STSGGTSDARF++ +CPV+EFGLVG+TMH
Sbjct: 296 G--ESFLTPPGELSELVARAVEAETGLRPEPSTSGGTSDARFVRAHCPVVEFGLVGKTMH 353

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E   +  +E L  IY+  L+++F
Sbjct: 354 QVDERVEVAQIEPLKAIYKRILKDYF 379


>gi|152995295|ref|YP_001340130.1| succinyl-diaminopimelate desuccinylase [Marinomonas sp. MWYL1]
 gi|150836219|gb|ABR70195.1| succinyl-diaminopimelate desuccinylase [Marinomonas sp. MWYL1]
          Length = 380

 Score =  263 bits (671), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 155/383 (40%), Positives = 217/383 (56%), Gaps = 13/383 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L+  + LI  PSVTP+D G   +++  LK +GF IE   F       VKN YA+ G   
Sbjct: 7   TLKLALDLISRPSVTPEDAGCQDLMIERLKNIGFEIEYMPFGE-----VKNFYAKRGNSG 61

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P+L FAGH DVVP G    W  PPF+  I +G +YGRG  DMKGS+A  + AV  F+ K+
Sbjct: 62  PNLCFAGHTDVVPTGPEAEWKIPPFAPEIVDGVLYGRGAADMKGSLAAMVTAVENFVAKH 121

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
            N  G IS LIT DEEGP ++GT +++  + ++ E+ D CIVGEP+    +GD IK GRR
Sbjct: 122 PNHSGQISFLITSDEEGPFVDGTTRVVDALMERNEQVDWCIVGEPSSTKTLGDIIKNGRR 181

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS SG++T++GKQGHVAYPHL ENPI    P L ++ +  +D GN  F PT+ +++ I  
Sbjct: 182 GSFSGDLTVYGKQGHVAYPHLAENPIHLAAPALAEMASSHWDDGNDFFPPTSFQVSNIHS 241

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NV+P ++   FN RF+   +   LK  +   L K       L + + ++    P 
Sbjct: 242 GTGATNVVPGKLNAQFNFRFSSELDFDALKVRVIEILDK-----HNLRYDIEWTYNGLPF 296

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
                 +L   + +++  T    P LSTSGGTSD RFI      V+E G +  T+H +NE
Sbjct: 297 LTRP-GELVDAIVEAVQATVNITPELSTSGGTSDGRFIAKMGTQVVELGPINATIHQINE 355

Query: 363 NASLQDLEDLTCIYENFLQNWFI 385
               + L  L+ IY   L+N F 
Sbjct: 356 CVDAESLNQLSEIYARILENLFA 378


>gi|307943165|ref|ZP_07658510.1| succinyl-diaminopimelate desuccinylase [Roseibium sp. TrichSKD4]
 gi|307773961|gb|EFO33177.1| succinyl-diaminopimelate desuccinylase [Roseibium sp. TrichSKD4]
          Length = 391

 Score =  262 bits (670), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 196/382 (51%), Positives = 252/382 (65%), Gaps = 4/382 (1%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            +     LI+CPSVTP++GGA   L +TL+  GF +E   F  ++T  V+NL+A  G+  
Sbjct: 7   AVRVARDLIRCPSVTPKEGGALNSLQSTLEAAGFKVERVTFSDQDTPDVENLFASIGSGK 66

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAA--VARFIP 122
           PH +FAGH DVVPPGD + W++ PF+  IA G++YGRG VDMKG IA F AA        
Sbjct: 67  PHFVFAGHTDVVPPGDNSSWSHDPFAGDIAGGRLYGRGAVDMKGGIAAFAAAALWFVEEN 126

Query: 123 KYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
                G IS LITGDEEGPA+NGT K+L W + +G  +DACIVGEPT    +GD IK+GR
Sbjct: 127 GTDFGGQISFLITGDEEGPAVNGTAKLLDWAQSQGHVFDACIVGEPTNPDHLGDAIKVGR 186

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSLSG I + G QGH AYPHL +NPI GLI LL  L  +  D GN  F P+N+EI T+D
Sbjct: 187 RGSLSGTIEVTGTQGHAAYPHLADNPIPGLIKLLSGLDQMKLDDGNERFQPSNLEIVTVD 246

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
           VGN + NVIP +    FNIRFND W+   LK+++   L +       L+ T+ F    S 
Sbjct: 247 VGNTAFNVIPERATGKFNIRFNDEWDLAGLKDKVTGVLQQAAPEG--LNWTIEFKRDASE 304

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNE 362
            FLT D+KL   LS +I NT G  P LST GGTSDARFIK+YCPV+EFGLVG+TMH ++E
Sbjct: 305 PFLTKDQKLIETLSNAIENTVGRTPELSTGGGTSDARFIKNYCPVVEFGLVGQTMHKVDE 364

Query: 363 NASLQDLEDLTCIYENFLQNWF 384
           + ++ DL+ L  +Y  FL+++F
Sbjct: 365 HVAIADLDQLAVVYSQFLKSYF 386


>gi|239832656|ref|ZP_04680985.1| succinyl-diaminopimelate desuccinylase [Ochrobactrum intermedium
           LMG 3301]
 gi|239824923|gb|EEQ96491.1| succinyl-diaminopimelate desuccinylase [Ochrobactrum intermedium
           LMG 3301]
          Length = 395

 Score =  262 bits (670), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 215/386 (55%), Positives = 269/386 (69%), Gaps = 8/386 (2%)

Query: 7   EHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPH 66
           E+L  LI+CPSVTP +GGA   L   LK +GFS+E   F+ + T  ++NLYAR     PH
Sbjct: 9   ENLAALIRCPSVTPAEGGALTALEAMLKPMGFSVERPVFRDEGTPDIENLYARKSGNGPH 68

Query: 67  LMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKN 126
           LMFAGH DVVPPG+   W +PPFSA I +G +YGRG VDMKG +ACF+AAVAR I K+ +
Sbjct: 69  LMFAGHTDVVPPGNEGDWKHPPFSAAIEDGVMYGRGAVDMKGGVACFVAAVARHIEKHGS 128

Query: 127 -FGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGS 185
             GS+S LITGDEEGPAINGT K+L W +++GE WDA IVGEPT  + +GD IKIGRRGS
Sbjct: 129 LKGSVSFLITGDEEGPAINGTVKLLDWAKQRGESWDASIVGEPTNPNALGDMIKIGRRGS 188

Query: 186 LSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGN 245
           LSG IT+HG QGH AYPHL ENP+RG+  L+  L    FD G   F  +N+E+TTIDVGN
Sbjct: 189 LSGIITVHGVQGHAAYPHLAENPVRGITTLVDSLLYPAFDAGTADFQASNLEVTTIDVGN 248

Query: 246 PSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVP-------KLSHTVHFSS 298
            + NVI  +   SFNIRFND W  ++L+ EI +RL K  ++          +++ + +  
Sbjct: 249 TATNVIANKATASFNIRFNDTWTAESLQAEIVARLEKAARDNRLRPGRETPINYELTWRE 308

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
             S VFLT D KL   L+ S+   TG  P LSTSGGTSDARFIKDYCPV+EFGLVG+TMH
Sbjct: 309 HPSHVFLTRDEKLIGTLTASVEAVTGKRPELSTSGGTSDARFIKDYCPVVEFGLVGQTMH 368

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E  +L DLE LT IYE F+ ++F
Sbjct: 369 MVDERVALADLEGLTQIYERFIADFF 394


>gi|62317859|ref|YP_223712.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 1 str.
           9-941]
 gi|83269837|ref|YP_419128.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis biovar
           Abortus 2308]
 gi|189023109|ref|YP_001932850.1| succinyl-diaminopimelate desuccinylase [Brucella abortus S19]
 gi|237817400|ref|ZP_04596392.1| succinyl-diaminopimelate desuccinylase [Brucella abortus str. 2308
           A]
 gi|254699149|ref|ZP_05160977.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254732593|ref|ZP_05191171.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 4 str.
           292]
 gi|260545094|ref|ZP_05820915.1| succinyl-diaminopimelate desuccinylase [Brucella abortus NCTC 8038]
 gi|260760405|ref|ZP_05872753.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 4 str.
           292]
 gi|260763645|ref|ZP_05875977.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|75495359|sp|Q576T3|DAPE_BRUAB RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|123545679|sp|Q2YJQ6|DAPE_BRUA2 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238055176|sp|B2SC17|DAPE_BRUA1 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|62198052|gb|AAX76351.1| DapE, succinyl-diaminopimelate desuccinylase [Brucella abortus bv.
           1 str. 9-941]
 gi|82940111|emb|CAJ13159.1| ArgE/dapE/ACY1/CPG2/yscS:Peptidase M20/M25/M40:Proteobacterial
           succinyl-diaminopimelate desuccinylase [Brucella
           melitensis biovar Abortus 2308]
 gi|189021683|gb|ACD74404.1| succinyl-diaminopimelate desuccinylase [Brucella abortus S19]
 gi|237788213|gb|EEP62429.1| succinyl-diaminopimelate desuccinylase [Brucella abortus str. 2308
           A]
 gi|260098365|gb|EEW82239.1| succinyl-diaminopimelate desuccinylase [Brucella abortus NCTC 8038]
 gi|260670723|gb|EEX57663.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 4 str.
           292]
 gi|260674066|gb|EEX60887.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 2 str.
           86/8/59]
          Length = 395

 Score =  262 bits (670), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 218/389 (56%), Positives = 270/389 (69%), Gaps = 8/389 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           + +++L  LI+CPSVTP +GGA   L   LKL+GFS     F   NT  ++NLYAR    
Sbjct: 6   NPVDNLAALIRCPSVTPAEGGALTALEKMLKLMGFSANRPVFSDDNTPDIENLYARKSGN 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVPPGD   W +PPF+A I +G +YGRG VDMKG IACF+AAVAR I K
Sbjct: 66  GPHLMFAGHTDVVPPGDEKDWKHPPFAAEIEDGVMYGRGAVDMKGGIACFVAAVARHIEK 125

Query: 124 YKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
           + N  GSIS LITGDEEGPA+NGT K+L W +++GE WDA IVGEPT  + +GD IKIGR
Sbjct: 126 HGNIKGSISFLITGDEEGPAVNGTVKLLEWAKQRGESWDASIVGEPTNPNALGDMIKIGR 185

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSLSG IT+HG QGH AYPHL ENP+RG++ L+  L    FD G   F  +N+E+TTID
Sbjct: 186 RGSLSGTITVHGVQGHAAYPHLAENPVRGIVTLVDSLLYPAFDEGTANFQASNLEVTTID 245

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVP-------KLSHTVH 295
           VGN + NVIP +   SFNIRFND W  ++L+ EI SRL +  ++          + + + 
Sbjct: 246 VGNKATNVIPNKATASFNIRFNDTWTAESLQAEIISRLERAARDNRLRQGRETPIKYELT 305

Query: 296 FSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGR 355
           +    S VFLTHD KL   L+ S+   TG  P LSTSGGTSDARFIKDYCPV+EFGL G+
Sbjct: 306 WRERPSHVFLTHDEKLIGTLTASVEAVTGKRPELSTSGGTSDARFIKDYCPVVEFGLTGQ 365

Query: 356 TMHALNENASLQDLEDLTCIYENFLQNWF 384
           TMH ++E  +L DLE LT IYE F+ ++F
Sbjct: 366 TMHMVDERVALADLEGLTQIYERFIADFF 394


>gi|319780353|ref|YP_004139829.1| succinyl-diaminopimelate desuccinylase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166241|gb|ADV09779.1| succinyl-diaminopimelate desuccinylase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 397

 Score =  262 bits (670), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 215/392 (54%), Positives = 269/392 (68%), Gaps = 8/392 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           +  D  E+L  LI+C SVTP +GGA   L   LK LGF ++   F    T  ++NLYAR 
Sbjct: 3   LPTDPAENLAALIRCASVTPAEGGALTALETMLKPLGFLVDRPVFSEDGTPDIENLYARR 62

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
               PHLMFAGH DVVP GD   WT+PPF+A IA G++YGRG VDMKG IACFIAAVAR 
Sbjct: 63  SGNGPHLMFAGHTDVVPVGDEAAWTHPPFAAEIANGEMYGRGAVDMKGGIACFIAAVARH 122

Query: 121 IP-KYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +       GS+SLLITGDEEGPAINGT K+L W   +GEKWDA +VGEPT    +GD IK
Sbjct: 123 VEANGGPKGSVSLLITGDEEGPAINGTVKLLEWAASRGEKWDASVVGEPTNPDALGDMIK 182

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGS+SG +T++G+QGHVAYP L +NP+RGL+ L+  L +  FD G   F PTN+EIT
Sbjct: 183 IGRRGSMSGAVTVNGRQGHVAYPLLADNPVRGLMSLVDALLHPVFDKGTRDFQPTNLEIT 242

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLS-------H 292
           +IDVGNP+ NVIPA+   +FNIRFND W ++TL+ EI +RL +  +             +
Sbjct: 243 SIDVGNPATNVIPAKATATFNIRFNDTWTDETLQAEIHNRLDQAARRKKYRQGKKTPVDY 302

Query: 293 TVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGL 352
            + +    S VFLT D +L   L  SI +  G  P LSTSGGTSDARFIKDYCPV+EFGL
Sbjct: 303 ELVWRDRPSHVFLTRDDRLIETLRGSIKSAVGKEPTLSTSGGTSDARFIKDYCPVVEFGL 362

Query: 353 VGRTMHALNENASLQDLEDLTCIYENFLQNWF 384
           VG+TMH ++E  ++ DLE LT IY+ F+++WF
Sbjct: 363 VGKTMHMVDERVAIADLETLTQIYQRFIEDWF 394


>gi|71065129|ref|YP_263856.1| succinyl-diaminopimelate desuccinylase [Psychrobacter arcticus
           273-4]
 gi|123649391|sp|Q4FU86|DAPE_PSYA2 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|71038114|gb|AAZ18422.1| succinyldiaminopimelate desuccinylase [Psychrobacter arcticus
           273-4]
          Length = 407

 Score =  262 bits (670), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 167/388 (43%), Positives = 225/388 (57%), Gaps = 8/388 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQT----KNTSIVKNLYAR 59
           + L+  I L++ PSVTP D G   IL   L   GF  E   +         + VKNL+AR
Sbjct: 21  ETLDLSIALLERPSVTPNDDGCQDILSERLTQAGFDCEFMYYGDRQAKGEHAEVKNLWAR 80

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT  P + FAGH DVVP GD  +WTYPPF+ TIA+G ++ RG  DMK  IA F  A  R
Sbjct: 81  RGTSNPVICFAGHTDVVPTGDEKNWTYPPFTPTIADGYLWARGAADMKTGIAAFTIAAER 140

Query: 120 FIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+  +    GSI+ LIT DEEGP+INGT K++  +E + EK   C+VGEP+    +GD I
Sbjct: 141 FVANHPQHNGSIAFLITSDEEGPSINGTVKVIETLEARQEKITYCLVGEPSSTDTLGDII 200

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSL   +T+ GKQGHVAYPHL  NPI   +  L +LTN  +D GN  F  T+++I
Sbjct: 201 KNGRRGSLGAVLTVTGKQGHVAYPHLASNPIHAAMSALSELTNASWDNGNDYFPATSLQI 260

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP  +++ FN RF+    E  LK +  +   K  ++  K  + +H+  
Sbjct: 261 SNINGGTGATNVIPETLEVVFNFRFSTETTEDELKAKTHAIFDKYFKDS-KAKYDIHWKL 319

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTM 357
              P FLT + KL S   ++I + TG    LSTSGGTSD RFI      V+E G+   T+
Sbjct: 320 SGQP-FLTPEGKLVSACQQAIKSVTGTDTTLSTSGGTSDGRFIAPTGAQVVELGVRNATI 378

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H ++E   + DL  L  IYE  L+N  +
Sbjct: 379 HQVDEKVEVDDLGRLAQIYERILENLLL 406


>gi|254696040|ref|ZP_05157868.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 3 str.
           Tulya]
 gi|261216472|ref|ZP_05930753.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 3 str.
           Tulya]
 gi|260918079|gb|EEX84940.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 3 str.
           Tulya]
          Length = 395

 Score =  262 bits (670), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 217/389 (55%), Positives = 269/389 (69%), Gaps = 8/389 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           + +++L  LI+CPSVTP +GGA   L   LKL+GFS     F   NT  ++NLYAR    
Sbjct: 6   NPVDNLAALIRCPSVTPAEGGALTALEKMLKLMGFSANRPVFSDGNTPDIENLYARKSGN 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVPPGD   W +PPF+A I +G +YGRG VDMKG IACF+AAVAR I K
Sbjct: 66  GPHLMFAGHTDVVPPGDEKDWKHPPFAAAIEDGVMYGRGAVDMKGGIACFVAAVARHIEK 125

Query: 124 YKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
           + N  GSIS LITGDEEGPA+NGT K+L W +++GE WDA IVGEPT  + +GD IKIGR
Sbjct: 126 HGNIKGSISFLITGDEEGPAVNGTVKLLEWAKQRGESWDASIVGEPTNPNALGDMIKIGR 185

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSLSG IT+HG QGH AYPHL ENP+ G++ L+  L    FD G   F  +N+E+TTID
Sbjct: 186 RGSLSGTITVHGVQGHAAYPHLAENPVHGIVTLVDSLLYPAFDEGTANFQASNLEVTTID 245

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVP-------KLSHTVH 295
           VGN + NVIP +   SFNIRFND W  ++L+ EI SRL +  ++          + + + 
Sbjct: 246 VGNKATNVIPNKATASFNIRFNDTWTAESLQAEIISRLERAARDNRLRQGRETPIKYELT 305

Query: 296 FSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGR 355
           +    S VFLTHD KL   L+ S+   TG  P LSTSGGTSDARFIKDYCPV+EFGL G+
Sbjct: 306 WRERPSHVFLTHDEKLIGTLTASVEAVTGKRPELSTSGGTSDARFIKDYCPVVEFGLTGQ 365

Query: 356 TMHALNENASLQDLEDLTCIYENFLQNWF 384
           TMH ++E  +L DLE LT IYE F+ ++F
Sbjct: 366 TMHMVDERVALADLEGLTQIYERFIADFF 394


>gi|109898509|ref|YP_661764.1| succinyl-diaminopimelate desuccinylase [Pseudoalteromonas atlantica
           T6c]
 gi|123064569|sp|Q15TS8|DAPE_PSEA6 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|109700790|gb|ABG40710.1| succinyldiaminopimelate desuccinylase [Pseudoalteromonas atlantica
           T6c]
          Length = 376

 Score =  262 bits (669), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 159/387 (41%), Positives = 217/387 (56%), Gaps = 13/387 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+ + L    +LI   SVTP+D G   ++   L  LGF IE   F         N++AR 
Sbjct: 1   MSCEVLALTEELINRQSVTPEDAGCQQLMAEYLAPLGFDIESMVFDD-----TTNMWARK 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT  P   FAGH DVVP G    WT+PPF+AT  EG++YGRG  DMKGS+A  + A   F
Sbjct: 56  GTGGPVFCFAGHTDVVPSGPAEKWTFPPFTATQHEGQLYGRGAADMKGSLAAMLVATKAF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + K+    GSI+ LIT DEEGP INGT +++  +E + EK   C+VGEP+   +IGD +K
Sbjct: 116 VTKHPEHSGSIAFLITSDEEGPFINGTTRVIDTLEARNEKMTWCLVGEPSSTTLIGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+G+IT+ G QGHVAYPHL +NPI    P   +L    +D+GN +F PT+ +++
Sbjct: 176 NGRRGSLTGDITVKGVQGHVAYPHLAKNPIHLSAPAFAELAQTHWDSGNASFPPTSFQVS 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NVIP  +   FN RF+    +K L E + + L K         + + ++  
Sbjct: 236 NINSGTGAGNVIPGDLSACFNFRFSTEVTDKQLIERVTTILDK-----YDFDYHIDWTFN 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P       KL      +I + TG    LST+GGTSD RFI      VIE G +  T+H
Sbjct: 291 GQPFLTD-SGKLVEATQSAIKDVTGRETELSTAGGTSDGRFIAPTGAQVIELGPINATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            ++EN ++ DL  L  IYE  LQ    
Sbjct: 350 KIDENVNINDLAQLAKIYEGILQRLLA 376


>gi|311107249|ref|YP_003980102.1| succinyl-diaminopimelate desuccinylase [Achromobacter xylosoxidans
           A8]
 gi|310761938|gb|ADP17387.1| succinyl-diaminopimelate desuccinylase [Achromobacter xylosoxidans
           A8]
          Length = 377

 Score =  262 bits (669), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 161/388 (41%), Positives = 216/388 (55%), Gaps = 13/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   L+ +  LI  PSVTP D      L   L+ +GF+ E           V NL+AR 
Sbjct: 1   MSTAVLDLVKDLIARPSVTPADEDCQATLAARLERIGFTCETI-----AQGGVTNLWARR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G+ AP  +FAGH DVVPPG    W   PF  T  +G +YGRG  DMK SIA F+ A   F
Sbjct: 56  GSAAPLAVFAGHTDVVPPGPREKWDSDPFVPTERDGYLYGRGAADMKSSIAAFVVAAEEF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  +    GSI+LLIT DEEGP+I+GT  +   ++ +GE+ D CIVGEPT   ++GDT K
Sbjct: 116 VAAHPQHGGSIALLITSDEEGPSIDGTAIVCDALKARGEQMDYCIVGEPTSGDVLGDTCK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSLSG++T+ G QGHVAYPHL  NP+  L P L  + NI +D GN  F PT  +++
Sbjct: 176 NGRRGSLSGKLTVKGIQGHVAYPHLARNPVHQLAPALADIVNIEWDQGNEYFPPTTFQVS 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            ++ G  + NV+P +    FN RF+     + L+  +   L +         +T+ +   
Sbjct: 236 NLNSGTGATNVVPGEAVALFNFRFSTASTPEGLQARVHEVLDRHGLE-----YTLDWELG 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMH 358
             P FLT    LT  L  +I + TG    LST+GGTSD RFI   CP VIEFG    T+H
Sbjct: 291 GEP-FLTPRGSLTDALVSAIRDETGVTAELSTTGGTSDGRFIAKICPQVIEFGPCNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFIT 386
            +NE   +  L+ L  IY   L+N  + 
Sbjct: 350 KVNERVEVASLDPLKNIYRRTLENLLLA 377


>gi|126732709|ref|ZP_01748505.1| succinyl-diaminopimelate desuccinylase [Sagittula stellata E-37]
 gi|126706839|gb|EBA05909.1| succinyl-diaminopimelate desuccinylase [Sagittula stellata E-37]
          Length = 379

 Score =  262 bits (668), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 162/387 (41%), Positives = 227/387 (58%), Gaps = 10/387 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT D ++   +L++CPSVTP++GGA  +L + L   GF     D        + NL+AR+
Sbjct: 1   MT-DPVDLTARLVRCPSVTPEEGGALVLLQDMLSDAGFECTRVD-----RGGISNLFARW 54

Query: 61  GTEA--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
           G +       F GH DVVP G    W + PF A I  G +YGRG  DMK  +A F AA  
Sbjct: 55  GAKGAAKTFGFNGHTDVVPIGRREDWQHDPFGAEIDGGMMYGRGTTDMKSGVAAFAAAAM 114

Query: 119 RFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
            F+      G++ L ITGDEEG +++GT  +L W+E +GEK   C+VGEPTC   +G  I
Sbjct: 115 DFVTATPPDGAVVLAITGDEEGDSVDGTTALLDWMEAEGEKMSVCLVGEPTCPDHMGQMI 174

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGS+S   T+ GKQGH AYPH   NP+  +  L+ +L +   D+G   F P+ + +
Sbjct: 175 KIGRRGSMSAWFTVEGKQGHSAYPHRALNPLPAMARLMDRLASHELDSGTDHFDPSTLAV 234

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
            TID GNP+ NVIPA+     NIRFND  +  +L E +R++  +        +      S
Sbjct: 235 VTIDTGNPATNVIPAKCSACVNIRFNDAHSGASLSEWLRAQAAEVDAAFGTTTDLKIKIS 294

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
                FLT    L+ L++ ++   TG  P  ST+GGTSDARF+K++CPV+EFGLVG+TMH
Sbjct: 295 G--ESFLTPPGYLSDLVANAVEAETGVKPEYSTTGGTSDARFVKNHCPVVEFGLVGQTMH 352

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
           A++E  S++ +  L  IY   LQ++F 
Sbjct: 353 AVDERVSVEQIGQLKAIYTRILQDYFA 379


>gi|294678819|ref|YP_003579434.1| succinyl-diaminopimelate desuccinylase [Rhodobacter capsulatus SB
           1003]
 gi|294477639|gb|ADE87027.1| succinyl-diaminopimelate desuccinylase [Rhodobacter capsulatus SB
           1003]
          Length = 379

 Score =  262 bits (668), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 163/386 (42%), Positives = 227/386 (58%), Gaps = 8/386 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT D ++    LI+CPSVTP +GGA  +L   L   GF+    D      +   NL+AR+
Sbjct: 1   MTLDPVQLTADLIRCPSVTPVEGGALVLLERVLSAAGFACTRVD-----RNGTPNLFARW 55

Query: 61  G-TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
           G   A    F GH DVVP GD   WT  PFS  + EG ++GRG  DMK  +A F+AA   
Sbjct: 56  GAKGAKTFGFNGHTDVVPVGDAAAWTQEPFSGAVIEGVLWGRGATDMKSGVAAFVAAAVD 115

Query: 120 FIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           F+      G+I L ITGDEEGP  +G   +L W++ +GE    C+VGEPTC   +GD +K
Sbjct: 116 FVTTTPPEGAIILTITGDEEGPGKDGALALLDWMKAEGEAMSVCLVGEPTCPETLGDMMK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGS++  + + G QGH AYPH  +NP+  L+ LL ++T    D G   F P+ ++IT
Sbjct: 176 IGRRGSMTFYLEVEGVQGHSAYPHRAKNPLHALVELLGRMTAEPLDRGTEHFEPSTLQIT 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           TID GNP+ NVIPA+ + + NIRFND  +   +++  R  + +               S 
Sbjct: 236 TIDCGNPANNVIPAKARATVNIRFNDAHSSAKIEDWARGLIAEIEAETGTRVSLCTEVSG 295

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
               FLT       L+S+++ + TG +P+LSTSGGTSDARF+KD+CPV+EFGLVG+TMH 
Sbjct: 296 --ESFLTPPGDFVELVSRAVVSETGVVPVLSTSGGTSDARFVKDHCPVLEFGLVGKTMHQ 353

Query: 360 LNENASLQDLEDLTCIYENFLQNWFI 385
           ++E   +  +  L  IY   L+++F 
Sbjct: 354 VDERIEVAQITRLKAIYARCLRDFFA 379


>gi|17988612|ref|NP_541245.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis bv. 1
           str. 16M]
 gi|260565075|ref|ZP_05835560.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis bv. 1
           str. 16M]
 gi|81850740|sp|Q8YDB0|DAPE_BRUME RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|17984414|gb|AAL53509.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis bv. 1
           str. 16M]
 gi|260152718|gb|EEW87811.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis bv. 1
           str. 16M]
          Length = 395

 Score =  262 bits (668), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 218/389 (56%), Positives = 270/389 (69%), Gaps = 8/389 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           + +++L  LI+CPSVTP +GGA   L   LKL+GFS     F   NT  ++NLYAR    
Sbjct: 6   NPVDNLAALIRCPSVTPAEGGALTALEKMLKLMGFSANRPVFSDDNTPDIENLYARKSGN 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVPPGD   W +PPF+A I +G +YGRG VDMKG IACF+AAVAR I K
Sbjct: 66  GPHLMFAGHTDVVPPGDEKDWKHPPFAAAIEDGVMYGRGAVDMKGGIACFVAAVARHIEK 125

Query: 124 YKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
           + N  GSIS LITGDEEGPA+NGT K+L W +++GE WDA IVGEPT  + +GD IKIGR
Sbjct: 126 HGNIKGSISFLITGDEEGPAVNGTVKLLEWAKQRGESWDASIVGEPTNPNALGDMIKIGR 185

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSLSG IT+HG QGH AYPHL ENP+RG++ L+  L    FD G   F  +N+E+TTID
Sbjct: 186 RGSLSGTITVHGVQGHAAYPHLAENPVRGIVTLVDSLLCPAFDEGTANFQASNLEVTTID 245

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVP-------KLSHTVH 295
           VGN + NVIP +   SFNIRFND W  ++L+ EI SRL +  ++          + + + 
Sbjct: 246 VGNKATNVIPNKATASFNIRFNDTWTAESLQAEIISRLERAARDNRLRQGRETPIKYELT 305

Query: 296 FSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGR 355
           +    S VFLTHD KL   L+ S+   TG  P LSTSGGTSDARFIKDYCPV+EFGL G+
Sbjct: 306 WRERPSHVFLTHDEKLIGTLTASVEAVTGKRPELSTSGGTSDARFIKDYCPVVEFGLTGQ 365

Query: 356 TMHALNENASLQDLEDLTCIYENFLQNWF 384
           TMH ++E  +L DLE LT IYE F+ ++F
Sbjct: 366 TMHMVDERVALADLEGLTQIYERFIADFF 394


>gi|301155929|emb|CBW15399.1| N-succinyl-diaminopimelate deacylase [Haemophilus parainfluenzae
           T3T1]
          Length = 377

 Score =  262 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 156/386 (40%), Positives = 217/386 (56%), Gaps = 13/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +E    LI+ PS++P D G   ++   L+ LGF IE   F     +   NL+A+ 
Sbjct: 1   MKQKTIELAQALIRRPSISPNDEGCQQLIAERLEKLGFQIEWMPF-----NDTLNLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G+  P + FAGH DVVP GD   WTYPPFSA I +  +YGRG  DMKGS+A  I A   +
Sbjct: 56  GSGEPVIAFAGHTDVVPTGDETQWTYPPFSADIVDDMLYGRGTADMKGSLAAMIVAAEEY 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G+I+LLIT DEE  A +GT +++  +  +GEK   C+VGEP+ +  +GD +K
Sbjct: 116 VKANPNHKGTIALLITSDEEAAAKDGTVRVVETLMARGEKITYCMVGEPSSSKTLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++G + I G QGHVAYPHL ENPI    P L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITGNLYIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDNGNEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN+R+     ++ +K+++   L K         + + ++  
Sbjct: 236 NIHAGTGSNNVIPGELYVQFNLRYCTEVTDEIIKQKVAEMLEKHGLK-----YRIDWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P FLT   KL   L+ +I  TTG  P   T GGTSD RFI      V+EFG +  T+H
Sbjct: 291 GKP-FLTKPGKLLDALTTAIEQTTGVTPQAETGGGTSDGRFIALMGAEVVEFGPLNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            +NE  ++ DL     IY   L N  
Sbjct: 350 KVNECVNVDDLAKCGQIYHQMLVNLL 375


>gi|225686785|ref|YP_002734757.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis ATCC
           23457]
 gi|254690655|ref|ZP_05153909.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 6 str.
           870]
 gi|256043898|ref|ZP_05446818.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256111037|ref|ZP_05452099.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis bv. 3
           str. Ether]
 gi|256255837|ref|ZP_05461373.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 9 str.
           C68]
 gi|256262081|ref|ZP_05464613.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis bv. 2
           str. 63/9]
 gi|260756226|ref|ZP_05868574.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 6 str.
           870]
 gi|260882050|ref|ZP_05893664.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 9 str.
           C68]
 gi|265990321|ref|ZP_06102878.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis bv. 1
           str. Rev.1]
 gi|265992572|ref|ZP_06105129.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis bv. 3
           str. Ether]
 gi|297249206|ref|ZP_06932907.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 5 str.
           B3196]
 gi|254767082|sp|C0RMH0|DAPE_BRUMB RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|225642890|gb|ACO02803.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis ATCC
           23457]
 gi|260676334|gb|EEX63155.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 6 str.
           870]
 gi|260871578|gb|EEX78647.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 9 str.
           C68]
 gi|262763442|gb|EEZ09474.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis bv. 3
           str. Ether]
 gi|263000990|gb|EEZ13680.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis bv. 1
           str. Rev.1]
 gi|263091770|gb|EEZ16101.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis bv. 2
           str. 63/9]
 gi|297173075|gb|EFH32439.1| succinyl-diaminopimelate desuccinylase [Brucella abortus bv. 5 str.
           B3196]
 gi|326411193|gb|ADZ68257.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis M28]
 gi|326554484|gb|ADZ89123.1| succinyl-diaminopimelate desuccinylase [Brucella melitensis M5-90]
          Length = 395

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 218/389 (56%), Positives = 270/389 (69%), Gaps = 8/389 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           + +++L  LI+CPSVTP +GGA   L   LKL+GFS     F   NT  ++NLYAR    
Sbjct: 6   NPVDNLAALIRCPSVTPAEGGALTALEKMLKLMGFSANRPVFSDDNTPDIENLYARKSGN 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVPPGD   W +PPF+A I +G +YGRG VDMKG IACF+AAVAR I K
Sbjct: 66  GPHLMFAGHTDVVPPGDEKDWKHPPFAAAIEDGVMYGRGAVDMKGGIACFVAAVARHIEK 125

Query: 124 YKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
           + N  GSIS LITGDEEGPA+NGT K+L W +++GE WDA IVGEPT  + +GD IKIGR
Sbjct: 126 HGNIKGSISFLITGDEEGPAVNGTVKLLEWAKQRGESWDASIVGEPTNPNALGDMIKIGR 185

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSLSG IT+HG QGH AYPHL ENP+RG++ L+  L    FD G   F  +N+E+TTID
Sbjct: 186 RGSLSGTITVHGVQGHAAYPHLAENPVRGIVTLVDSLLYPAFDEGTANFQASNLEVTTID 245

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVP-------KLSHTVH 295
           VGN + NVIP +   SFNIRFND W  ++L+ EI SRL +  ++          + + + 
Sbjct: 246 VGNKATNVIPNKATASFNIRFNDTWTAESLQAEIISRLERAARDNRLRQGRETPIKYELT 305

Query: 296 FSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGR 355
           +    S VFLTHD KL   L+ S+   TG  P LSTSGGTSDARFIKDYCPV+EFGL G+
Sbjct: 306 WRERPSHVFLTHDEKLIGTLTASVEAVTGKRPELSTSGGTSDARFIKDYCPVVEFGLTGQ 365

Query: 356 TMHALNENASLQDLEDLTCIYENFLQNWF 384
           TMH ++E  +L DLE LT IYE F+ ++F
Sbjct: 366 TMHMVDERVALADLEGLTQIYERFIADFF 394


>gi|306840406|ref|ZP_07473170.1| succinyl-diaminopimelate desuccinylase [Brucella sp. BO2]
 gi|306289619|gb|EFM60826.1| succinyl-diaminopimelate desuccinylase [Brucella sp. BO2]
          Length = 395

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 217/386 (56%), Positives = 267/386 (69%), Gaps = 8/386 (2%)

Query: 7   EHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPH 66
           ++L  LI+CPSVTP +GGA   L   LK +GFS +   F   NT  ++NLYAR     PH
Sbjct: 9   DNLAALIRCPSVTPAEGGALTALEKMLKPMGFSADRPVFSDDNTPDIENLYARKSGNGPH 68

Query: 67  LMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKN 126
           LMFAGH DVVPPGD   W +PPF+A I  G +YGRG VDMKG IACF+AAVAR I K+ N
Sbjct: 69  LMFAGHTDVVPPGDEKDWKHPPFAAAIENGVMYGRGAVDMKGGIACFVAAVARHIEKHGN 128

Query: 127 F-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGS 185
             GSIS LITGDEEGPA+NGT K+L W +++GE WDA IVGEPT  + +GD IKIGRRGS
Sbjct: 129 IKGSISFLITGDEEGPAVNGTVKLLEWAKRRGESWDASIVGEPTNPNALGDMIKIGRRGS 188

Query: 186 LSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGN 245
           LSG IT+HG QGH AYPHL ENP+RG++ L+  L    FD G   F  +N+E+TTIDVGN
Sbjct: 189 LSGTITVHGVQGHAAYPHLAENPVRGIVTLVDSLLYPAFDEGTANFQASNLEVTTIDVGN 248

Query: 246 PSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVP-------KLSHTVHFSS 298
            + NVIP +   SFNIRFND W  ++L+ EI SRL +  ++          + + + +  
Sbjct: 249 KATNVIPNKATASFNIRFNDTWTAESLQAEIISRLERAARDNRLRQGRETPIKYELTWRE 308

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
             S VFLTHD KL   L+ S+   TG  P LSTSGGTSDARFIKDYCPV+EFGL G+TMH
Sbjct: 309 RPSHVFLTHDEKLIGTLTASVEAVTGKRPELSTSGGTSDARFIKDYCPVVEFGLTGQTMH 368

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E  +L DLE LT IYE F+ ++F
Sbjct: 369 MVDERVALADLEGLTQIYERFIADFF 394


>gi|165977318|ref|YP_001652911.1| succinyl-diaminopimelate desuccinylase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|238055198|sp|B0BTF3|DAPE_ACTPJ RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|165877419|gb|ABY70467.1| succinyl-diaminopimelate desuccinylase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
          Length = 377

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 146/388 (37%), Positives = 216/388 (55%), Gaps = 13/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  + +     LI+ PS++P D G   ++   L  LGF++E   F         NL+A+ 
Sbjct: 1   MKNNIINLAQDLIRRPSISPADQGCQQVIAERLAQLGFTLEWLPFGD-----TLNLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G+ +P + FAGH DVVP GD   WTYPPF A I +  +YGRG  DMKGS++  + A   F
Sbjct: 56  GSGSPVVAFAGHTDVVPVGDETQWTYPPFEARIVDNMLYGRGAADMKGSLSALVVAAEEF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G+++LLIT DEE  A +GT K++  +  +GE    C+VGEP+   ++GD IK
Sbjct: 116 VKANPNHTGTVALLITSDEEAAAKDGTVKVVETLMARGEPIHYCVVGEPSSGKVLGDVIK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++GE+ I G QGHVAYPHL ENP+   +  L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITGELYIEGVQGHVAYPHLAENPVHTSLNFLTELTTYQWDNGNEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN+R+     ++ +K ++   L K         H + ++  
Sbjct: 236 NIKAGTGSNNVIPGELYVQFNLRYCTEVTDEIIKNKVAEMLAKHQLK-----HRISWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P    +  +L     +++ N T   P L TSGGTSD RFI      V+EFG +  T+H
Sbjct: 291 GQPFLAGN-GELVKATVQAVENVTKITPRLDTSGGTSDGRFIALMGAEVVEFGPLNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFIT 386
            +NE  S++DL     +Y + L+    +
Sbjct: 350 KVNECVSVEDLGKCGEVYYHILERLLKS 377


>gi|306846232|ref|ZP_07478794.1| succinyl-diaminopimelate desuccinylase [Brucella sp. BO1]
 gi|306273483|gb|EFM55344.1| succinyl-diaminopimelate desuccinylase [Brucella sp. BO1]
          Length = 395

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 217/386 (56%), Positives = 268/386 (69%), Gaps = 8/386 (2%)

Query: 7   EHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPH 66
           ++L  LI+CPSVTP +GGA   L   LK +GFS +   F   NT  ++NLYAR     PH
Sbjct: 9   DNLAALIRCPSVTPAEGGALTALEKMLKPMGFSADRPVFSDDNTPDIENLYARKSGNGPH 68

Query: 67  LMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKN 126
           LMFAGH DVVPPGD   W +PPF+A I +G +YGRG VDMKG IACF+AAVAR I K+ N
Sbjct: 69  LMFAGHTDVVPPGDEKDWKHPPFAAAIEDGVMYGRGAVDMKGGIACFVAAVARHIEKHGN 128

Query: 127 F-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGS 185
             GSIS LITGDEEGPA+NGT K+L W +++GE WDA IVGEPT  + +GD IKIGRRGS
Sbjct: 129 IKGSISFLITGDEEGPAVNGTVKLLEWAKQRGESWDASIVGEPTNPNALGDMIKIGRRGS 188

Query: 186 LSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGN 245
           LSG IT+HG QGH AYPHL ENP+RG++ L+  L    FD G   F  +N+E+TTIDVGN
Sbjct: 189 LSGTITVHGVQGHAAYPHLAENPVRGIVTLVDSLLYPAFDEGTANFQASNLEVTTIDVGN 248

Query: 246 PSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVP-------KLSHTVHFSS 298
            + NVIP +   SFNIRFND W  ++L+ EI SRL +  ++          + + + +  
Sbjct: 249 KATNVIPNKATASFNIRFNDTWTAESLQAEIISRLERAARDNRLRQGRETPIKYELTWRE 308

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
             S VFLTHD KL   L+ S+   TG  P LSTSGGTSDARFIKDYCPV+EFGL G+TMH
Sbjct: 309 RPSHVFLTHDEKLIGTLTASVEAVTGKRPELSTSGGTSDARFIKDYCPVVEFGLTGQTMH 368

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E  +L DLE LT IYE F+ ++F
Sbjct: 369 MVDERVALADLEGLTQIYERFIADFF 394


>gi|254720142|ref|ZP_05181953.1| succinyl-diaminopimelate desuccinylase [Brucella sp. 83/13]
 gi|265985148|ref|ZP_06097883.1| succinyl-diaminopimelate desuccinylase [Brucella sp. 83/13]
 gi|306839552|ref|ZP_07472359.1| succinyl-diaminopimelate desuccinylase [Brucella sp. NF 2653]
 gi|264663740|gb|EEZ34001.1| succinyl-diaminopimelate desuccinylase [Brucella sp. 83/13]
 gi|306405384|gb|EFM61656.1| succinyl-diaminopimelate desuccinylase [Brucella sp. NF 2653]
          Length = 395

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 217/386 (56%), Positives = 268/386 (69%), Gaps = 8/386 (2%)

Query: 7   EHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPH 66
           ++L  LI+CPSVTP +GGA   L   LK +GFS +   F   NT  ++NLYAR     PH
Sbjct: 9   DNLAALIRCPSVTPAEGGALTALEKMLKPMGFSADRPVFSDDNTPDIENLYARKSGNGPH 68

Query: 67  LMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKN 126
           LMFAGH DVVPPGD   W +PPF+A I +G +YGRG VDMKG IACF+AAVAR I K+ N
Sbjct: 69  LMFAGHTDVVPPGDEKDWKHPPFAAAIEDGVMYGRGAVDMKGGIACFVAAVARHIEKHGN 128

Query: 127 F-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGS 185
             GSIS LITGDEEGPA+NGT K+L W +++GE WDA IVGEPT  + +GD IKIGRRGS
Sbjct: 129 IKGSISFLITGDEEGPAVNGTVKLLEWAKQRGESWDASIVGEPTNPNALGDMIKIGRRGS 188

Query: 186 LSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGN 245
           LSG IT+HG QGH AYPHL ENP+RG++ L+  L    FD G   F  +N+E+TTIDVGN
Sbjct: 189 LSGTITVHGVQGHAAYPHLAENPVRGIVTLVDSLLYPAFDEGTANFQASNLEVTTIDVGN 248

Query: 246 PSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVP-------KLSHTVHFSS 298
            + NVIP +   SFNIRFND W  ++L+ EI SRL +  ++          + + + +  
Sbjct: 249 KATNVIPNKATASFNIRFNDTWTAESLQAEIISRLERAARDNRLRQGRETPIKYELTWRE 308

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
             S VFLTHD KL   L+ S+   TG  P LSTSGGTSDARFIKDYCPV+EFGL G+TMH
Sbjct: 309 QPSHVFLTHDEKLIGTLTASVEAVTGKRPELSTSGGTSDARFIKDYCPVVEFGLTGQTMH 368

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E  +L DLE LT IYE F+ ++F
Sbjct: 369 MVDERVALADLEGLTQIYERFIADFF 394


>gi|238064823|sp|Q2RNM1|DAPE_RHORT RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 392

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 187/393 (47%), Positives = 239/393 (60%), Gaps = 13/393 (3%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D L     L+ CPSVTP+D GA  +L + L  LGF      F  +    V NLYAR G  
Sbjct: 3   DPLALARALVACPSVTPRDAGALDVLESALIALGFRCVRLPFGAEGGERVDNLYARRGGA 62

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR---- 119
            P   FAGH DVVP GD   W+ PPF A + +G + GRG  DMKG IACF+AAVAR    
Sbjct: 63  GPCFGFAGHTDVVPAGD--GWSRPPFGAEVVDGALVGRGAADMKGGIACFVAAVARLISG 120

Query: 120 -----FIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHII 174
                 I ++   GSI+LLITGDEEGPA++GT+K+L W+E  GE+ D C+VGEPT    +
Sbjct: 121 PDSTGSISRHDPTGSIALLITGDEEGPALHGTRKVLEWMEGAGERMDLCLVGEPTNPEGL 180

Query: 175 GDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPT 234
           GD IKIGRRGSL+  +T+ G+ GHVAYPHL +NP+  L  L   L     D G   F P+
Sbjct: 181 GDMIKIGRRGSLTATVTLLGRAGHVAYPHLADNPLHRLSTLTGLLLAETLDDGTAHFQPS 240

Query: 235 NMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTV 294
           ++++T+IDVGNP+ NVIPA+  + FNIRFND  + ++L   IR+R +            V
Sbjct: 241 SLQLTSIDVGNPAANVIPAKATLRFNIRFNDRHSGESLSAWIRARCLAACDGDESGFSLV 300

Query: 295 HFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVG 354
              S     FLT    L+ L++ +    TG  P LSTSGGTSDARFI+ +CPV EFGLVG
Sbjct: 301 LEHSG--DAFLTPPGPLSDLIATACQAVTGRRPELSTSGGTSDARFIRSHCPVAEFGLVG 358

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNWFITP 387
           RTMH  +E  ++ DLE L+ IY   L  +F  P
Sbjct: 359 RTMHKPDERVAVADLEALSEIYRRVLVGFFEAP 391


>gi|83594809|ref|YP_428561.1| succinyl-diaminopimelate desuccinylase [Rhodospirillum rubrum ATCC
           11170]
 gi|83577723|gb|ABC24274.1| succinyldiaminopimelate desuccinylase [Rhodospirillum rubrum ATCC
           11170]
          Length = 404

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 187/393 (47%), Positives = 239/393 (60%), Gaps = 13/393 (3%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D L     L+ CPSVTP+D GA  +L + L  LGF      F  +    V NLYAR G  
Sbjct: 15  DPLALARALVACPSVTPRDAGALDVLESALIALGFRCVRLPFGAEGGERVDNLYARRGGA 74

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR---- 119
            P   FAGH DVVP GD   W+ PPF A + +G + GRG  DMKG IACF+AAVAR    
Sbjct: 75  GPCFGFAGHTDVVPAGD--GWSRPPFGAEVVDGALVGRGAADMKGGIACFVAAVARLISG 132

Query: 120 -----FIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHII 174
                 I ++   GSI+LLITGDEEGPA++GT+K+L W+E  GE+ D C+VGEPT    +
Sbjct: 133 PDSTGSISRHDPTGSIALLITGDEEGPALHGTRKVLEWMEGAGERMDLCLVGEPTNPEGL 192

Query: 175 GDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPT 234
           GD IKIGRRGSL+  +T+ G+ GHVAYPHL +NP+  L  L   L     D G   F P+
Sbjct: 193 GDMIKIGRRGSLTATVTLLGRAGHVAYPHLADNPLHRLSTLTGLLLAETLDDGTAHFQPS 252

Query: 235 NMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTV 294
           ++++T+IDVGNP+ NVIPA+  + FNIRFND  + ++L   IR+R +            V
Sbjct: 253 SLQLTSIDVGNPAANVIPAKATLRFNIRFNDRHSGESLSAWIRARCLAACDGDESGFSLV 312

Query: 295 HFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVG 354
              S     FLT    L+ L++ +    TG  P LSTSGGTSDARFI+ +CPV EFGLVG
Sbjct: 313 LEHSG--DAFLTPPGPLSDLIATACQAVTGRRPELSTSGGTSDARFIRSHCPVAEFGLVG 370

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNWFITP 387
           RTMH  +E  ++ DLE L+ IY   L  +F  P
Sbjct: 371 RTMHKPDERVAVADLEALSEIYRRVLVGFFEAP 403


>gi|222084713|ref|YP_002543242.1| succinyl-diaminopimelate desuccinylase protein [Agrobacterium
           radiobacter K84]
 gi|238055202|sp|B9J8D0|DAPE_AGRRK RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|221722161|gb|ACM25317.1| succinyl-diaminopimelate desuccinylase protein [Agrobacterium
           radiobacter K84]
          Length = 397

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 216/393 (54%), Positives = 269/393 (68%), Gaps = 8/393 (2%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT  D + +L  LI+C SVTP +GGA   L + L  LGF +E        T  ++NLYAR
Sbjct: 1   MTATDPVANLQTLIRCASVTPAEGGALTALADMLLPLGFKVERMTASEAGTPDIENLYAR 60

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GTE PHLMFAGH DVVP GD   W++PPF+A IA G+++GRG VDMKG IACF AAVAR
Sbjct: 61  LGTEGPHLMFAGHTDVVPVGDAASWSHPPFAADIAGGELFGRGAVDMKGGIACFAAAVAR 120

Query: 120 FIPKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
            I K+    GSIS LITGDEEGPAINGT K+L W  ++GE+WDA +VGEPT    +GD I
Sbjct: 121 HIEKHGPPAGSISFLITGDEEGPAINGTVKLLQWAAERGEQWDASLVGEPTNPDQLGDMI 180

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGS+SG IT+HG QGH AYPHL +NP+R ++ L   L +  FD G   F P+N+E+
Sbjct: 181 KIGRRGSISGFITVHGVQGHAAYPHLADNPVRSIVKLTEALLDPPFDAGTDNFQPSNLEV 240

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKG------IQNVPKLSH 292
           TTIDVGN + NVIPA+   +FNIRFND W  +TL+ EI +RL                 +
Sbjct: 241 TTIDVGNAATNVIPAKATAAFNIRFNDTWTVETLRAEILARLDAAAADQTLRPGREPTKY 300

Query: 293 TVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGL 352
            + +S   S VFLT +  L + LS ++ N TG+ P LST+GGTSDARFIKDYCPV+EFGL
Sbjct: 301 DITWSDRPSQVFLTRNNALIASLSSAVENVTGHTPKLSTTGGTSDARFIKDYCPVVEFGL 360

Query: 353 VGRTMHALNENASLQDLEDLTCIYENFLQNWFI 385
           VG+TMH ++E  ++ DLE LT IYE F+Q WF 
Sbjct: 361 VGQTMHMVDERVAVADLETLTEIYETFIQRWFA 393


>gi|154250722|ref|YP_001411546.1| succinyl-diaminopimelate desuccinylase [Parvibaculum
           lavamentivorans DS-1]
 gi|238064767|sp|A7HPQ6|DAPE_PARL1 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|154154672|gb|ABS61889.1| succinyl-diaminopimelate desuccinylase [Parvibaculum
           lavamentivorans DS-1]
          Length = 395

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 175/385 (45%), Positives = 237/385 (61%), Gaps = 3/385 (0%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D L+  ++LI+CPSVTP +GGA  +L   L  LGF  E   F  + T  V NLYAR G+ 
Sbjct: 13  DPLDIAVELIRCPSVTPDEGGALGVLEKWLAPLGFKCERMRFSAEGTPDVDNLYARLGSG 72

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PH  FAGH DVVP G  + W+  PF+A I +G++YGRG  DMK ++A F+AA  R I +
Sbjct: 73  HPHFCFAGHTDVVPVGQADAWSVDPFAADIKDGRLYGRGAADMKSAVASFVAAAER-ISR 131

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               GSISLLITGDEEGP+INGT+KML  +  + E  D CIVGEPT    +GD IK+GRR
Sbjct: 132 EGFQGSISLLITGDEEGPSINGTRKMLEKLAARNETIDHCIVGEPTSVEKLGDMIKVGRR 191

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++G +T+ G QGHVAYPHL +NP+  L+ +L +L     D G   F P+N+E+TT+D+
Sbjct: 192 GSINGWLTVQGTQGHVAYPHLADNPVPRLLEMLRRLDAHVLDEGTDHFQPSNLEVTTVDI 251

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GN + NVIP   + + NIRFNDL    +L + +R  L      +          S     
Sbjct: 252 GNTATNVIPGSARATVNIRFNDLHTGASLDKWMRGVLDAVTAEMGGSYSFKTSVSG--EA 309

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           F+T     ++L++++    TG  P LST+GGTSDARFI+ Y PV+E GL   TMH  +EN
Sbjct: 310 FITEPGAFSALIAEAAKEVTGITPELSTTGGTSDARFIRAYAPVVEIGLPNATMHKADEN 369

Query: 364 ASLQDLEDLTCIYENFLQNWFITPS 388
             + ++  L  IYE  L+ +F   +
Sbjct: 370 TGVSEIRQLADIYETVLRGYFAGRA 394


>gi|114321019|ref|YP_742702.1| succinyl-diaminopimelate desuccinylase [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|122311387|sp|Q0A7H5|DAPE_ALHEH RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|114227413|gb|ABI57212.1| succinyldiaminopimelate desuccinylase [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 375

 Score =  260 bits (663), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 152/384 (39%), Positives = 226/384 (58%), Gaps = 13/384 (3%)

Query: 3   PDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT 62
            + LE    LI   SVTP D G   +L   L+ LGF  E  D+       V NL+AR G 
Sbjct: 2   SETLELASALIARRSVTPMDAGCQQLLAERLRPLGFDCERLDYGE-----VNNLWARRGQ 56

Query: 63  EAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI- 121
           + P   FAGH DVVPPG    W +PPF   + +G +YGRG  DMKGS+A F+ A+ R++ 
Sbjct: 57  QGPVFCFAGHTDVVPPGPEAQWRHPPFQPVVEQGLLYGRGAADMKGSVAAFVTALERYLA 116

Query: 122 PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
             ++  GS++LLIT DEEGPA++GT+ ++  + ++GE+ D C+VGEP+    +GD +K+G
Sbjct: 117 GGHRPRGSLALLITSDEEGPAVDGTRHVVETLSERGERIDWCLVGEPSSTERVGDVVKVG 176

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSL+G +T+ G QGHVAYPHL  NP+   +  L +L    +D GN  F PT+ +I+ +
Sbjct: 177 RRGSLNGRLTVRGDQGHVAYPHLARNPVHQALAALDELVTTRWDEGNDHFPPTSFQISNV 236

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
             G  + NVIP +++++FN RF+       L++ + + L +   +       + +S    
Sbjct: 237 QAGTGATNVIPGELEVTFNFRFSTEVTADELQQRVEAVLDRHGLDGR-----IDWSLSGE 291

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHAL 360
           P FLT + +L +    ++ +  G+ P+LSTSGGTSD RFI      V+E G V  T+H +
Sbjct: 292 P-FLTAEGELVAATQAAVRDVCGDPPVLSTSGGTSDGRFIAPTGAQVLELGPVNATIHKV 350

Query: 361 NENASLQDLEDLTCIYENFLQNWF 384
           NE+    DL+ L+ IYE  L+   
Sbjct: 351 NEHVRAADLDTLSRIYEGVLRRLL 374


>gi|126738609|ref|ZP_01754314.1| succinyl-diaminopimelate desuccinylase [Roseobacter sp. SK209-2-6]
 gi|126720408|gb|EBA17114.1| succinyl-diaminopimelate desuccinylase [Roseobacter sp. SK209-2-6]
          Length = 381

 Score =  260 bits (663), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 160/386 (41%), Positives = 226/386 (58%), Gaps = 15/386 (3%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D ++    LI+CPSVTP++GGA  +L N L   GF+    D        + NL+AR+G +
Sbjct: 5   DPIQLTADLIRCPSVTPEEGGALVLLENLLSEAGFACTRVD-----RGGICNLFARWGNK 59

Query: 64  A--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
                  F GH DVVP GD + W+ PPF A + +G +YGRG  DMK  +A F+AA   F 
Sbjct: 60  GHPRSFGFNGHTDVVPLGDESAWSMPPFGAEVKDGIMYGRGATDMKSGVAAFVAAAIDFT 119

Query: 122 PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
                 GS+ L ITGDEE  A++GT  +L +I +  E+ D C+VGEPTC + +G+ IKIG
Sbjct: 120 RNTPPDGSVILTITGDEEADALDGTTALLDYISEAKEQMDVCLVGEPTCPNEMGEMIKIG 179

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGS++   T+ GKQGH AYPH   NP+  +  L+ +L +   D G   F  + + + TI
Sbjct: 180 RRGSMTAWFTVTGKQGHSAYPHRANNPLNAMARLMDRLASHELDKGTEHFDASTLAVVTI 239

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIR---SRLIKGIQNVPKLSHTVHFSS 298
           D GNP+ NVIPAQ   + NIRFND      L E ++    R+         +   +   S
Sbjct: 240 DTGNPATNVIPAQCTSTVNIRFNDAHTGAGLTEWLQSEAERIQDEFGASVAMKIKISGES 299

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
                F+T    L+ L++ ++   TG  P LST+GGTSDARF+K +CPV+EFGLVG+TMH
Sbjct: 300 -----FITPPGTLSDLVANAVEAETGRRPELSTTGGTSDARFVKHHCPVVEFGLVGKTMH 354

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++EN  ++ +E L  IY   L+++F
Sbjct: 355 QVDENVPVEQIEQLKAIYTRILKDYF 380


>gi|89095175|ref|ZP_01168099.1| succinyl-diaminopimelate desuccinylase [Oceanospirillum sp. MED92]
 gi|89080533|gb|EAR59781.1| succinyl-diaminopimelate desuccinylase [Oceanospirillum sp. MED92]
          Length = 381

 Score =  259 bits (662), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 160/383 (41%), Positives = 217/383 (56%), Gaps = 13/383 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            +E    LI   SVTP+D G   +++  L+ +GF IE   F+      VKN +AR G   
Sbjct: 8   TIELAKDLISRRSVTPEDAGCQDLMIERLEAMGFKIERLQFED-----VKNFWARRGDSG 62

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P   FAGH DVVPPG    W +PPF ATI +G + GRG  DMKG +A F+ A+ RFI  +
Sbjct: 63  PVFCFAGHTDVVPPGPEERWEFPPFEATIDQGMLCGRGAADMKGGLAAFMTALERFIANH 122

Query: 125 K-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
             + GSI+LLIT DEEGP +NGT +++  +E + EK   CIVGEP+    +GD IK GRR
Sbjct: 123 PDHDGSIALLITSDEEGPWVNGTTRVVDHLEARDEKITWCIVGEPSSTKHVGDAIKNGRR 182

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL   +T+ G QGHVAYPHL +NPI    P L +L    +D GN  F PT+ +I+ I+ 
Sbjct: 183 GSLGATLTVRGIQGHVAYPHLVKNPIHMAAPALAELAAEVWDEGNDFFPPTSFQISNING 242

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G    N++P  V + FN RF+       LK  +R  L K   +       + ++   +P 
Sbjct: 243 GTGVTNIVPGHVDIMFNFRFSTEVTADELKTRVRDILNKHNLD-----WDIDWTLSGNP- 296

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
           FLT +  L     ++I   TG    LSTSGGTSD RFI      V+E G +  T+H +NE
Sbjct: 297 FLTAEGDLVDACQQAIKAITGQDTELSTSGGTSDGRFIAPTGAQVVELGPINATIHKVNE 356

Query: 363 NASLQDLEDLTCIYENFLQNWFI 385
             S QDL+ L+ +YEN +    +
Sbjct: 357 RVSCQDLDTLSDLYENVMARLLV 379


>gi|150395289|ref|YP_001325756.1| succinyl-diaminopimelate desuccinylase [Sinorhizobium medicae
           WSM419]
 gi|150026804|gb|ABR58921.1| succinyl-diaminopimelate desuccinylase [Sinorhizobium medicae
           WSM419]
          Length = 426

 Score =  259 bits (662), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 214/388 (55%), Positives = 266/388 (68%), Gaps = 7/388 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D + +L  LI+CPSVTP +GGA   L + L  +GF  +    +   T  ++NLYAR G  
Sbjct: 34  DPVSNLATLIRCPSVTPAEGGALTALESMLTPIGFKADRIVAREAGTPDIENLYARIGVG 93

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVP GD   W++PPFSA IAEG++YGRG VDMKG IACF+AAVAR I K
Sbjct: 94  GPHLMFAGHTDVVPVGDEIAWSHPPFSAAIAEGEMYGRGAVDMKGGIACFVAAVARHIEK 153

Query: 124 YK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
           +    GSIS LITGDEEGPAINGT K+L W   KGE+WDAC+VGEPT    IG+ IKIGR
Sbjct: 154 HGAPKGSISFLITGDEEGPAINGTVKLLEWAAAKGERWDACLVGEPTNPGGIGEMIKIGR 213

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSLSG IT+ G QGH AYPHL +NP+R ++ L H L +  FD G   F P+N+E+TTID
Sbjct: 214 RGSLSGRITVQGVQGHAAYPHLADNPVRSILQLAHALMDPPFDDGTENFQPSNLEVTTID 273

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKG------IQNVPKLSHTVHF 296
           VGN + NVIPA+   +FN+RFNDLW  ++L  EI +RL +             + + + +
Sbjct: 274 VGNAAVNVIPAKASAAFNVRFNDLWTAESLMTEIVARLDRAASAGALRPGRAPVKYEIVW 333

Query: 297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRT 356
           +   S VFLT +  L   LS ++   TG  P LST+GGTSDARFIKDYCPV+EFGLVG+T
Sbjct: 334 NERPSHVFLTRNDALIESLSGAVEAVTGQQPRLSTTGGTSDARFIKDYCPVVEFGLVGKT 393

Query: 357 MHALNENASLQDLEDLTCIYENFLQNWF 384
           MH ++E  +L DLE LT IYE F+  WF
Sbjct: 394 MHMVDERVALADLETLTGIYETFIARWF 421


>gi|23500754|ref|NP_700194.1| succinyl-diaminopimelate desuccinylase [Brucella suis 1330]
 gi|148558511|ref|YP_001257942.1| succinyl-diaminopimelate desuccinylase [Brucella ovis ATCC 25840]
 gi|161621078|ref|YP_001594964.1| succinyl-diaminopimelate desuccinylase [Brucella canis ATCC 23365]
 gi|163845144|ref|YP_001622799.1| succinyl-diaminopimelate desuccinylase [Brucella suis ATCC 23445]
 gi|225629480|ref|ZP_03787513.1| succinyl-diaminopimelate desuccinylase [Brucella ceti str. Cudo]
 gi|254700225|ref|ZP_05162053.1| succinyl-diaminopimelate desuccinylase [Brucella suis bv. 5 str.
           513]
 gi|254703346|ref|ZP_05165174.1| succinyl-diaminopimelate desuccinylase [Brucella suis bv. 3 str.
           686]
 gi|254705513|ref|ZP_05167341.1| succinyl-diaminopimelate desuccinylase [Brucella pinnipedialis
           M163/99/10]
 gi|254710744|ref|ZP_05172555.1| succinyl-diaminopimelate desuccinylase [Brucella pinnipedialis
           B2/94]
 gi|254712786|ref|ZP_05174597.1| succinyl-diaminopimelate desuccinylase [Brucella ceti M644/93/1]
 gi|254715855|ref|ZP_05177666.1| succinyl-diaminopimelate desuccinylase [Brucella ceti M13/05/1]
 gi|256015790|ref|YP_003105799.1| succinyl-diaminopimelate desuccinylase [Brucella microti CCM 4915]
 gi|256029127|ref|ZP_05442741.1| succinyl-diaminopimelate desuccinylase [Brucella pinnipedialis
           M292/94/1]
 gi|256058810|ref|ZP_05449026.1| succinyl-diaminopimelate desuccinylase [Brucella neotomae 5K33]
 gi|256157319|ref|ZP_05455237.1| succinyl-diaminopimelate desuccinylase [Brucella ceti M490/95/1]
 gi|256253703|ref|ZP_05459239.1| succinyl-diaminopimelate desuccinylase [Brucella ceti B1/94]
 gi|260167781|ref|ZP_05754592.1| succinyl-diaminopimelate desuccinylase [Brucella sp. F5/99]
 gi|260567724|ref|ZP_05838193.1| succinyl-diaminopimelate desuccinylase [Brucella suis bv. 4 str.
           40]
 gi|261217616|ref|ZP_05931897.1| succinyl-diaminopimelate desuccinylase [Brucella ceti M13/05/1]
 gi|261220840|ref|ZP_05935121.1| succinyl-diaminopimelate desuccinylase [Brucella ceti B1/94]
 gi|261312917|ref|ZP_05952114.1| succinyl-diaminopimelate desuccinylase [Brucella pinnipedialis
           M163/99/10]
 gi|261318312|ref|ZP_05957509.1| succinyl-diaminopimelate desuccinylase [Brucella pinnipedialis
           B2/94]
 gi|261320493|ref|ZP_05959690.1| succinyl-diaminopimelate desuccinylase [Brucella ceti M644/93/1]
 gi|261322747|ref|ZP_05961944.1| succinyl-diaminopimelate desuccinylase [Brucella neotomae 5K33]
 gi|261750720|ref|ZP_05994429.1| succinyl-diaminopimelate desuccinylase [Brucella suis bv. 5 str.
           513]
 gi|261753976|ref|ZP_05997685.1| succinyl-diaminopimelate desuccinylase [Brucella suis bv. 3 str.
           686]
 gi|261757218|ref|ZP_06000927.1| succinyl-diaminopimelate desuccinylase [Brucella sp. F5/99]
 gi|265986110|ref|ZP_06098667.1| succinyl-diaminopimelate desuccinylase [Brucella pinnipedialis
           M292/94/1]
 gi|265995804|ref|ZP_06108361.1| succinyl-diaminopimelate desuccinylase [Brucella ceti M490/95/1]
 gi|294853984|ref|ZP_06794656.1| succinyl-diaminopimelate desuccinylase [Brucella sp. NVSL 07-0026]
 gi|81750979|sp|Q8FV22|DAPE_BRUSU RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238055177|sp|A9MCV6|DAPE_BRUC2 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238055178|sp|A5VVT7|DAPE_BRUO2 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238055179|sp|A9WW41|DAPE_BRUSI RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|23464409|gb|AAN34199.1| succinyl-diaminopimelate desuccinylase [Brucella suis 1330]
 gi|148369796|gb|ABQ62668.1| succinyl-diaminopimelate desuccinylase [Brucella ovis ATCC 25840]
 gi|161337889|gb|ABX64193.1| succinyl-diaminopimelate desuccinylase [Brucella canis ATCC 23365]
 gi|163675867|gb|ABY39977.1| succinyl-diaminopimelate desuccinylase [Brucella suis ATCC 23445]
 gi|225615976|gb|EEH13025.1| succinyl-diaminopimelate desuccinylase [Brucella ceti str. Cudo]
 gi|255998450|gb|ACU50137.1| succinyl-diaminopimelate desuccinylase [Brucella microti CCM 4915]
 gi|260154389|gb|EEW89470.1| succinyl-diaminopimelate desuccinylase [Brucella suis bv. 4 str.
           40]
 gi|260919424|gb|EEX86077.1| succinyl-diaminopimelate desuccinylase [Brucella ceti B1/94]
 gi|260922705|gb|EEX89273.1| succinyl-diaminopimelate desuccinylase [Brucella ceti M13/05/1]
 gi|261293183|gb|EEX96679.1| succinyl-diaminopimelate desuccinylase [Brucella ceti M644/93/1]
 gi|261297535|gb|EEY01032.1| succinyl-diaminopimelate desuccinylase [Brucella pinnipedialis
           B2/94]
 gi|261298727|gb|EEY02224.1| succinyl-diaminopimelate desuccinylase [Brucella neotomae 5K33]
 gi|261301943|gb|EEY05440.1| succinyl-diaminopimelate desuccinylase [Brucella pinnipedialis
           M163/99/10]
 gi|261737202|gb|EEY25198.1| succinyl-diaminopimelate desuccinylase [Brucella sp. F5/99]
 gi|261740473|gb|EEY28399.1| succinyl-diaminopimelate desuccinylase [Brucella suis bv. 5 str.
           513]
 gi|261743729|gb|EEY31655.1| succinyl-diaminopimelate desuccinylase [Brucella suis bv. 3 str.
           686]
 gi|262550101|gb|EEZ06262.1| succinyl-diaminopimelate desuccinylase [Brucella ceti M490/95/1]
 gi|264658307|gb|EEZ28568.1| succinyl-diaminopimelate desuccinylase [Brucella pinnipedialis
           M292/94/1]
 gi|294819639|gb|EFG36639.1| succinyl-diaminopimelate desuccinylase [Brucella sp. NVSL 07-0026]
          Length = 395

 Score =  259 bits (662), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 218/386 (56%), Positives = 268/386 (69%), Gaps = 8/386 (2%)

Query: 7   EHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPH 66
           ++L  LI+CPSVTP +GGA   L   LKL+GFS     F   NT  ++NLYAR     PH
Sbjct: 9   DNLAALIRCPSVTPAEGGALTALEKMLKLMGFSANRPVFSDDNTPDIENLYARKSGNGPH 68

Query: 67  LMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKN 126
           LMFAGH DVVPPGD   W +PPF+A I +G +YGRG VDMKG IACF+AAVAR I K+ N
Sbjct: 69  LMFAGHTDVVPPGDEKDWKHPPFAAAIEDGVMYGRGAVDMKGGIACFVAAVARHIEKHGN 128

Query: 127 F-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGS 185
             GSIS LITGDEEGPA+NGT K+L W +++GE WDA IVGEPT  + +GD IKIGRRGS
Sbjct: 129 IKGSISFLITGDEEGPAVNGTVKLLEWAKQRGESWDASIVGEPTNPNALGDMIKIGRRGS 188

Query: 186 LSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGN 245
           LSG IT+HG QGH AYPHL ENP+RG++ L+  L    FD G   F  +N+E+TTIDVGN
Sbjct: 189 LSGTITVHGVQGHAAYPHLAENPVRGIVTLVDSLLYPAFDEGTANFQASNLEVTTIDVGN 248

Query: 246 PSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVP-------KLSHTVHFSS 298
            + NVIP +   SFNIRFND W  ++L+ EI SRL +  ++          + + + +  
Sbjct: 249 KATNVIPNKATASFNIRFNDTWTAESLQAEIISRLERAARDNRLRQGRETPIKYELTWRE 308

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
             S VFLTHD KL   L+ S+   TG  P LSTSGGTSDARFIKDYCPV+EFGL G+TMH
Sbjct: 309 RPSHVFLTHDEKLIGTLTASVEAVTGKRPELSTSGGTSDARFIKDYCPVVEFGLTGQTMH 368

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E  +L DLE LT IYE F+ ++F
Sbjct: 369 MVDERVALADLEGLTQIYERFIADFF 394


>gi|294651358|ref|ZP_06728677.1| succinyl-diaminopimelate desuccinylase [Acinetobacter haemolyticus
           ATCC 19194]
 gi|292822760|gb|EFF81644.1| succinyl-diaminopimelate desuccinylase [Acinetobacter haemolyticus
           ATCC 19194]
          Length = 401

 Score =  259 bits (662), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 162/384 (42%), Positives = 228/384 (59%), Gaps = 13/384 (3%)

Query: 3   PDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT 62
            D LE  +QL++ PSVTP D     I+ + L  +GF+IE+  F+      V NL+AR GT
Sbjct: 28  SDTLELSLQLLRQPSVTPVDHDCQNIMADRLAKIGFNIEKLRFED-----VDNLWARRGT 82

Query: 63  EAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIP 122
           E P   FAGH DVVP G  + W   PF  TI +GK+YGRG  DMK ++A  + A  RF+ 
Sbjct: 83  ENPVFCFAGHTDVVPTGHLDAWNSDPFQPTIRDGKLYGRGSADMKTALAAMVVASERFVA 142

Query: 123 KYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
           K+ +  GSI+ LIT DEEGP+INGT K++  +E + EK   C+VGEP+  + +GD +K G
Sbjct: 143 KHPDHKGSIAFLITSDEEGPSINGTVKVVETLEARNEKMTWCLVGEPSSTNQLGDIVKNG 202

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSL+  +T++GKQGHVAYPHL ENPI      L++L    +D GN  F  T+ +I+ I
Sbjct: 203 RRGSLNAVLTVNGKQGHVAYPHLAENPIHLASKALNELCETVWDNGNEYFPATSFQISNI 262

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
             G  + NVIP  +KM+FN R++     + L++ +   L K   N     + + ++    
Sbjct: 263 QAGTGATNVIPGHLKMTFNFRYSTEVTAEILQQRVLEILDKHKLN-----YDISWTFSGL 317

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHAL 360
           P FLT   +L +    +I + TG   +LSTSGGTSD RFI      V+E G++  T+H +
Sbjct: 318 P-FLTPVGELVNAAKTAIKDVTGVETVLSTSGGTSDGRFIAPTGAQVLELGVLNATIHQI 376

Query: 361 NENASLQDLEDLTCIYENFLQNWF 384
           NE+ ++ DLE L  IYE  L    
Sbjct: 377 NEHVNVDDLEPLAEIYEQILVQLL 400


>gi|163795440|ref|ZP_02189407.1| succinyl-diaminopimelate desuccinylase [alpha proteobacterium
           BAL199]
 gi|159179426|gb|EDP63957.1| succinyl-diaminopimelate desuccinylase [alpha proteobacterium
           BAL199]
          Length = 393

 Score =  259 bits (661), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 184/384 (47%), Positives = 243/384 (63%), Gaps = 8/384 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D ++    LI+CPSVTP +GGA  +L +TL  LGF+     F+   T  + NLYAR GT 
Sbjct: 16  DAVDFAGHLIRCPSVTPAEGGAIDVLESTLGALGFTCHRLRFEEAGTDPIDNLYARIGTA 75

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
           APH  FAGH DVVP GD   WT  PF   + +G ++GRG  DMKG IA F+AA AR I +
Sbjct: 76  APHFCFAGHTDVVPVGDAAAWTVGPFDGAVRDGLLWGRGAADMKGGIAAFVAAAARIIGE 135

Query: 124 Y--KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
           +     GSISLLITGDEEGPA+NGT K+L W+E  GE  DAC+VGEPT  + +GD +KIG
Sbjct: 136 HGGNPPGSISLLITGDEEGPAVNGTTKVLDWMEAAGEIPDACVVGEPTNPNALGDMMKIG 195

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSL+G +T+ G QGHVAYPHL +NPI  L+ +L    +   D G   F P+ + +TTI
Sbjct: 196 RRGSLTGTLTVLGTQGHVAYPHLADNPIHHLLRMLEPFAHGQLDEGTAHFQPSTLAVTTI 255

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
           DVGNP+ NV+PA+    FNIRFND  N ++L+  +R    +              +S   
Sbjct: 256 DVGNPASNVVPAKATAVFNIRFNDAHNSQSLERMLRDSFDQKGARYEL------VTSCSG 309

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALN 361
             FLT   +L++L++ +  +  G  P LST+GGTSDARFI   CPV+EFGLVG+TMH ++
Sbjct: 310 ESFLTEPGRLSTLIADAAESVVGRRPELSTTGGTSDARFICRMCPVVEFGLVGQTMHKVD 369

Query: 362 ENASLQDLEDLTCIYENFLQNWFI 385
           E  ++ D+  LT IY   L+ +  
Sbjct: 370 ERVAIADIRSLTDIYAALLRRFLA 393


>gi|237748726|ref|ZP_04579206.1| succinyl-diaminopimelate desuccinylase [Oxalobacter formigenes
           OXCC13]
 gi|229380088|gb|EEO30179.1| succinyl-diaminopimelate desuccinylase [Oxalobacter formigenes
           OXCC13]
          Length = 375

 Score =  259 bits (661), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 155/381 (40%), Positives = 218/381 (57%), Gaps = 13/381 (3%)

Query: 7   EHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPH 66
           E    LI  PS+TP D     ++++ LK LGF  E        ++ V NL+AR GT  P 
Sbjct: 6   ELASALIAEPSITPDDKNCQKLIIDQLKPLGFECETIV-----SNGVTNLWARHGTSGPL 60

Query: 67  LMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKN 126
           L+FAGH DVVP G    W   PF+ T+  G++YGRG  DMK S A  + A   FI  + +
Sbjct: 61  LVFAGHTDVVPTGPVEKWGSDPFTPTVRNGRLYGRGASDMKTSDAAMVIAARDFILSHPD 120

Query: 127 F-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGS 185
           + GSI  + T DEEG A++GT  ++  ++++G   D CIVGEP+    +GDTIK GRRGS
Sbjct: 121 YKGSIGFIFTSDEEGIAVDGTDVVVKLLDERGIHPDYCIVGEPSSLTKLGDTIKNGRRGS 180

Query: 186 LSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGN 245
           L G++T+ GKQGH+AYP    NPI    P + +L+   +D GN  + PT  +I+ I  G 
Sbjct: 181 LCGKLTVIGKQGHIAYPKRAANPIHLAAPAIAELSATVWDKGNEYYEPTTWQISNIHAGT 240

Query: 246 PSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFL 305
            + NVIP ++ + FN RF       +LKE + + L K   N     + + ++    P FL
Sbjct: 241 GANNVIPGELFVEFNFRFCTASTVDSLKERVCAILDKHGLN-----YRLDWNYSGVP-FL 294

Query: 306 THDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMHALNENA 364
           T    L   LS++I   TG  P LST+GGTSD RFI   CP V+EFG V  ++H ++EN 
Sbjct: 295 TPRGSLCDALSEAIKEKTGITPELSTTGGTSDGRFIARICPQVVEFGPVTESIHQIDENV 354

Query: 365 SLQDLEDLTCIYENFLQNWFI 385
            + D++ LT IY   L+  F+
Sbjct: 355 PVSDIQPLTDIYRRTLEKLFL 375


>gi|325578775|ref|ZP_08148822.1| succinyl-diaminopimelate desuccinylase [Haemophilus parainfluenzae
           ATCC 33392]
 gi|325159599|gb|EGC71731.1| succinyl-diaminopimelate desuccinylase [Haemophilus parainfluenzae
           ATCC 33392]
          Length = 377

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 156/386 (40%), Positives = 217/386 (56%), Gaps = 13/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +E    LI+ PS++P D G   ++   L+ LGF IE   F     +   NL+A+ 
Sbjct: 1   MKQKTIELAQALIRRPSISPNDEGCQQLIAERLEKLGFQIEWMPF-----NDTLNLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   P + FAGH DVVP GD  HWTYPPFSA I +  +YGRG  DMKGS+A  I A   +
Sbjct: 56  GAGEPVIAFAGHTDVVPTGDEAHWTYPPFSAEIVDDVLYGRGAADMKGSLAAMIVAAEEY 115

Query: 121 IPKY-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +     + G+I+LLIT DEE  A +GT +++  +  +GEK   C+VGEP+ +  +GD +K
Sbjct: 116 VKANLNHKGTIALLITSDEEAAAKDGTVRVVETLMARGEKITYCMVGEPSSSKTLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++G + I G QGHVAYPHL ENPI    P L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITGNLYIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDNGNEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN+R+     ++ +K+++   L K         + + ++  
Sbjct: 236 NIHAGTGSNNVIPGELYVQFNLRYCTEVTDEGIKQKVAEMLEKHDLK-----YRIDWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P FLT   KL   L+ +I  TTG  P   T GGTSD RFI      V+EFG +  T+H
Sbjct: 291 GKP-FLTKPGKLLDALTTAIEQTTGIAPQAETGGGTSDGRFIALMGAEVVEFGPLNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            +NE  ++ DL     IY   L N  
Sbjct: 350 KVNECVNVDDLAKCGQIYHQMLVNLL 375


>gi|220934324|ref|YP_002513223.1| succinyl-diaminopimelate desuccinylase [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|238055235|sp|B8GPR9|DAPE_THISH RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|219995634|gb|ACL72236.1| succinyl-diaminopimelate desuccinylase [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 376

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 152/385 (39%), Positives = 224/385 (58%), Gaps = 13/385 (3%)

Query: 3   PDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT 62
            D L+   +LI+  SVTP+D G   ++   L  LGF      F+      V NL+ R G+
Sbjct: 2   SDTLDLAQELIRRRSVTPEDAGCQQLIAERLAPLGFEAHHLRFED-----VDNLWLRRGS 56

Query: 63  EAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIP 122
           E P L FAGH DVVP G    W+  PF   I  G++YGRG  DMK SIA F+ A   F+ 
Sbjct: 57  EGPVLAFAGHTDVVPTGPVEKWSSDPFQPQIRNGQLYGRGAADMKSSIAAFVIACEAFLK 116

Query: 123 KYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
            + +  GSI+LLIT DEEGP++NGT K++ W+E +GEK    +VGEP+    +GD IK G
Sbjct: 117 DHPDHKGSIALLITSDEEGPSVNGTVKVVEWLEARGEKITWALVGEPSSTERLGDVIKNG 176

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSLSG + + G+QGHVAYPHL +NP+   +P L +L  I +D GN  F PT+ +I+ I
Sbjct: 177 RRGSLSGVLRVRGQQGHVAYPHLADNPVHRALPALAELAAIQWDEGNEHFPPTSFQISNI 236

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
             G  ++NVIP ++++ FN+RF+    ++ ++  + + L     +   L + + +     
Sbjct: 237 HAGTGAENVIPGELEVMFNLRFSTEQTDEGIRTRVHAVL-----DAHGLDYELSWRLSGH 291

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHAL 360
           P FLT + +L    S +I    G    LST+GGTSD RFI      V+E G +  ++H +
Sbjct: 292 P-FLTAEGELVEAASAAIREVMGLDTELSTAGGTSDGRFIAPTGAQVVELGPLNASIHKI 350

Query: 361 NENASLQDLEDLTCIYENFLQNWFI 385
           +E+  ++DL+ L+ IY   L+   +
Sbjct: 351 DEHVRIEDLDALSRIYTGILKRLLV 375


>gi|190571095|ref|YP_001975453.1| succinyl-diaminopimelate desuccinylase [Wolbachia endosymbiont of
           Culex quinquefasciatus Pel]
 gi|213019615|ref|ZP_03335421.1| succinyl-diaminopimelate desuccinylase [Wolbachia endosymbiont of
           Culex quinquefasciatus JHB]
 gi|238055301|sp|B3CLN1|DAPE_WOLPP RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|190357367|emb|CAQ54799.1| succinyl-diaminopimelate desuccinylase [Wolbachia endosymbiont of
           Culex quinquefasciatus Pel]
 gi|212995037|gb|EEB55679.1| succinyl-diaminopimelate desuccinylase [Wolbachia endosymbiont of
           Culex quinquefasciatus JHB]
          Length = 398

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 170/385 (44%), Positives = 228/385 (59%), Gaps = 11/385 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D +E   +LI   S+TP+D GA   +   LK  GF  E  +F  K    VKNLYA++
Sbjct: 1   MKIDPVELTKKLISFKSITPKDDGAIEHIAAILKKSGFECEILEFGDK----VKNLYAKY 56

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIA-AVAR 119
               P+L FAGH+DVVPPG+   W   PF   I +G +YGRG  DMK  IA FIA  V  
Sbjct: 57  INGVPNLCFAGHVDVVPPGELKDWISDPFKPEIRDGMLYGRGAADMKSGIAAFIAAIVDS 116

Query: 120 FIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
              K++  GSIS LIT  EE    +GTK +L W++ K +K D CIVGEPT +  +GDTIK
Sbjct: 117 VAGKFRFSGSISALITSAEESTEEHGTKAVLEWMKSKQKKIDFCIVGEPTSSEKLGDTIK 176

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGS + ++  HGKQGHVAYP L +NPI  +I +L ++ +  FDTGN  F P++ EIT
Sbjct: 177 IGRRGSATFKLICHGKQGHVAYPELADNPIYKMISILSKIKDTTFDTGNKYFQPSHCEIT 236

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           TIDVGN + N+IP+ +   FNIR+N++     L + I         +      +      
Sbjct: 237 TIDVGNNTNNLIPSSIAAGFNIRYNNIQTLDGLYKLIDEICSSVTNDYKLSMQSSRNVFL 296

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
             P   T       ++  +I   TG   +LST+GGTSDA FIKD CPVIEFG++ +T H 
Sbjct: 297 SIPDRNT------DIMLDAINKITGIDAVLSTNGGTSDAAFIKDICPVIEFGMINKTAHQ 350

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           +NE  S+ D+  LT IY+ F++N+F
Sbjct: 351 VNECVSIDDIHKLTAIYKEFIKNYF 375


>gi|90409194|ref|ZP_01217307.1| succinyl-diaminopimelate desuccinylase [Psychromonas sp. CNPT3]
 gi|90309700|gb|EAS37872.1| succinyl-diaminopimelate desuccinylase [Psychromonas sp. CNPT3]
          Length = 377

 Score =  259 bits (660), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 160/382 (41%), Positives = 227/382 (59%), Gaps = 13/382 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            +  L  L+  PSVTP D G   +L+  L+ LGF+ E   F+        NL+AR GT++
Sbjct: 6   VISLLKNLVNRPSVTPNDAGCQTLLIERLEKLGFTCEVMHFED-----TLNLWARRGTQS 60

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI-PK 123
           P   FAGH DVVP G  + W +PPF AT ++GK+YGRG  DMKG IA F+ AV +FI   
Sbjct: 61  PLFCFAGHTDVVPTGPEHLWKFPPFQATESDGKLYGRGTADMKGGIAAFMIAVEQFIAQH 120

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
             + GSI++LIT DEEGP INGT +++  +EK+ EK D CIVGEP+    +GD IK GRR
Sbjct: 121 QDHQGSIAMLITSDEEGPFINGTTRVIDCLEKRNEKIDYCIVGEPSSTEQVGDVIKNGRR 180

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL+ +I I GKQGHVAYPHL +NPI   +    +L+N  +D GN  F PT+ +IT  + 
Sbjct: 181 GSLTADIRIIGKQGHVAYPHLVKNPIHSCLSAFAELSNEMWDNGNAYFPPTSFQITQFNA 240

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + N++P   ++  N R++   N + +   + + L K   N     + ++++   SP 
Sbjct: 241 GTGASNMVPGDAQLQCNFRYSTQLNSEQISARLEAILDKHQLN-----YEINWTYNGSPF 295

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
             T    LT  +S +I+   G    LSTSGGTSDARFI      V+E G+   ++H ++E
Sbjct: 296 ITTP-GYLTDAVSDAIFEINGLKTELSTSGGTSDARFIAPTGAQVVELGVCNGSIHQIDE 354

Query: 363 NASLQDLEDLTCIYENFLQNWF 384
           N ++ D+E LT IY+  L+   
Sbjct: 355 NVNINDVEQLTLIYQRILEKLL 376


>gi|226951677|ref|ZP_03822141.1| succinyl-diaminopimelate desuccinylase [Acinetobacter sp. ATCC
           27244]
 gi|226837593|gb|EEH69976.1| succinyl-diaminopimelate desuccinylase [Acinetobacter sp. ATCC
           27244]
          Length = 377

 Score =  259 bits (660), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 161/384 (41%), Positives = 228/384 (59%), Gaps = 13/384 (3%)

Query: 3   PDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT 62
            D LE  +QL++ PSVTP D     I+ + L  +GF+IE+  F+      V NL+AR GT
Sbjct: 4   SDTLELSLQLLRQPSVTPVDHDCQNIMADRLSKIGFNIEKLRFED-----VDNLWARRGT 58

Query: 63  EAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIP 122
           E P   FAGH DVVP G  + W   PF  TI +GK+YGRG  DMK ++A  + A  RF+ 
Sbjct: 59  ENPVFCFAGHTDVVPTGHLDAWNSDPFQPTIRDGKLYGRGSADMKTALAAMVVASERFVA 118

Query: 123 KYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
           K+ +  GSI+ LIT DEEGP+INGT K++  +E + EK   C+VGEP+  + +GD +K G
Sbjct: 119 KHPDHKGSIAFLITSDEEGPSINGTVKVVETLEARNEKMTWCLVGEPSSTNQLGDIVKNG 178

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSL+  +T++GKQGHVAYPHL ENPI      L++L    +D GN  F  T+ +I+ I
Sbjct: 179 RRGSLNAVLTVNGKQGHVAYPHLAENPIHLASKALNELCETVWDKGNEYFPATSFQISNI 238

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
             G  + NVIP  +K++FN R++     + L++ +   L K   N     + + ++    
Sbjct: 239 QAGTGATNVIPGHLKVTFNFRYSTEVTAEILQQRVLEILDKHKLN-----YDISWTFSGL 293

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHAL 360
           P FLT   +L +    +I + TG   +LSTSGGTSD RFI      V+E G++  T+H +
Sbjct: 294 P-FLTPVGELVNAAKTAIKDVTGVETVLSTSGGTSDGRFIAPTGAQVLELGVLNATIHQI 352

Query: 361 NENASLQDLEDLTCIYENFLQNWF 384
           NE+ ++ DLE L  IYE  L    
Sbjct: 353 NEHVNVDDLEPLAEIYEQILVQLL 376


>gi|317405181|gb|EFV85522.1| succinyl-diaminopimelate desuccinylase [Achromobacter xylosoxidans
           C54]
          Length = 405

 Score =  259 bits (660), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 163/387 (42%), Positives = 215/387 (55%), Gaps = 14/387 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L+ +  LI  PSVTP D      L   L  +GF+ E           V NL+AR G  A
Sbjct: 31  VLDLVKDLIARPSVTPADADCQATLAARLARIGFTCETI-----AQGGVTNLWARRGDTA 85

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P  +FAGH DVVPPG    W   PF  T  +G +YGRG  DMK SIA F+ A   F+   
Sbjct: 86  PLAVFAGHTDVVPPGPREKWESDPFVPTERDGYLYGRGAADMKSSIAAFVVAAEEFVAAN 145

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               GSI+LLIT DEEGP+I+GT  +   ++ +GE+ D CIVGEPT   ++GDT K GRR
Sbjct: 146 PRHGGSIALLITSDEEGPSIDGTAIVCDTLKARGEQMDYCIVGEPTSGDVLGDTCKNGRR 205

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSLSG++T+ G QGHVAYPHL  NP+  L P L ++  I +D GN  F PT  +++ ++ 
Sbjct: 206 GSLSGKLTVKGIQGHVAYPHLARNPVHQLAPALAEIVAIEWDQGNEYFPPTTFQVSNLNS 265

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NV+P +    FN RF+     + LK  +   L +         +T+ +     P 
Sbjct: 266 GTGATNVVPGEAVALFNFRFSTASTPEGLKARVHEVLDRHGLE-----YTLDWELGGEP- 319

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMHALNE 362
           FLT    LT  L K+I + TG    LST+GGTSD RFI   CP VIEFG    T+H +NE
Sbjct: 320 FLTPRGSLTDALVKAIRDETGVTAELSTTGGTSDGRFIAKICPQVIEFGPCNATIHKVNE 379

Query: 363 NASLQDLEDLTCIYENFLQNWFITPSQ 389
              L  L+ L  IY   L+N  + P++
Sbjct: 380 RIELASLDPLKNIYRRTLENLLL-PAK 405


>gi|56460563|ref|YP_155844.1| succinyl-diaminopimelate desuccinylase [Idiomarina loihiensis L2TR]
 gi|81362149|sp|Q5QTZ3|DAPE_IDILO RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|56179573|gb|AAV82295.1| N-succinyl-diaminopimelate deacylase [Idiomarina loihiensis L2TR]
          Length = 376

 Score =  259 bits (660), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 157/386 (40%), Positives = 214/386 (55%), Gaps = 13/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+ + L+   +LI  PS+TP+D G   ++   L   GF++E   F+        NL+AR 
Sbjct: 1   MSSETLKFARELISRPSITPEDEGCQQLIGERLAAQGFNLESMIFED-----TTNLWARR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G       FAGH DVVPPGD N W +PPF  T  EG +YGRG  DMKGS+A  I A  RF
Sbjct: 56  GQGRKLFCFAGHTDVVPPGDINDWQFPPFEPTTHEGYLYGRGAADMKGSLAAMITATERF 115

Query: 121 IPKYKN-FGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           I  Y N    I  LIT DEEGP INGTK+++  ++++ E  D CIVGEP+    +GD +K
Sbjct: 116 IKDYPNVDADIGFLITSDEEGPFINGTKRVIETLQERNENIDWCIVGEPSSTDTLGDIVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+G++T+ G QGHVAYPHL +NP+  L P L +L N  +D GN +F PT  +++
Sbjct: 176 NGRRGSLTGDLTVLGIQGHVAYPHLAKNPVHDLAPALSELINEEWDQGNASFPPTTFQVS 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  + NVIP ++   FN RF+     + +K+ + + L K                 
Sbjct: 236 NIQAGTGAGNVIPGRIDTQFNFRFSTELTAEKIKQRVEAILDKHSLKYHLQWKL------ 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT    L   +  +I +  G    LST+GGTSD RFI      VIE G V  T+H
Sbjct: 290 NGPPFLTESGALVEAVQAAIEHECGFSTTLSTAGGTSDGRFIAPTGAQVIELGPVNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            +NE   + DL+ L+ +Y   L+   
Sbjct: 350 KVNECVKISDLDKLSDVYYRCLEKLL 375


>gi|126733865|ref|ZP_01749612.1| succinyl-diaminopimelate desuccinylase [Roseobacter sp. CCS2]
 gi|126716731|gb|EBA13595.1| succinyl-diaminopimelate desuccinylase [Roseobacter sp. CCS2]
          Length = 380

 Score =  258 bits (659), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 158/387 (40%), Positives = 224/387 (57%), Gaps = 9/387 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D +    +L++CPS+TP +GGA  +L + L   GF+    D        V NLYAR+
Sbjct: 1   MPIDPVALTAELVRCPSITPHEGGALVLLEDVLTKGGFTCTRVDRGD-----VSNLYARW 55

Query: 61  GTEA--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
           G +       F GH DVVP GD   WT PPF A I +G +YGRG  DMK  +A F AA  
Sbjct: 56  GRQGANRTFGFNGHTDVVPLGDEAAWTMPPFEAEIKDGYLYGRGATDMKSGVAAFAAAAI 115

Query: 119 RFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
            F+      G++ L ITGDEEG A++GT  +L W+    E    C+VGEPTC  ++G+ +
Sbjct: 116 DFVQNTPPDGAVVLAITGDEEGDAVDGTTALLDWMATNNEAMSVCLVGEPTCPDVMGEAM 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGS++   T+ G QGH AYPH  +NP+  +  L+  L++   D G T F P+++++
Sbjct: 176 KIGRRGSMTAFFTMTGVQGHAAYPHRAKNPMPAMARLMDVLSSRVLDEGTTHFDPSSLQV 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
            TID GNP+ NVIP+  K + NIRFND  +   L   ++    K               S
Sbjct: 236 LTIDTGNPATNVIPSHTKATVNIRFNDTHSSADLTTWMQEEADKVAAAFDIQVDMRVRVS 295

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
                F+T    L+ L+ K++ + TG  P LST+GGTSDARF+K +CPV+EFGLVG+TMH
Sbjct: 296 G--ESFVTPPGDLSDLVGKAVESETGVKPELSTTGGTSDARFVKHHCPVVEFGLVGKTMH 353

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            ++E  +++ +  L  IY   L+++F 
Sbjct: 354 QVDERVAVEQIGQLKAIYTRILRDYFA 380


>gi|238064819|sp|B8IFQ0|DAPE_METNO RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 396

 Score =  258 bits (659), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 200/385 (51%), Positives = 250/385 (64%), Gaps = 4/385 (1%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           TP  L     LI+CPSVTP +GGA  +L + L   GFS+E   F    T  V+NLYAR G
Sbjct: 4   TPSPLALTQGLIRCPSVTPAEGGALSLLADLLGAAGFSVERPVFSEPGTPDVENLYARIG 63

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
           T  P L+ AGH DVVPPGD   W + PF   + EG+++GRG VDMKG IAC  AA+  F+
Sbjct: 64  TAGPCLLLAGHTDVVPPGDLAAWRHDPFGGVVEEGEVHGRGAVDMKGGIACLAAAILAFL 123

Query: 122 PKYKNF--GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
            +      GSI+ LITGDEEGPA+NGT K+L+W  +KGE++D CI+ EPT    +GD IK
Sbjct: 124 AERGPDFGGSIAFLITGDEEGPAVNGTVKLLAWARQKGERFDHCILAEPTNPDRLGDMIK 183

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGSL+  +T+HG QGHVAYPH  ENPI GLI L   L     D G   F  +N+E T
Sbjct: 184 IGRRGSLTAALTVHGVQGHVAYPHRAENPIPGLIRLAGALLAAPLDAGTAHFDASNLEFT 243

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           T+DVGNP+ NVIPA+ +  FNIRFNDLW   TL+ E+R RL     N  + +  V  ++ 
Sbjct: 244 TVDVGNPASNVIPAEARAVFNIRFNDLWTPATLEAELRRRLDAAAGNAVRYTLAVQPTNA 303

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
           V   FLT       L++ +I   TG  P LST+GGTSDARFIKD CPVIEFGLVG+TMH 
Sbjct: 304 V--AFLTQPDPFVDLVTAAIEAETGRRPALSTTGGTSDARFIKDACPVIEFGLVGQTMHQ 361

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           ++E A+L DL+ LT I+   L  +F
Sbjct: 362 IDERAALADLDRLTAIFRRVLDAYF 386


>gi|86139452|ref|ZP_01058021.1| succinyl-diaminopimelate desuccinylase [Roseobacter sp. MED193]
 gi|85823955|gb|EAQ44161.1| succinyl-diaminopimelate desuccinylase [Roseobacter sp. MED193]
          Length = 381

 Score =  258 bits (659), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 162/388 (41%), Positives = 222/388 (57%), Gaps = 10/388 (2%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           M P D +     LI+CPSVTP++GGA  +L   L   GF+    D        + NL+AR
Sbjct: 1   MPPIDPVSLTADLIRCPSVTPEEGGALQLLDELLTQAGFACTRVD-----RGGIANLFAR 55

Query: 60  FGTEA--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAV 117
           +G +       F GH DVVP GD   WT PPF A I EG +YGRG  DMK  +A F AA 
Sbjct: 56  WGDKGHARTFGFNGHTDVVPLGDEAAWTMPPFGAEIKEGVMYGRGATDMKSGVAAFAAAA 115

Query: 118 ARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDT 177
             F+      G++ L ITGDEEG AI+GT  +L  +E  GE  D C+VGEPTC + +G+ 
Sbjct: 116 IDFVTNTPPDGAVILTITGDEEGDAIDGTTALLDHLETAGEAMDVCLVGEPTCPNTMGEM 175

Query: 178 IKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNME 237
           IKIGRRGS++   T+ GKQGH AYPH   NP+  +  L+ +L +   D G   F  + + 
Sbjct: 176 IKIGRRGSMTAWFTVTGKQGHSAYPHRANNPLNAMARLMDRLASHELDQGTEHFDASTLA 235

Query: 238 ITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFS 297
           + TID GNP+ NVIPAQ + + NIRFND  +  +L   ++  + +               
Sbjct: 236 VVTIDTGNPATNVIPAQSRATVNIRFNDSHSGASLSAWLQEEVDRVTTEFGVSVDLTIKI 295

Query: 298 SPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTM 357
           S     F+T    L+ L++ ++   TG  P LST+GGTSDARF+K +CPV+EFGLVG+TM
Sbjct: 296 SG--ESFITPPGALSDLVATAVEAETGLKPELSTTGGTSDARFVKHHCPVVEFGLVGKTM 353

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H ++E   +  +  L  IY   L+++F 
Sbjct: 354 HQVDECVPIAQITQLKSIYTRILKDYFA 381


>gi|220924611|ref|YP_002499913.1| succinyl-diaminopimelate desuccinylase [Methylobacterium nodulans
           ORS 2060]
 gi|219949218|gb|ACL59610.1| succinyl-diaminopimelate desuccinylase [Methylobacterium nodulans
           ORS 2060]
          Length = 410

 Score =  258 bits (659), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 200/385 (51%), Positives = 250/385 (64%), Gaps = 4/385 (1%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           TP  L     LI+CPSVTP +GGA  +L + L   GFS+E   F    T  V+NLYAR G
Sbjct: 18  TPSPLALTQGLIRCPSVTPAEGGALSLLADLLGAAGFSVERPVFSEPGTPDVENLYARIG 77

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
           T  P L+ AGH DVVPPGD   W + PF   + EG+++GRG VDMKG IAC  AA+  F+
Sbjct: 78  TAGPCLLLAGHTDVVPPGDLAAWRHDPFGGVVEEGEVHGRGAVDMKGGIACLAAAILAFL 137

Query: 122 PKYKNF--GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
            +      GSI+ LITGDEEGPA+NGT K+L+W  +KGE++D CI+ EPT    +GD IK
Sbjct: 138 AERGPDFGGSIAFLITGDEEGPAVNGTVKLLAWARQKGERFDHCILAEPTNPDRLGDMIK 197

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGSL+  +T+HG QGHVAYPH  ENPI GLI L   L     D G   F  +N+E T
Sbjct: 198 IGRRGSLTAALTVHGVQGHVAYPHRAENPIPGLIRLAGALLAAPLDAGTAHFDASNLEFT 257

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           T+DVGNP+ NVIPA+ +  FNIRFNDLW   TL+ E+R RL     N  + +  V  ++ 
Sbjct: 258 TVDVGNPASNVIPAEARAVFNIRFNDLWTPATLEAELRRRLDAAAGNAVRYTLAVQPTNA 317

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
           V   FLT       L++ +I   TG  P LST+GGTSDARFIKD CPVIEFGLVG+TMH 
Sbjct: 318 V--AFLTQPDPFVDLVTAAIEAETGRRPALSTTGGTSDARFIKDACPVIEFGLVGQTMHQ 375

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           ++E A+L DL+ LT I+   L  +F
Sbjct: 376 IDERAALADLDRLTAIFRRVLDAYF 400


>gi|238055330|sp|A6U5J1|DAPE_SINMW RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 397

 Score =  258 bits (659), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 214/388 (55%), Positives = 266/388 (68%), Gaps = 7/388 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D + +L  LI+CPSVTP +GGA   L + L  +GF  +    +   T  ++NLYAR G  
Sbjct: 5   DPVSNLATLIRCPSVTPAEGGALTALESMLTPIGFKADRIVAREAGTPDIENLYARIGVG 64

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVP GD   W++PPFSA IAEG++YGRG VDMKG IACF+AAVAR I K
Sbjct: 65  GPHLMFAGHTDVVPVGDEIAWSHPPFSAAIAEGEMYGRGAVDMKGGIACFVAAVARHIEK 124

Query: 124 YK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
           +    GSIS LITGDEEGPAINGT K+L W   KGE+WDAC+VGEPT    IG+ IKIGR
Sbjct: 125 HGAPKGSISFLITGDEEGPAINGTVKLLEWAAAKGERWDACLVGEPTNPGGIGEMIKIGR 184

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSLSG IT+ G QGH AYPHL +NP+R ++ L H L +  FD G   F P+N+E+TTID
Sbjct: 185 RGSLSGRITVQGVQGHAAYPHLADNPVRSILQLAHALMDPPFDDGTENFQPSNLEVTTID 244

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKG------IQNVPKLSHTVHF 296
           VGN + NVIPA+   +FN+RFNDLW  ++L  EI +RL +             + + + +
Sbjct: 245 VGNAAVNVIPAKASAAFNVRFNDLWTAESLMTEIVARLDRAASAGALRPGRAPVKYEIVW 304

Query: 297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRT 356
           +   S VFLT +  L   LS ++   TG  P LST+GGTSDARFIKDYCPV+EFGLVG+T
Sbjct: 305 NERPSHVFLTRNDALIESLSGAVEAVTGQQPRLSTTGGTSDARFIKDYCPVVEFGLVGKT 364

Query: 357 MHALNENASLQDLEDLTCIYENFLQNWF 384
           MH ++E  +L DLE LT IYE F+  WF
Sbjct: 365 MHMVDERVALADLETLTGIYETFIARWF 392


>gi|238064833|sp|Q3YT10|DAPE_EHRCJ RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 380

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 172/385 (44%), Positives = 235/385 (61%), Gaps = 9/385 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D ++   +LI  PS+TP D GA   L NTL   GF+     F      +  NLYA+ 
Sbjct: 1   MAIDPIKLSQELISFPSITPTDNGAIDFLSNTLSQYGFTCHVLTFGDDQVQVR-NLYAQL 59

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G  +P+L FAGH DVVP GD   W + PFS  I +  +YGRG+VDMK +I  F+AAV+R 
Sbjct: 60  GNGSPNLCFAGHTDVVPTGDSEKWKFDPFSGKIEDNILYGRGVVDMKSAICAFVAAVSR- 118

Query: 121 IPKYKNFGSISLLITGDEEGPAI-NGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           I   +  GSIS LI+GDEEG     GT  +L W+    +K D C+VGEPT    +GDTIK
Sbjct: 119 IDFNQINGSISFLISGDEEGNYFKYGTPAVLKWLTDNNKKIDFCLVGEPTSQSSVGDTIK 178

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGS++ +I  +G QGHVAYPHL ENP+  +I +L++++N   D GN  F P+N EIT
Sbjct: 179 IGRRGSINFKIVCNGVQGHVAYPHLAENPVDNMISILYKISNTVLDNGNEYFQPSNCEIT 238

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           ++DVGN + NVIP ++  + NIR+ND+   ++L   I +   +  +      + +  +  
Sbjct: 239 SVDVGNTATNVIPDKITANLNIRYNDMHTSESLFNIINNICAEITEK-----YELFTAVS 293

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
            S        K + +LS +I   TG   +LSTSGGTSDARFIKD+CPVIE GL   T H 
Sbjct: 294 GSSFITHP-GKHSDMLSSAIKKVTGQDAILSTSGGTSDARFIKDFCPVIELGLSNETAHK 352

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           +NE+A + D+  LT IYE F++ +F
Sbjct: 353 INEHAPVDDIYKLTDIYEEFIRQFF 377


>gi|73666727|ref|YP_302743.1| succinyl-diaminopimelate desuccinylase [Ehrlichia canis str. Jake]
 gi|72393868|gb|AAZ68145.1| succinyldiaminopimelate desuccinylase [Ehrlichia canis str. Jake]
          Length = 389

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 172/385 (44%), Positives = 235/385 (61%), Gaps = 9/385 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D ++   +LI  PS+TP D GA   L NTL   GF+     F      +  NLYA+ 
Sbjct: 10  MAIDPIKLSQELISFPSITPTDNGAIDFLSNTLSQYGFTCHVLTFGDDQVQVR-NLYAQL 68

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G  +P+L FAGH DVVP GD   W + PFS  I +  +YGRG+VDMK +I  F+AAV+R 
Sbjct: 69  GNGSPNLCFAGHTDVVPTGDSEKWKFDPFSGKIEDNILYGRGVVDMKSAICAFVAAVSR- 127

Query: 121 IPKYKNFGSISLLITGDEEGPAI-NGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           I   +  GSIS LI+GDEEG     GT  +L W+    +K D C+VGEPT    +GDTIK
Sbjct: 128 IDFNQINGSISFLISGDEEGNYFKYGTPAVLKWLTDNNKKIDFCLVGEPTSQSSVGDTIK 187

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGS++ +I  +G QGHVAYPHL ENP+  +I +L++++N   D GN  F P+N EIT
Sbjct: 188 IGRRGSINFKIVCNGVQGHVAYPHLAENPVDNMISILYKISNTVLDNGNEYFQPSNCEIT 247

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           ++DVGN + NVIP ++  + NIR+ND+   ++L   I +   +  +      + +  +  
Sbjct: 248 SVDVGNTATNVIPDKITANLNIRYNDMHTSESLFNIINNICAEITEK-----YELFTAVS 302

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
            S        K + +LS +I   TG   +LSTSGGTSDARFIKD+CPVIE GL   T H 
Sbjct: 303 GSSFITHP-GKHSDMLSSAIKKVTGQDAILSTSGGTSDARFIKDFCPVIELGLSNETAHK 361

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           +NE+A + D+  LT IYE F++ +F
Sbjct: 362 INEHAPVDDIYKLTDIYEEFIRQFF 386


>gi|114769615|ref|ZP_01447225.1| succinyl-diaminopimelate desuccinylase [alpha proteobacterium
           HTCC2255]
 gi|114549320|gb|EAU52202.1| succinyl-diaminopimelate desuccinylase [alpha proteobacterium
           HTCC2255]
          Length = 377

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 168/385 (43%), Positives = 223/385 (57%), Gaps = 8/385 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D +     LI+C S+TP++ GA  +L   L   GF     D       +V NL+AR+
Sbjct: 1   MNIDPVNLTADLIRCKSITPKEAGALVLLEALLSKAGFECNRVD-----RGLVSNLFARW 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G+    L F GH DVVP G  N WT  PF A I +G +YGRG  DMK  +A F AA   F
Sbjct: 56  GS-GRTLGFNGHTDVVPVGSINDWTVDPFGAEIKDGFLYGRGSTDMKSGVAAFAAAAIDF 114

Query: 121 IPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
           +      GSI L ITGDEEG A++GT  +L W+ +  E  + CIVGEPTC   IG+ +KI
Sbjct: 115 VQNSPPDGSIVLAITGDEEGQAVDGTVALLDWMNENNEIINHCIVGEPTCPENIGEMMKI 174

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGS++   TI G QGH AYPH   NP+  +  L+  LT+   D G+  F P+ + +TT
Sbjct: 175 GRRGSMTAYFTIRGVQGHSAYPHRANNPLPIMAKLICDLTSFELDQGSKHFDPSTLAVTT 234

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV 300
           ID GN + NVIPA+ K + NIRFNDL   K L   +  ++ K I +   +          
Sbjct: 235 IDTGNLANNVIPAETKATVNIRFNDLHTSKKLSIWL-DKVTKRIASENDVEINTEIQVSG 293

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL 360
              F+T     + L+S S++  TG  P  STSGGTSDARFIKD+CPV+EFGLVG+TMH +
Sbjct: 294 -ESFITALGDFSDLISNSVHLETGIYPEASTSGGTSDARFIKDHCPVVEFGLVGKTMHQI 352

Query: 361 NENASLQDLEDLTCIYENFLQNWFI 385
           +E  S+  +  L  IY N ++N+F 
Sbjct: 353 DERVSIDQVYKLKAIYFNIIKNYFA 377


>gi|82702973|ref|YP_412539.1| succinyl-diaminopimelate desuccinylase [Nitrosospira multiformis
           ATCC 25196]
 gi|123544266|sp|Q2Y7X4|DAPE_NITMU RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|82411038|gb|ABB75147.1| succinyldiaminopimelate desuccinylase [Nitrosospira multiformis
           ATCC 25196]
          Length = 378

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 161/387 (41%), Positives = 222/387 (57%), Gaps = 13/387 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D L     LI   S TP D G   IL++ L+ +GF IE           V NL+AR 
Sbjct: 1   MLNDTLALAQMLIARRSPTPFDNGCQEILIDRLEKMGFDIERIRCGE-----VDNLWARR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GTEAP + FAGH DVVP G    W   PF      G++YGRG  DMKGSIA FI ++  F
Sbjct: 56  GTEAPLICFAGHTDVVPTGPLEKWESSPFDPVTRNGRLYGRGAADMKGSIAAFITSIEAF 115

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++  + GSI+LLIT DEEG A++GT +++  ++ + E  D CIVGEPT    +GD IK
Sbjct: 116 VAEHPDHNGSIALLITSDEEGIAVDGTVRVVEVLKARNELIDYCIVGEPTSVDKLGDMIK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSLSG +T+ G QGH+AYPHL +NPI    P + +L N  +D GN  F PT  +I+
Sbjct: 176 NGRRGSLSGTLTVKGIQGHIAYPHLAKNPIHLAAPAIAELANTEWDEGNEYFPPTTWQIS 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NVIP +V + FN RF+     ++LK  +   L +         + + + + 
Sbjct: 236 NINGGTGATNVIPGEVTVLFNFRFSTASTIESLKARVHGILDRHNLE-----YDLQWENS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMH 358
             P +LT    L   ++ +I+  TG  P LSTSGGTSD RFI D CP V+E G    T+H
Sbjct: 291 GKP-YLTPRGDLVDAVNAAIHTVTGIEPELSTSGGTSDGRFIADICPQVVELGPRNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            +NE   + DL+ L  IY+  +++  +
Sbjct: 350 KINEYVEVSDLDQLPRIYQLTMESLLL 376


>gi|315121999|ref|YP_004062488.1| succinyl-diaminopimelate desuccinylase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495401|gb|ADR52000.1| succinyl-diaminopimelate desuccinylase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 365

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 276/358 (77%), Positives = 320/358 (89%)

Query: 29  LVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDVVPPGDFNHWTYPP 88
           L +TLK LGFSI+++ FQ +NT  VKN+YARFG + PHLMFAGH+DVVPPG+ + W YPP
Sbjct: 2   LADTLKPLGFSIKQQIFQEENTPDVKNIYARFGVKKPHLMFAGHVDVVPPGNLDEWMYPP 61

Query: 89  FSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKK 148
           FSAT+AEG+IYGRG VDMKGSIACFIAAV+RFIPK+ NFGSISLLITGDEEGPAINGTKK
Sbjct: 62  FSATVAEGRIYGRGAVDMKGSIACFIAAVSRFIPKHTNFGSISLLITGDEEGPAINGTKK 121

Query: 149 MLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENP 208
           MLSW +K GE+WDACIVGEPTC+HI+GDTIKIGRRGSLSGEI IHG QGHVAYPHL  NP
Sbjct: 122 MLSWAKKNGEQWDACIVGEPTCSHILGDTIKIGRRGSLSGEIIIHGTQGHVAYPHLANNP 181

Query: 209 IRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWN 268
           I+GLIPLLHQLT I FDTGNT F  TN+EITT+DVGNP+KN+IPA+VK+SFNIRFN+LWN
Sbjct: 182 IKGLIPLLHQLTTIEFDTGNTDFPSTNLEITTVDVGNPAKNIIPAKVKISFNIRFNNLWN 241

Query: 269 EKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPL 328
           E+TLK+EI SRL K +QN+PKLS+ +HFSSPVSPVFLT ++ LTSLLS+SI+  TG  P 
Sbjct: 242 EQTLKKEIESRLTKSLQNMPKLSYNLHFSSPVSPVFLTDNKTLTSLLSESIHRVTGGTPQ 301

Query: 329 LSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASLQDLEDLTCIYENFLQNWFIT 386
           LST+GGTSDARFIKD+CPVIEFGLVG+T+HA+NEN  L+DLEDLTCIYE+FL NWFI+
Sbjct: 302 LSTTGGTSDARFIKDHCPVIEFGLVGKTIHAVNENVLLKDLEDLTCIYEDFLHNWFIS 359


>gi|87118634|ref|ZP_01074533.1| succinyl-diaminopimelate desuccinylase [Marinomonas sp. MED121]
 gi|86166268|gb|EAQ67534.1| succinyl-diaminopimelate desuccinylase [Marinomonas sp. MED121]
          Length = 378

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 157/383 (40%), Positives = 218/383 (56%), Gaps = 13/383 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L     LI  PSVTP+D G   +++  L  LGF +EE  F       VKN YA+ G E 
Sbjct: 7   TLALAFDLISRPSVTPEDAGCQALMIQRLTKLGFDVEEMPFGD-----VKNFYAKRGNEG 61

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P+L FAGH DVVP G  + W  PPF   I +GK++GRG  DMKGS+A  + AV  F+   
Sbjct: 62  PNLCFAGHTDVVPTGPESEWINPPFEPKIIDGKLFGRGAADMKGSLASMVVAVEEFVTAN 121

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
            +  G IS LIT DEEGP ++GT +++  + ++ EK D CIVGEP+  + +GD IK GRR
Sbjct: 122 PDHKGQISFLITSDEEGPFVDGTTRVVDALMERKEKVDWCIVGEPSSTNQLGDIIKNGRR 181

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS SG +TI+GKQGHVAYPHL +NPI    P++ +L+   +D GN  F PT+ +++ I  
Sbjct: 182 GSFSGNLTIYGKQGHVAYPHLAQNPIHLAAPVIAELSETHWDEGNDFFPPTSFQVSNISS 241

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NV+P  +   FN+RF+   +   +K  I + L K         + + ++    P 
Sbjct: 242 GTGATNVVPGTLNTQFNLRFSSELDFDKIKARILAILEKHGVK-----YDIEWTYNGLPF 296

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
                 +L   + KS+ ++    P LSTSGGTSD RFI      V+E G V  T+H +NE
Sbjct: 297 LTRP-GELVDAIVKSVEDSVKITPELSTSGGTSDGRFIAKMGTQVVELGPVNATIHQINE 355

Query: 363 NASLQDLEDLTCIYENFLQNWFI 385
               + L  LT IY   L+N F+
Sbjct: 356 CVEAESLNQLTNIYRKTLENLFL 378


>gi|93005379|ref|YP_579816.1| succinyl-diaminopimelate desuccinylase [Psychrobacter
           cryohalolentis K5]
 gi|122415857|sp|Q1QDC1|DAPE_PSYCK RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|92393057|gb|ABE74332.1| succinyldiaminopimelate desuccinylase [Psychrobacter cryohalolentis
           K5]
          Length = 407

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 165/387 (42%), Positives = 224/387 (57%), Gaps = 8/387 (2%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQT----KNTSIVKNLYARF 60
            L+  I L++ PSVTP D G   IL   L   GF  E   +         + VKNL+AR 
Sbjct: 22  TLDLSIALLERPSVTPDDDGCQDILSERLTQAGFDCEFMYYGDRQAKGEHAEVKNLWARR 81

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   P + FAGH DVVP GD  +WTYPPF+ TIA+G ++ RG  DMK  IA F  A  RF
Sbjct: 82  GNTNPVICFAGHTDVVPTGDEKNWTYPPFTPTIADGYLWARGAADMKTGIAAFTVAAERF 141

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  +  + GSI+ LIT DEEGP+INGT K++  +E + EK   C+VGEP+    +GD IK
Sbjct: 142 VANHPEHNGSIAFLITSDEEGPSINGTVKVVETLEARNEKITYCLVGEPSSTDTLGDIIK 201

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL   +T+ GKQGHVAYPHL  NPI   +  L +LTN  +D GN  F  T+++I+
Sbjct: 202 NGRRGSLGAVLTVTGKQGHVAYPHLASNPIHAAMSALAELTNATWDNGNDYFPATSLQIS 261

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NVIP  ++  FN RF+   +E  LK +  +   +   +  K ++ +H+   
Sbjct: 262 NINSGTGATNVIPETLEAVFNFRFSTETSEDELKAKTHAIFDRYFADS-KAAYDIHWKLS 320

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT + KL S   ++I + TG    LSTSGGTSD RFI      V+E G+   T+H
Sbjct: 321 GQP-FLTPEGKLVSACQQAIKSVTGTDTTLSTSGGTSDGRFIAPTGAQVVELGVRNATIH 379

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            ++E   + DL  L  IYE  L+N  +
Sbjct: 380 QVDEKVEVDDLGKLAQIYEGILENLLL 406


>gi|307257980|ref|ZP_07539733.1| Succinyl-diaminopimelate desuccinylase [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306863527|gb|EFM95457.1| Succinyl-diaminopimelate desuccinylase [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
          Length = 382

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 149/388 (38%), Positives = 215/388 (55%), Gaps = 13/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  + +     LI+ PSV+P D G   ++   L  LGF++E   F         NL+A  
Sbjct: 6   MKHNIINLAQDLIRRPSVSPDDQGCQQVIAERLAQLGFTLEWLPFGD-----TLNLWATH 60

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT+ P ++FAGH DVVP GD   W YPPFSA I +G +YGRG  DMKGS+A  + A   F
Sbjct: 61  GTQDPCVVFAGHTDVVPVGDETQWQYPPFSAEIVDGTLYGRGAADMKGSLAALVIAAETF 120

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G I+LLIT DEE  A +GT K++  +  + E     +VGEP+   ++GD IK
Sbjct: 121 VKNNPNHKGKIALLITSDEEAAAKDGTVKVVETLMARQEAVHYAVVGEPSSGKVLGDVIK 180

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++GE+ I G QGHVAYPHL ENP+   +  L +LT   +D GN  F PT+++I 
Sbjct: 181 NGRRGSITGELYIEGVQGHVAYPHLAENPVHTSLNFLTELTTYQWDNGNEFFPPTSLQIA 240

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN+R+    +++ +K ++   L K         H + ++  
Sbjct: 241 NIKAGTGSNNVIPGELYVQFNLRYCTEVSDEIIKNKVAEMLAKHQLK-----HRISWNLS 295

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P    +  +L     +++ N T   P L TSGGTSD RFI      V+EFG +  T+H
Sbjct: 296 GKPFLAGN-GELVKAAVQAVENVTKITPRLDTSGGTSDGRFIALMGAEVVEFGPLNATIH 354

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFIT 386
            +NE  S++DL     +Y   L++   +
Sbjct: 355 KVNECVSVEDLGKCGEVYYKILEHLLKS 382


>gi|297184317|gb|ADI20434.1| acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase
           and related deacylases [uncultured alpha proteobacterium
           EB080_L43F08]
          Length = 377

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 167/385 (43%), Positives = 223/385 (57%), Gaps = 8/385 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D +     LI+C S+TP++ GA  +L   L   GF     D       +V NL+AR+
Sbjct: 1   MNIDPVNLTADLIRCKSITPKEAGALVLLEALLSKAGFECNRVD-----RGLVSNLFARW 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G+    L F GH DVVP G  N W+  PF A I +G +YGRG  DMK  +A F AA   F
Sbjct: 56  GS-GRTLGFNGHTDVVPVGSINDWSVDPFGAEIKDGFLYGRGSTDMKSGVAAFAAAAIDF 114

Query: 121 IPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
           +      GSI L ITGDEEG A++GT  +L W+ +  E  + CIVGEPTC   IG+ +KI
Sbjct: 115 VQNSPPDGSIVLAITGDEEGQAVDGTVALLDWMNENNEIINHCIVGEPTCPENIGEMMKI 174

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGS++   TI G QGH AYPH   NP+  +  L+  LT+   D G+  F P+ + +TT
Sbjct: 175 GRRGSMTAYFTIRGVQGHSAYPHRANNPLPIMAKLICDLTSFELDQGSKHFDPSTLAVTT 234

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV 300
           ID GN + NVIPA+ K + NIRFNDL   K L   +  ++ K I +   +          
Sbjct: 235 IDTGNLANNVIPAETKATVNIRFNDLHTSKKLSIWL-DKVTKKIASENDVEINTEIQVSG 293

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL 360
              F+T     + L+S S++  TG  P  STSGGTSDARFIKD+CPV+EFGLVG+TMH +
Sbjct: 294 -ESFITALGDFSDLISNSVHLETGIYPEASTSGGTSDARFIKDHCPVVEFGLVGKTMHQI 352

Query: 361 NENASLQDLEDLTCIYENFLQNWFI 385
           +E  S+  +  L  IY N ++N+F 
Sbjct: 353 DERVSIDQVYKLKAIYFNIIKNYFA 377


>gi|182680238|ref|YP_001834384.1| succinyl-diaminopimelate desuccinylase [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|238055172|sp|B2IDW3|DAPE_BEII9 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|182636121|gb|ACB96895.1| succinyl-diaminopimelate desuccinylase [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 383

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 186/385 (48%), Positives = 251/385 (65%), Gaps = 4/385 (1%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   L+    LI CPSVTPQDGG   +L + LK  GF      F  + T  + NLYARF
Sbjct: 1   MSETALDLARALISCPSVTPQDGGTLGVLESRLKASGFRTHRLTFHEEGTPDIDNLYARF 60

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G+ AP L+FAGH DVVP G    W + PF+A + +G+++GRG  DMKG+IA F AA   F
Sbjct: 61  GSGAPCLVFAGHTDVVPVGTATDWRFDPFAAKVEDGQLWGRGAADMKGAIAAFTAAALTF 120

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           I ++K+F GSI+ LITGDEEGP+INGT K+L W  ++GE +D CIVGEPT   ++GD IK
Sbjct: 121 IEQHKDFKGSIAFLITGDEEGPSINGTIKLLKWAAEQGEHFDHCIVGEPTNPQVLGDMIK 180

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGSL+G ++I GKQGHVAYPH  +NP+  L+ L+  L     D G   F  +N+E+ 
Sbjct: 181 IGRRGSLNGILSITGKQGHVAYPHRADNPVPKLMRLIEALIGTPLDEGTDHFDASNLEVV 240

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            +  G  + NVIPA+ +  FNIRFNDLW  +TL+ E+ +RL    +     ++T+ F   
Sbjct: 241 ALSSGTDAYNVIPAKAEARFNIRFNDLWTPQTLELELLARLDSVAEGT---AYTLTFEPC 297

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
            +  F+T   + T L++ +I   TG  P LST+GGTSDARFI  YCPV+EFGLVG+TMH 
Sbjct: 298 NALAFITKPDQFTDLVANAIEKQTGRRPELSTTGGTSDARFISAYCPVVEFGLVGQTMHM 357

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           ++E  S+ D+  L  IY + L+ +F
Sbjct: 358 VDERVSVADIATLETIYTSILEGYF 382


>gi|159042568|ref|YP_001531362.1| succinyl-diaminopimelate desuccinylase [Dinoroseobacter shibae DFL
           12]
 gi|238064732|sp|A8LJT5|DAPE_DINSH RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|157910328|gb|ABV91761.1| succinyl-diaminopimelate desuccinylase [Dinoroseobacter shibae DFL
           12]
          Length = 379

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 155/387 (40%), Positives = 223/387 (57%), Gaps = 10/387 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT D +     LI+CPSVTP++GGA  +L   L   GF+    D      + + NL+AR+
Sbjct: 1   MT-DPVALTADLIRCPSVTPEEGGALSLLEARLSAAGFACTRVD-----RNGIANLFARW 54

Query: 61  GTEA--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
           G +       F GH DVVP G    W + PF A +    +YGRG VDMK ++A F AA  
Sbjct: 55  GEKGHARSFGFNGHTDVVPVGARADWRFDPFGAQVEGDWMYGRGAVDMKSAVAAFAAAAM 114

Query: 119 RFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
            F+      G++ L ITGDEEG A +GT  +L W+  +GE  D C+VGEPTC   +G+ +
Sbjct: 115 DFVADTPPDGAVILAITGDEEGDAKDGTVALLDWMAAQGEAMDVCLVGEPTCPDEMGEMM 174

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGS++      G QGH AYPH  +NP+  L  L+ +L  +  DTG   F P+ + +
Sbjct: 175 KIGRRGSMTFFFEALGVQGHSAYPHRAKNPLPALAKLVDRLAGLELDTGTDHFDPSTLAV 234

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           TT D GNP+ NVIPA  + + NIRFND  + ++L   +R    +               S
Sbjct: 235 TTFDTGNPANNVIPAACRATVNIRFNDAHSSESLTAMVRGIAAEVAAETGIEITDRVSVS 294

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
                F+T   +L+ L++ ++   TG +P+LSTSGGTSDARF++ +CPV+EFGLVG++MH
Sbjct: 295 G--ESFITPPGRLSDLVAAAVETETGRVPVLSTSGGTSDARFVQHHCPVVEFGLVGKSMH 352

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            ++E  ++  +  L  IY   L+++F 
Sbjct: 353 QVDERVAIAQIPQLKAIYTRILRDYFA 379


>gi|153008681|ref|YP_001369896.1| succinyl-diaminopimelate desuccinylase [Ochrobactrum anthropi ATCC
           49188]
 gi|238064762|sp|A6WYL3|DAPE_OCHA4 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|151560569|gb|ABS14067.1| succinyl-diaminopimelate desuccinylase [Ochrobactrum anthropi ATCC
           49188]
          Length = 395

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 212/386 (54%), Positives = 266/386 (68%), Gaps = 8/386 (2%)

Query: 7   EHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPH 66
           ++L  LI+C SVTP +GGA   L   LK +GFS+E   F  ++T  ++NLYAR     PH
Sbjct: 9   DNLAALIRCASVTPAEGGALTALEAMLKPMGFSVERPVFHDEDTPDIENLYARKSGNGPH 68

Query: 67  LMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK- 125
           LMFAGH DVVPPG+   W +PPFSA I +G +YGRG VDMKG +ACF+AAVAR I K+  
Sbjct: 69  LMFAGHTDVVPPGNEGDWKHPPFSAAIEDGVMYGRGAVDMKGGVACFVAAVARHIEKHGS 128

Query: 126 NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGS 185
             GS+S LITGDEEGPAINGT K+L W +++GE WDA IVGEP+  + +GD IKIGRRGS
Sbjct: 129 IKGSVSFLITGDEEGPAINGTVKLLDWAKQRGESWDASIVGEPSNPNALGDAIKIGRRGS 188

Query: 186 LSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGN 245
           LSG IT+HG QGH AYPHL ENP+RG+  L+  L    FD G   F  +N+E+T+IDVGN
Sbjct: 189 LSGTITVHGVQGHAAYPHLAENPVRGITTLVDSLLYPAFDQGTANFQASNLEVTSIDVGN 248

Query: 246 PSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVP-------KLSHTVHFSS 298
            + NVI  +   SFNIRFND W  +TL+ EI +RL K  ++          + + + +  
Sbjct: 249 KATNVIANKATASFNIRFNDTWTAETLQAEIIARLEKAARDNRLRPGRETPIKYELTWRE 308

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
             S VFLT D KL   L+ S+   TG  P LSTSGGTSDARFIKDYCPV+EFGLVG+TMH
Sbjct: 309 HPSHVFLTRDEKLIGTLTDSVEAVTGKRPELSTSGGTSDARFIKDYCPVVEFGLVGQTMH 368

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E  +L DLE LT IYE F+ ++F
Sbjct: 369 MVDERVALADLEGLTQIYERFIADFF 394


>gi|293391369|ref|ZP_06635703.1| succinyl-diaminopimelate desuccinylase [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290951903|gb|EFE02022.1| succinyl-diaminopimelate desuccinylase [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 377

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 154/386 (39%), Positives = 216/386 (55%), Gaps = 13/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +     LI+ PS++P D G   ++   L+ LGF IE   F     +   NL+A+ 
Sbjct: 1   MKEKVVSLAQALIRRPSISPNDEGCQQLIAERLEKLGFQIEWLPF-----NDTLNLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G+  P + FAGH DVVP GD + WTYPPF A I +  +YGRG  DMKGS+A  + A   +
Sbjct: 56  GSGDPVIAFAGHTDVVPTGDESQWTYPPFDAKIVDDMLYGRGAADMKGSLAAMVVAAEEY 115

Query: 121 IP-KYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +     + G+I+LLIT DEE  A +GT +++  +  +GEK   C+VGEP+ + I+GD +K
Sbjct: 116 VKAHRNHQGTIALLITSDEEAAAKDGTVRVVETLMARGEKITYCMVGEPSTSQILGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++G + I G QGHVAYPHL ENPI    P L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITGNLYIQGIQGHVAYPHLAENPIHNAAPFLQELTTYQWDNGNDFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN+R+     +  +K+++   L K         + + ++  
Sbjct: 236 NIHAGTGSNNVIPGELYVQFNLRYCTEVTDGMIKQKVAEMLEKHGLK-----YRIEWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P FLT   KL S L  S+    G  P L T GGTSD RFI      V+EFG +  T+H
Sbjct: 291 GKP-FLTKPGKLVSALVDSLQQIAGITPKLETGGGTSDGRFIALMGAEVVEFGPLNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            +NE  S++DL     IY   L N  
Sbjct: 350 KVNECVSVEDLGKCGQIYHQMLVNLL 375


>gi|118589725|ref|ZP_01547130.1| succinyl-diaminopimelate desuccinylase [Stappia aggregata IAM
           12614]
 gi|118437811|gb|EAV44447.1| succinyl-diaminopimelate desuccinylase [Stappia aggregata IAM
           12614]
          Length = 390

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 196/386 (50%), Positives = 252/386 (65%), Gaps = 4/386 (1%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +     LI+CPSVTP +GGA   L   L  +GF++    FQ ++T  V+NL+A  
Sbjct: 1   MPTSAVAIAQDLIRCPSVTPAEGGALASLEALLGKVGFNVSRVTFQDEDTPDVENLFASI 60

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G+ APH +FAGH DVVP G  + W + PF   I  G ++GRG VDMKG IA F AA   +
Sbjct: 61  GSGAPHFVFAGHTDVVPAGAESDWRHGPFEGAIDNGMLFGRGAVDMKGGIAAFAAAALDY 120

Query: 121 I--PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           +        G+IS LITGDEEGPA+NGT K+L W + +G  +DACIVGEPT    +GD I
Sbjct: 121 VAEKGPDFGGTISFLITGDEEGPAVNGTVKLLQWAKDQGHVFDACIVGEPTNPDKLGDAI 180

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K+GRRGSLSG IT+ G QGHVAYPHL ENPI GL+ LL  L  +  D GN  F P+N+EI
Sbjct: 181 KVGRRGSLSGTITVRGVQGHVAYPHLAENPIPGLVRLLAALDALELDQGNERFQPSNLEI 240

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
            ++DVGNP+ NVIPA+ +  FNIR+ND W  ++LK  I   L      + KL+  + F  
Sbjct: 241 VSVDVGNPAFNVIPARAEARFNIRYNDEWTLESLKARITQTL--EGVELGKLALALEFKR 298

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
             S  FLT D  L   LSK++   TG +P LST GGTSDARFIKDYCPV+EFGLVG+TMH
Sbjct: 299 DSSESFLTRDEVLIEALSKAVEAETGRVPELSTGGGTSDARFIKDYCPVVEFGLVGQTMH 358

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E  +++DL+ L  IY+ FL ++F
Sbjct: 359 KVDECVAVEDLDRLAAIYKKFLLSYF 384


>gi|126724390|ref|ZP_01740233.1| succinyl-diaminopimelate desuccinylase [Rhodobacterales bacterium
           HTCC2150]
 gi|126705554|gb|EBA04644.1| succinyl-diaminopimelate desuccinylase [Rhodobacterales bacterium
           HTCC2150]
          Length = 431

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 165/387 (42%), Positives = 225/387 (58%), Gaps = 9/387 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D ++    L+KC SVTP +GGA   L   L   GF     D          NLYAR+
Sbjct: 52  MASDPVKITETLVKCASVTPTEGGALVYLAELLGAAGFECTRVD-----RGETSNLYARW 106

Query: 61  GTEA--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
           G +       F GH DVVP GD + WT+PPFSA I +G +YGRG  DMK  +A F AA  
Sbjct: 107 GAKGHARSFGFNGHTDVVPVGDEDAWTHPPFSANIVDGWLYGRGSTDMKSGVAAFAAAAI 166

Query: 119 RFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
            F+      G++ L ITGDEEG AI+GT  +L W++ + E   AC+VGEPTC   +G+ +
Sbjct: 167 DFVTDTSPDGAVILAITGDEEGVAIDGTVALLDWMDNQNEAMTACLVGEPTCPDTMGEMM 226

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGS++   T+HG QGH AYPH   NP+  +  L+ +L +   DTG   F  + + +
Sbjct: 227 KIGRRGSMTAYFTVHGIQGHSAYPHRALNPLPPMARLMDRLASHTLDTGTDHFDASTLAV 286

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           TTID GNP+ NVIPA  K + NIRFND      L   ++S++ +               S
Sbjct: 287 TTIDTGNPANNVIPAACKATVNIRFNDAHTSTDLIAWLQSQVDETTTADGVKIEMKTQVS 346

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
                FLT   +L++L+S+S+ + TG  P+ ST+GGTSDARF+K++CPV+EFGLVG+TMH
Sbjct: 347 G--ESFLTPPGELSALISRSVKDVTGVEPVPSTTGGTSDARFVKNHCPVVEFGLVGKTMH 404

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            ++E   +  +E L  IY   L  +F 
Sbjct: 405 QVDERVEVAHIEQLKEIYSKILAGYFA 431


>gi|89052845|ref|YP_508296.1| succinyl-diaminopimelate desuccinylase [Jannaschia sp. CCS1]
 gi|122499698|sp|Q28VJ1|DAPE_JANSC RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|88862394|gb|ABD53271.1| succinyldiaminopimelate desuccinylase [Jannaschia sp. CCS1]
          Length = 388

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 165/384 (42%), Positives = 219/384 (57%), Gaps = 9/384 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT- 62
           D +     LI+C SVTP +GGA  +L   L   GF     D        + NLYAR+GT 
Sbjct: 11  DPVALTADLIRCNSVTPLEGGALVLLEALLSDAGFDCTRVD-----RGGIANLYARWGTR 65

Query: 63  -EAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
                  F GH DVVP GD   WT+PPF A +    +YGRG  DMK  +A F AA   F+
Sbjct: 66  GNGKAFGFNGHTDVVPVGDEAAWTHPPFGAEVDGDWMYGRGATDMKSGVAAFAAAAIDFV 125

Query: 122 PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
                 G+I L ITGDEEG + +GT  +L W+E+ GE+ D CIVGEPTC   +GD +KIG
Sbjct: 126 RDTPPDGAIVLAITGDEEGESTDGTIALLDWMEEVGERIDVCIVGEPTCPEQMGDMMKIG 185

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRG+L+    + GKQGH AY H   NP+  +  L H+L+    D G   F P+   ITTI
Sbjct: 186 RRGALTAFFEVIGKQGHSAYLHKVINPMPAVALLGHRLSTHTLDEGTDHFDPSTCAITTI 245

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
           D GNP+ NVIPA+ +M+ N+RFNDL +  +L   +R    +  ++           S   
Sbjct: 246 DTGNPANNVIPAKTRMTVNLRFNDLHSGDSLTAWLREEADRVAEDTGTTIRMTTKLSG-- 303

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALN 361
             FLT    L+ L+ K++   TG  P LST+GGTSDARF+K++CPV+EFGLVG  MH ++
Sbjct: 304 ESFLTPPGDLSDLVGKAVQAETGRQPTLSTTGGTSDARFVKNHCPVVEFGLVGHRMHQVD 363

Query: 362 ENASLQDLEDLTCIYENFLQNWFI 385
           E   + D+EDL  +Y   L  +F 
Sbjct: 364 ERVRISDIEDLKRVYGRVLTEYFA 387


>gi|144900139|emb|CAM77003.1| Proteobacterial succinyl-diaminopimelate desuccinylase
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 380

 Score =  257 bits (655), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 179/381 (46%), Positives = 244/381 (64%), Gaps = 8/381 (2%)

Query: 3   PDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT 62
            D +    +LIKC SVTP+D GA  +L   L+ LGF     D  T    +++NLYAR G+
Sbjct: 4   SDPVGLTAELIKCASVTPEDAGARDLLAGWLRELGFDCHAVDSATGG-PLIRNLYARRGS 62

Query: 63  EAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIP 122
           +  +  FAGH DVVP G  + W+  PF+ TI   ++YGRG  DMKG+IACF+AAV+RF+ 
Sbjct: 63  DGINFCFAGHTDVVPVG-ASGWSVEPFAGTILNNRLYGRGATDMKGAIACFVAAVSRFVA 121

Query: 123 KYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
             +  GSISLLITGDEEGPA++GT K+L W++ +GE+ D C+VGEPT    +G+ +KIGR
Sbjct: 122 TGQPAGSISLLITGDEEGPAVDGTVKVLDWLKARGERLDMCLVGEPTNPGRLGEMMKIGR 181

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSL+  IT+ G QGH AYPHL +NPI  L+ +L+ LT    D G+  F  + + +TT+D
Sbjct: 182 RGSLNCRITVFGTQGHSAYPHLADNPIPRLLAMLNALTAEPLDHGSPHFQASTLALTTVD 241

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
           VGN + NVIPAQ +  FNIRFNDL +  +L++ IR  L     +                
Sbjct: 242 VGNAATNVIPAQARAGFNIRFNDLHSGNSLEQWIRHTLDSVGGDYECKIEV------SGE 295

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNE 362
            FLT    L+  +++     TG  P LST+GGTSDARFIK++CPV+EFGLV +TMH ++E
Sbjct: 296 SFLTEPGVLSEAVAECARAVTGLTPELSTTGGTSDARFIKNHCPVLEFGLVSQTMHKVDE 355

Query: 363 NASLQDLEDLTCIYENFLQNW 383
           + ++ DLE LT IY   L+  
Sbjct: 356 HVAVDDLEALTQIYLGVLERL 376


>gi|262368838|ref|ZP_06062167.1| succinyl-diaminopimelate desuccinylase [Acinetobacter johnsonii
           SH046]
 gi|262316516|gb|EEY97554.1| succinyl-diaminopimelate desuccinylase [Acinetobacter johnsonii
           SH046]
          Length = 377

 Score =  257 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 157/388 (40%), Positives = 225/388 (57%), Gaps = 14/388 (3%)

Query: 1   MTPDC-LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    L+  +QL++ PSVTP D     I+   LK +GF+IE   F       V NL+AR
Sbjct: 1   MTSSATLDLSLQLLRQPSVTPVDHNCQNIMAERLKKIGFNIESMRFDD-----VDNLWAR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GTE+P   FAGH DVVP G+ + W   PF+  I +GK+YGRG  DMK ++A  + A  R
Sbjct: 56  KGTESPVFCFAGHTDVVPTGNLDAWNSDPFAPEIRDGKLYGRGSADMKTALAAMVVASER 115

Query: 120 FIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ K+ N  GSI+ LIT DEEGP+INGT K++  +E + EK   C+VGEP+  H +GD +
Sbjct: 116 FVAKHPNHKGSIAFLITSDEEGPSINGTVKVIETLEARNEKMKWCLVGEPSSTHQLGDIV 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSL+  +T+ GKQGHVAYPHL  NPI      + +L +  +D GN  F  T+ ++
Sbjct: 176 KNGRRGSLNAVLTVKGKQGHVAYPHLAINPIHMASKAVSELCDTVWDQGNEYFPATSFQV 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I  G  + NV+P  + ++FN R++     + LK  +   L     +   L + + ++ 
Sbjct: 236 SNIQAGTGATNVVPGTMTVTFNFRYSTELTAEELKARVLEIL-----DRHGLVYDIKWTH 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTM 357
              P FLT   +L +    +I N TG    LSTSGGTSD RFI      V+E G++  ++
Sbjct: 291 SGLP-FLTPVGELVNAAKNAIRNVTGVETELSTSGGTSDGRFIAPTGAQVLELGVLNASI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H ++E+ ++ DLE L  IYE  L+    
Sbjct: 350 HQIDEHVNVADLEPLAEIYEQILEGLLA 377


>gi|187477918|ref|YP_785942.1| succinyl-diaminopimelate desuccinylase [Bordetella avium 197N]
 gi|123515305|sp|Q2L2J6|DAPE_BORA1 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|115422504|emb|CAJ49029.1| succinyl-diaminopimelate desuccinylase [Bordetella avium 197N]
          Length = 377

 Score =  257 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 164/384 (42%), Positives = 215/384 (55%), Gaps = 13/384 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L+ +  LI  PSVTPQD     +L   L  +GF  E           V NL+AR GT+ 
Sbjct: 4   VLDLVRDLIARPSVTPQDKDCQQMLAQRLARIGFQCETI-----ARGGVTNLWARRGTQG 58

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P ++FAGH DVVPPG    W   PF  T  +G +YGRG  DMK SIA F+ AV  F+  +
Sbjct: 59  PLVVFAGHTDVVPPGPREKWDSDPFVPTERDGYLYGRGASDMKSSIAAFVVAVEEFVAAH 118

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               GS++ L+T DEEGPAI+GT  +   ++ +GEK D CIVGEPT  H +GD  K GRR
Sbjct: 119 PQHEGSLAFLLTSDEEGPAIDGTVIVCDALQARGEKLDYCIVGEPTSTHELGDVCKNGRR 178

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL G +T+ G QGHVAYPHL  NP+    P L +L  I +D GN  F PT  +I+ ++ 
Sbjct: 179 GSLGGTLTVKGIQGHVAYPHLARNPVHQFAPALAELVGIEWDKGNEYFPPTTFQISNLNS 238

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NV+PA+  + FN RF+     ++LK  +   L +         + + +     P 
Sbjct: 239 GTGATNVVPAEAIVEFNCRFSTASTPESLKARVHEVLDRHGLE-----YDLEWDLGGEP- 292

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMHALNE 362
           FLT    LT  LS +I   TG  P LST+GGTSD RFI   CP VIEFG    T+H +NE
Sbjct: 293 FLTARGSLTDALSSAIQAETGLTPELSTTGGTSDGRFIAKICPQVIEFGPTNATIHKINE 352

Query: 363 NASLQDLEDLTCIYENFLQNWFIT 386
             +L  L+ L  IY   L+N  + 
Sbjct: 353 RVALDCLDPLKNIYRRTLENLLLA 376


>gi|303252743|ref|ZP_07338904.1| succinyl-diaminopimelate desuccinylase [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|302648393|gb|EFL78588.1| succinyl-diaminopimelate desuccinylase [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
          Length = 377

 Score =  257 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 149/388 (38%), Positives = 214/388 (55%), Gaps = 13/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  + +     LI+ PSV+P D G   ++   L  LGF++E   F         NL+A  
Sbjct: 1   MKHNIINLAQDLIRRPSVSPDDQGCQQVIAERLAQLGFTLEWLPFGD-----TLNLWATH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT+ P ++FAGH DVVP GD   W YPPFSA I +G +YGRG  DMKGS+A  + A   F
Sbjct: 56  GTQDPCVVFAGHTDVVPVGDETQWQYPPFSAEIVDGTLYGRGAADMKGSLAALVIAAETF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G I+LLIT DEE  A +GT K++  +  + E     +VGEP+   ++GD IK
Sbjct: 116 VKNNPNHKGKIALLITSDEEAAAKDGTVKVVETLMARQEAVHYAVVGEPSSGKVLGDVIK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++GE+ I G QGHVAYPHL ENP+   +  L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITGELYIEGVQGHVAYPHLAENPVHTSLNFLTELTTYQWDNGNEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN+R+     ++ +K ++   L K         H + ++  
Sbjct: 236 NIKAGTGSNNVIPGELYVQFNLRYCTEVTDEIIKNKVAEMLAKHQLK-----HRISWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P    +  +L     +++ N T   P L TSGGTSD RFI      V+EFG +  T+H
Sbjct: 291 GQPFLAGN-GELVKATVQAVENVTKITPRLDTSGGTSDGRFIALMGAEVVEFGPLNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFIT 386
            +NE  S++DL     +Y + L+    +
Sbjct: 350 KVNECVSVEDLGKCGEVYYHILERLLKS 377


>gi|16272076|ref|NP_438276.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae Rd
           KW20]
 gi|260580594|ref|ZP_05848421.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           RdAW]
 gi|1169224|sp|P44514|DAPE_HAEIN RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|259090306|pdb|3IC1|A Chain A, Crystal Structure Of Zinc-Bound Succinyl-Diaminopimelate
           Desuccinylase From Haemophilus Influenzae
 gi|259090307|pdb|3IC1|B Chain B, Crystal Structure Of Zinc-Bound Succinyl-Diaminopimelate
           Desuccinylase From Haemophilus Influenzae
 gi|266618689|pdb|3ISZ|A Chain A, Crystal Structure Of Mono-Zinc Form Of Succinyl-
           Diaminopimelate Desuccinylase From Haemophilus
           Influenzae
 gi|266618690|pdb|3ISZ|B Chain B, Crystal Structure Of Mono-Zinc Form Of Succinyl-
           Diaminopimelate Desuccinylase From Haemophilus
           Influenzae
 gi|1573051|gb|AAC21776.1| succinyl-diaminopimelate desuccinylase (dapE) [Haemophilus
           influenzae Rd KW20]
 gi|260092656|gb|EEW76592.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           RdAW]
          Length = 377

 Score =  257 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 155/388 (39%), Positives = 215/388 (55%), Gaps = 13/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +     LI+ PS++P D G   I+   L+ LGF IE   F     +   NL+A+ 
Sbjct: 1   MKEKVVSLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPF-----NDTLNLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT  P + FAGH DVVP GD N W+ PPFSA I +G +YGRG  DMKGS+A  I A   +
Sbjct: 56  GTSEPVIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEY 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G+I+LLIT DEE  A +GT  ++  +  + EK   C+VGEP+    +GD +K
Sbjct: 116 VKANPNHKGTIALLITSDEEATAKDGTIHVVETLMARDEKITYCMVGEPSSAKNLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++G + I G QGHVAYPHL ENPI      L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITGNLYIQGIQGHVAYPHLAENPIHKAALFLQELTTYQWDKGNEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIPA++ + FN+R+     ++ +K+++   L K         + + ++  
Sbjct: 236 NIHAGTGSNNVIPAELYIQFNLRYCTEVTDEIIKQKVAEMLEKHNLK-----YRIEWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P FLT   KL   ++ +I  T G  P   T GGTSD RFI      V+EFG +  T+H
Sbjct: 291 GKP-FLTKPGKLLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFIT 386
            +NE  S++DL     IY   L N   +
Sbjct: 350 KVNECVSVEDLGKCGEIYHKMLVNLLDS 377


>gi|114706679|ref|ZP_01439580.1| succinyl-diaminopimelate desuccinylase [Fulvimarina pelagi
           HTCC2506]
 gi|114538071|gb|EAU41194.1| succinyl-diaminopimelate desuccinylase [Fulvimarina pelagi
           HTCC2506]
          Length = 403

 Score =  257 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 200/387 (51%), Positives = 255/387 (65%), Gaps = 8/387 (2%)

Query: 9   LIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLM 68
           L +LI+CPSVTP +GGA   L   L  LGF +    F  K+T  V+NL+A  G   PHL 
Sbjct: 14  LAELIRCPSVTPAEGGALSALGRMLNELGFDVMRPVFSDKDTPDVENLFAARG-AGPHLC 72

Query: 69  FAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK-YKNF 127
           FAGH DVVP GD + W+ PPFSA I +G++YGRG VDMKG IA F+AA+AR   +  ++ 
Sbjct: 73  FAGHTDVVPVGDESEWSLPPFSAEIRDGELYGRGAVDMKGGIAAFVAALARRRTRGERSD 132

Query: 128 GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLS 187
           G +SLLITGDEEGPAINGT K+L WI  +GE+ DAC+VGEPT    +GD +KIGRRGSLS
Sbjct: 133 GRVSLLITGDEEGPAINGTIKLLDWIAARGERLDACLVGEPTNPETLGDMVKIGRRGSLS 192

Query: 188 GEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPS 247
             +T+ G+QGHVAYPHL +NP+R +  +   L    FD G   F PTN+EIT+ID GN +
Sbjct: 193 AHVTVTGRQGHVAYPHLADNPLRTITAIAEALQAKPFDKGTEAFPPTNLEITSIDTGNDA 252

Query: 248 KNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKL----SHTVHFSSPVSPV 303
            NVIP + ++SFN+RF DLW   +LK E+ +R+                 V F+    P 
Sbjct: 253 TNVIPGRARLSFNVRFCDLWTPDSLKAELLARVETARNGSKYRAGKEPAEVSFAWRGRPS 312

Query: 304 --FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALN 361
             FLT    L S LS ++   TG  P LST+GGTSDARFIKD+CPV+EFGLVG+TMH ++
Sbjct: 313 EAFLTRSEDLISALSGAVAAVTGKAPRLSTTGGTSDARFIKDFCPVVEFGLVGQTMHMID 372

Query: 362 ENASLQDLEDLTCIYENFLQNWFITPS 388
           E+ +L DLE LT IY+ F+  WF    
Sbjct: 373 EHVALADLEALTEIYDRFISRWFAANP 399


>gi|307251146|ref|ZP_07533068.1| Succinyl-diaminopimelate desuccinylase [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|306856812|gb|EFM88946.1| Succinyl-diaminopimelate desuccinylase [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
          Length = 382

 Score =  256 bits (654), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 149/388 (38%), Positives = 215/388 (55%), Gaps = 13/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  + +     LI+ PSV+P D G   ++   L  LGF++E   F         NL+A  
Sbjct: 6   MKHNIINLAQDLIRRPSVSPADQGCQQVIAERLAQLGFTLEWLPFGD-----TLNLWATH 60

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT+ P ++FAGH DVVP GD   W YPPFSA I +G +YGRG  DMKGS+A  + A   F
Sbjct: 61  GTQDPCVVFAGHTDVVPVGDETQWQYPPFSAEIVDGTLYGRGAADMKGSLAALVIAAETF 120

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G I+LLIT DEE  A +GT K++  +  + E     +VGEP+   ++GD IK
Sbjct: 121 VKNNPNHKGKIALLITSDEEAAAKDGTVKVVETLMARQEAVHYAVVGEPSSGKVLGDVIK 180

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++GE+ I G QGHVAYPHL ENP+   +  L +LT   +D GN  F PT+++I 
Sbjct: 181 NGRRGSITGELYIEGVQGHVAYPHLAENPVHTSLNFLTELTTYQWDNGNEFFPPTSLQIA 240

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN+R+    +++ +K ++   L K         H + ++  
Sbjct: 241 NIKAGTGSNNVIPGELYVQFNLRYCTEVSDEIIKNKVAEMLAKHQLK-----HRISWNLS 295

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P    +  +L     +++ N T   P L TSGGTSD RFI      V+EFG +  T+H
Sbjct: 296 GKPFLAGN-GELVKAAVQAVENVTKITPRLDTSGGTSDGRFIALMGAEVVEFGPLNATIH 354

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFIT 386
            +NE  S++DL     +Y   L++   +
Sbjct: 355 KVNECVSVEDLGKCGEVYYKILEHLLKS 382


>gi|33596610|ref|NP_884253.1| succinyl-diaminopimelate desuccinylase [Bordetella parapertussis
           12822]
 gi|81427183|sp|Q7W8Y3|DAPE_BORPA RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|33573311|emb|CAE37294.1| succinyl-diaminopimelate desuccinylase [Bordetella parapertussis]
          Length = 379

 Score =  256 bits (654), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 161/389 (41%), Positives = 208/389 (53%), Gaps = 14/389 (3%)

Query: 1   MT-PDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    L+ +  LI  PSVTP D     +L   L+ +GF  E           V NL+AR
Sbjct: 1   MTASAVLDLVKDLIARPSVTPDDVDCQMLLAQRLERIGFQCETI-----ARGGVTNLWAR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            G  AP  +FAGH DVVPPG  + W   PF  T  +G +YGRG  DMK SIA F+ A   
Sbjct: 56  RGAGAPLTVFAGHTDVVPPGPRDKWDSDPFVPTERDGFLYGRGAADMKSSIAAFVVAAEE 115

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+  +  + GSI+LLIT DEEGPA++GT  +   + ++GE+ D CIVGEPT    +GD  
Sbjct: 116 FVAAHPEHPGSIALLITSDEEGPAVDGTVIVCDELRQRGEQLDYCIVGEPTSTEALGDVC 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG + + G QGHVAYPHL  NP+  L P L +L  I +D GN  F PT  ++
Sbjct: 176 KNGRRGSLSGRLLVKGVQGHVAYPHLARNPVHQLAPALTELVAIEWDQGNEYFPPTTFQV 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + +  G  + NV+P +    FN RF+       LK  +   L +         + + +  
Sbjct: 236 SNLHAGTGATNVVPGEAVALFNFRFSTASTPDQLKARVHEVLDRHGLE-----YQLDWEL 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTM 357
              P FLT    LT  L  +I   TG    LST+GGTSD RFI   CP VIEFG    T+
Sbjct: 291 GGEP-FLTPRGSLTDALVSAIQAETGLQAELSTTGGTSDGRFIARICPQVIEFGPCNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFIT 386
           H +NE   L  L  L  IY   L+N  + 
Sbjct: 350 HKVNERIELSSLAPLKNIYRRTLENLLLA 378


>gi|262371776|ref|ZP_06065055.1| succinyl-diaminopimelate desuccinylase [Acinetobacter junii SH205]
 gi|262311801|gb|EEY92886.1| succinyl-diaminopimelate desuccinylase [Acinetobacter junii SH205]
          Length = 378

 Score =  256 bits (654), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 162/384 (42%), Positives = 229/384 (59%), Gaps = 13/384 (3%)

Query: 3   PDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT 62
            D LE  +QL++ PSVTP D     I+ + L+  GF IE   F+      V NL+AR G 
Sbjct: 5   SDTLELSLQLLRQPSVTPVDHDCQKIMADRLEKAGFKIENMRFED-----VDNLWARRGR 59

Query: 63  EAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI- 121
           E P   FAGH DVVP G  + W   PF  +I +GK+YGRG  DMK ++A  + A  RF+ 
Sbjct: 60  EQPVFCFAGHTDVVPTGHLDAWNSDPFLPSIRDGKLYGRGSADMKTALAAMVVASERFVA 119

Query: 122 PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
              K+ GSI+ LIT DEEGP+INGT K++  +E + EK   C+VGEP+  H +GD +K G
Sbjct: 120 KHPKHKGSIAFLITSDEEGPSINGTVKVVETLEARNEKMTWCLVGEPSSTHQLGDIVKNG 179

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSL+G +TIHGKQGHVAYPHL +NPI      +++L    +D GN  F  T+ +I+ I
Sbjct: 180 RRGSLNGVLTIHGKQGHVAYPHLAQNPIHLASKAINELCETVWDNGNEYFPATSFQISNI 239

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
             G  + NV+P  +K++FN R++     + LK+ +   L K      +L++ + ++    
Sbjct: 240 HAGTGATNVVPGTLKVTFNFRYSTEVTAEILKQRVIETLDK-----HQLTYDIQWTLSGL 294

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHAL 360
           P FLT   +L +    +I N TG    LSTSGGTSD RFI      V+E G++  T+H +
Sbjct: 295 P-FLTPVGELVNAAKTAIKNVTGIETELSTSGGTSDGRFIAPTGAQVLELGVLNATIHQI 353

Query: 361 NENASLQDLEDLTCIYENFLQNWF 384
           NE+ ++ +L+ LT IYE  L+N  
Sbjct: 354 NEHVNVDELDPLTDIYEQILENLL 377


>gi|197103845|ref|YP_002129222.1| succinyl-diaminopimelate desuccinylase [Phenylobacterium zucineum
           HLK1]
 gi|238064768|sp|B4RDU4|DAPE_PHEZH RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|196477265|gb|ACG76793.1| succinyl-diaminopimelate desuccinylase [Phenylobacterium zucineum
           HLK1]
          Length = 380

 Score =  256 bits (654), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 170/382 (44%), Positives = 225/382 (58%), Gaps = 7/382 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +E   +LI+ PSVTP D GA  ++  TL  LGF+     F       ++NLYAR+GT 
Sbjct: 6   DAVELSRELIRKPSVTPADEGAMDVVERTLAGLGFACRRMRFGE-----IENLYARYGTA 60

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            P+L FAGH DVVP GD   W+   F+A + +G + GRG VDMK +IA F AA A  I  
Sbjct: 61  RPNLCFAGHTDVVPVGDAAAWSKDAFAADVVDGVLIGRGAVDMKSAIAAFAAAAAEAIAA 120

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
            +  GS+S LITGDEEG A +GTKK++  +  +GE  D C+VGEPT     GD +K+GRR
Sbjct: 121 GRVTGSVSFLITGDEEGVATHGTKKVVEALLAEGEAIDHCVVGEPTSAESFGDMVKVGRR 180

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++ EI + G QGHVAYPH   NP+  L+ LL  L +   D G   F P+N+E+T IDV
Sbjct: 181 GSINAEILVEGIQGHVAYPHRAANPVPVLVRLLAALQDRALDEGYPEFQPSNLEVTMIDV 240

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
            N + NVIP   K   NIRFN     + L + I +   K   +  K   TV         
Sbjct: 241 PNTATNVIPGTAKARLNIRFNPNHTGQALADWIAAEARKA-ADGFKGKVTVTPQISGEA- 298

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           FLT     T L++ ++ + TG  P LSTSGGTSDARFI+  CPV+E GLVGRTMH ++E 
Sbjct: 299 FLTERGPFTELVAAAVKDVTGAEPELSTSGGTSDARFIRALCPVVEVGLVGRTMHQVDER 358

Query: 364 ASLQDLEDLTCIYENFLQNWFI 385
           A + ++  L  +Y   +  +F 
Sbjct: 359 APVDEIRRLQAVYAAIIARYFA 380


>gi|145633690|ref|ZP_01789416.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           3655]
 gi|145635499|ref|ZP_01791199.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           PittAA]
 gi|229845494|ref|ZP_04465623.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           6P18H1]
 gi|144985450|gb|EDJ92271.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           3655]
 gi|145267264|gb|EDK07268.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           PittAA]
 gi|229811597|gb|EEP47297.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           6P18H1]
          Length = 377

 Score =  256 bits (654), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 156/388 (40%), Positives = 218/388 (56%), Gaps = 13/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +     LI+ PS++P D G   I+   L+ LGF IE   F     +   NL+A+ 
Sbjct: 1   MKEKVISLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPF-----NDTLNLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT  P + FAGH DVVP GD N W+ PPFSA I +G +YGRG  DMKGS+A  I A   +
Sbjct: 56  GTGEPVIAFAGHTDVVPTGDENQWSSPPFSADIIDGMLYGRGAADMKGSLAAMIVAAEEY 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G+I+LLIT DEE  A +GT +++  +  + EK   C+VGEP+    +GD +K
Sbjct: 116 VKANPNHKGTIALLITSDEEAAAKDGTVRVVETLMARDEKITYCMVGEPSSAKNLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++G + I G QGHVAYPHL ENPI    P L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITGNLYIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDKGNEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN+R+     ++ +K+++   L K         + + ++  
Sbjct: 236 NIHAGTGSNNVIPGELYIQFNLRYCTEVTDEIIKQKVAEMLEKHNLK-----YRIEWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P FLT   KL   ++ +I  TTG +P   T GGTSD RFI      V+EFG +  T+H
Sbjct: 291 GKP-FLTKPGKLLGSITSAIEETTGIMPKAETGGGTSDGRFIALMGAEVVEFGPLNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFIT 386
            +NE  S++DL     IY   L N   +
Sbjct: 350 KVNECVSVEDLGKCGEIYHKMLVNLLDS 377


>gi|254511423|ref|ZP_05123490.1| succinyl-diaminopimelate desuccinylase [Rhodobacteraceae bacterium
           KLH11]
 gi|221535134|gb|EEE38122.1| succinyl-diaminopimelate desuccinylase [Rhodobacteraceae bacterium
           KLH11]
          Length = 379

 Score =  256 bits (654), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 162/387 (41%), Positives = 223/387 (57%), Gaps = 10/387 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT D ++    LI+CPSVTP++GGA  +L   L   GF     D        V NL+AR+
Sbjct: 1   MT-DPVKLTADLIRCPSVTPEEGGALVLLQRVLGEAGFECTRVD-----RGGVCNLFARW 54

Query: 61  GTEA--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
           G +       F GH DVVP GD   WT  PF A   +G +YGRG  DMK  +A F AA  
Sbjct: 55  GQKGHPRSFGFNGHTDVVPIGDEAAWTMRPFGAETRDGVMYGRGTTDMKSGVAAFAAAAI 114

Query: 119 RFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
            F+      G++ L ITGDEEG A++GT  +L  ++   E+   C+VGEPTC   +G+ +
Sbjct: 115 DFVRDTPPDGAVILTITGDEEGDALHGTVALLDHMDNADERMSVCLVGEPTCPDKMGEMM 174

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGS++   T+ G QGH AYPH  +NP+  +  L+ +L +   D G+  F  + + +
Sbjct: 175 KIGRRGSMTAWFTVVGVQGHSAYPHRAKNPLPAMARLMDRLASHELDQGSDHFDASTLAV 234

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
            TID GN + NVIPAQ   + NIRFNDL +  +L + +R    +  Q       T    S
Sbjct: 235 VTIDTGNAATNVIPAQCVGTVNIRFNDLHSGASLSDWLRKAADQVAQEYGVEVDTKIKIS 294

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
                FLT    L+ L+S+++ N TG  P LST+GGTSDARFIK++CPV+EFGLVGRTMH
Sbjct: 295 G--ESFLTPPGPLSDLVSQAVANETGVTPELSTTGGTSDARFIKNHCPVVEFGLVGRTMH 352

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            ++E   ++ +  L  IY   L ++F 
Sbjct: 353 QVDECVEVEQIRQLKAIYTRILTDYFA 379


>gi|315633832|ref|ZP_07889121.1| succinyl-diaminopimelate desuccinylase [Aggregatibacter segnis ATCC
           33393]
 gi|315477082|gb|EFU67825.1| succinyl-diaminopimelate desuccinylase [Aggregatibacter segnis ATCC
           33393]
          Length = 377

 Score =  256 bits (653), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 159/386 (41%), Positives = 219/386 (56%), Gaps = 13/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    ++    LI+ PS++P D G   ++   L+ LGF IE   F     +   NL+A+ 
Sbjct: 1   MKHHIIQLSQSLIRRPSISPNDEGCQQLIAERLEKLGFHIEWMPF-----NDTLNLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G+  P + FAGH DVVP GD + WTYPPFSA I +G +YGRG  DMKGS+A  I AV  +
Sbjct: 56  GSGEPVIAFAGHTDVVPTGDESQWTYPPFSAEIVDGMLYGRGAADMKGSLAAMIVAVEEY 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G+I+LLIT DEE  A +GT +++  +  +GEK   C+VGEP+ + I+GD +K
Sbjct: 116 VKANPNHEGTIALLITSDEEATAKDGTVRVVESLMARGEKITYCMVGEPSSSKILGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++G + I G QGHVAYPHL ENPI    P L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITGNLYIQGVQGHVAYPHLAENPIHKAAPFLQELTTYQWDNGNEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN+R+     ++ +K+++   L K             ++  
Sbjct: 236 NIHAGTGSNNVIPGELYVQFNLRYCTEVTDEIIKQKVAEMLEKHGLKYRM-----EWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P FLT   KL   L+ +I  TTG  P   T GGTSD RFI      V+EFG +  T+H
Sbjct: 291 GKP-FLTKPGKLLDALTAAIEQTTGITPQAETGGGTSDGRFIALMGAEVVEFGPLNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            +NE  S+ DL     IY   L N  
Sbjct: 350 KVNECVSVDDLAKCGQIYHQMLVNLL 375


>gi|254465156|ref|ZP_05078567.1| succinyl-diaminopimelate desuccinylase [Rhodobacterales bacterium
           Y4I]
 gi|206686064|gb|EDZ46546.1| succinyl-diaminopimelate desuccinylase [Rhodobacterales bacterium
           Y4I]
          Length = 383

 Score =  256 bits (653), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 158/380 (41%), Positives = 217/380 (57%), Gaps = 9/380 (2%)

Query: 8   HLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA--P 65
               LI+CPSVTP++GGA  +L   L   GF     D        V NL+AR+G +    
Sbjct: 9   LTADLIRCPSVTPEEGGALVLLEQLLSAAGFDCTRTD-----RGEVSNLFARWGAKGHTK 63

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
              F GH DVVP GD   WT PPF A   +G +YGRG  DMK  +A F AA   F+ +  
Sbjct: 64  TFGFNGHTDVVPLGDEAAWTMPPFGAEEKDGFMYGRGATDMKSGVAAFAAAAVDFVKETP 123

Query: 126 NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGS 185
             G+I L ITGDEEG A +GT  +L +++++GEK   C+VGEPTC   +G+ IKIGRRGS
Sbjct: 124 PDGAIILTITGDEEGDAEDGTTALLDYMDREGEKMSVCLVGEPTCPDEMGEMIKIGRRGS 183

Query: 186 LSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGN 245
           L+   T+ G QGH AYPH   NP+  +  L+ +L +   D G   F  + + + TID GN
Sbjct: 184 LTAWFTVTGVQGHSAYPHRANNPLNAMARLMDRLASHELDQGTEHFDASTLAVVTIDTGN 243

Query: 246 PSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFL 305
            + NVIPAQ + + NIRFND     +L + ++    K               S     F+
Sbjct: 244 TATNVIPAQSRAAVNIRFNDAHTGASLTDWLQDEADKTAAEFGVEITVQVKISG--ESFI 301

Query: 306 THDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENAS 365
           T    L+ L+++++   TG  P LST+GGTSDARF+K++CPV+EFGLVG+TMH ++E   
Sbjct: 302 TPPGPLSDLVAEAVEAETGRKPELSTTGGTSDARFVKNHCPVVEFGLVGKTMHQVDERVE 361

Query: 366 LQDLEDLTCIYENFLQNWFI 385
           +  +  L  IY   LQ++F 
Sbjct: 362 VAQIHQLKTIYTRILQDYFA 381


>gi|307248947|ref|ZP_07530957.1| Succinyl-diaminopimelate desuccinylase [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|306854558|gb|EFM86751.1| Succinyl-diaminopimelate desuccinylase [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
          Length = 382

 Score =  256 bits (653), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 149/388 (38%), Positives = 214/388 (55%), Gaps = 13/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  + +     LI+ PSV+P D G   ++   L  LGF++E   F         NL+A  
Sbjct: 6   MKHNIINLAQDLIRRPSVSPDDQGCQQVIAERLAQLGFTLEWLPFGD-----TLNLWATH 60

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT+ P ++FAGH DVVP GD   W YPPFSA I +G +YGRG  DMKGS+A  + A   F
Sbjct: 61  GTQDPCVVFAGHTDVVPVGDETQWQYPPFSAEIVDGTLYGRGAADMKGSLAALVIAAETF 120

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G I+LLIT DEE  A +GT K++  +  + E     +VGEP+   ++GD IK
Sbjct: 121 VKNNPNHKGKIALLITSDEEAAAKDGTVKVVETLMARQEAVHYAVVGEPSSGKVLGDVIK 180

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++GE+ I G QGHVAYPHL ENP+   +  L +LT   +D GN  F PT+++I 
Sbjct: 181 NGRRGSITGELYIEGVQGHVAYPHLAENPVHTSLNFLTELTTYQWDNGNEFFPPTSLQIA 240

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN+R+     ++ +K ++   L K         H + ++  
Sbjct: 241 NIKAGTGSNNVIPGELYVQFNLRYCTEVTDEIIKNKVAEMLAKHQLK-----HRISWNLS 295

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P    +  +L     +++ N T   P L TSGGTSD RFI      V+EFG +  T+H
Sbjct: 296 GQPFLAGN-GELVKATVQAVENVTKITPRLDTSGGTSDGRFIALMGAEVVEFGPLNATIH 354

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFIT 386
            +NE  S++DL     +Y + L+    +
Sbjct: 355 KVNECVSVEDLGKCGEVYYHILERLLKS 382


>gi|237746594|ref|ZP_04577074.1| succinyl-diaminopimelate desuccinylase [Oxalobacter formigenes
           HOxBLS]
 gi|229377945|gb|EEO28036.1| succinyl-diaminopimelate desuccinylase [Oxalobacter formigenes
           HOxBLS]
          Length = 375

 Score =  256 bits (653), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 158/387 (40%), Positives = 218/387 (56%), Gaps = 14/387 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT   L     LI  PSVTP DG    +L   L+ LGF  E        ++ V NL+AR 
Sbjct: 1   MTS-TLALASALIAQPSVTPADGECQNLLKAQLEPLGFECETIV-----SNGVTNLWARH 54

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G+ +P L+FAGH DVVP G    WT  PF  T  +G++YGRG  DMK  +A    A   F
Sbjct: 55  GSASPLLVFAGHTDVVPSGPIEKWTSDPFVPTERDGRLYGRGAADMKTPVAAMTVAARDF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           I  + ++ GSI  +IT DEEG A +GT  ++  +E++  + D CIVGEP+    +GDTIK
Sbjct: 115 IHAHPDYTGSIGFIITSDEEGIATDGTDIVVKKLEERDIRPDYCIVGEPSSLKKLGDTIK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL G++T+ GKQGH+AYP    NPI    P L +L    +D GN  + PT+ +++
Sbjct: 175 NGRRGSLCGQLTVFGKQGHIAYPKRAANPIHLAAPALAELAAEVWDEGNEYYEPTSWQMS 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  + NVIP ++ + FN RF        LK+ + + L     +     + + ++  
Sbjct: 235 NIHAGTGANNVIPGELFVEFNFRFCTASTVDGLKKRVHAIL-----DRHGFQYRLDWNYS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMH 358
             P FLT    L   LS++I   TG  P LST+GGTSD RFI   CP V+EFG V  ++H
Sbjct: 290 GVP-FLTPRGSLCDALSRAIKAETGVTPELSTTGGTSDGRFIARICPQVVEFGPVTESIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            ++EN  + D+E LT IY   L+N F+
Sbjct: 349 QIDENILIADIEPLTAIYRKTLENLFL 375


>gi|299132599|ref|ZP_07025794.1| succinyl-diaminopimelate desuccinylase [Afipia sp. 1NLS2]
 gi|298592736|gb|EFI52936.1| succinyl-diaminopimelate desuccinylase [Afipia sp. 1NLS2]
          Length = 384

 Score =  256 bits (653), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 180/386 (46%), Positives = 233/386 (60%), Gaps = 5/386 (1%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT   L+    L++CPSVTP D GA  +L   LK  GF      F         NLYAR 
Sbjct: 1   MTK-ALDVARDLLRCPSVTPADAGALGVLEKLLKDAGFETHRLTFTEPGADDTDNLYARI 59

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT APH+ FAGH DVVPPGD   W++  F+  +    +YGRG VDMKG+IAC +AAV  +
Sbjct: 60  GTAAPHITFAGHTDVVPPGDDKAWSHDAFAGDVDGDVLYGRGAVDMKGAIACSVAAVLDY 119

Query: 121 IPKY--KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           +     +  GSIS LITGDEEGPA+NGT K+L W  K+GEK+D C++GEP+  + +GD I
Sbjct: 120 LQANGGQPKGSISFLITGDEEGPAVNGTVKLLDWAAKRGEKFDHCVLGEPSNVNALGDCI 179

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K+GRRGSLSG + + GKQGHVAYP    NP+  +  L+  L     D G   F P+N+E 
Sbjct: 180 KVGRRGSLSGTLIVEGKQGHVAYPDRAHNPLPDIAALVSALNADPLDHGTDHFPPSNLEF 239

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
            +ID GNP+ NVIPAQ +  FNIR ND   + +L+  I  R+ K   +    +  V +  
Sbjct: 240 LSIDTGNPAWNVIPAQARARFNIRHNDYRTQDSLRALIEGRVEKL--SGNHTTARVEWEP 297

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
             +  FLT     T L+  +I   T   P L T GGTSDARFI  YCPV+EFGLVG+TMH
Sbjct: 298 SNADAFLTQPGPFTDLVVAAIEEVTKRRPKLDTGGGTSDARFIVHYCPVLEFGLVGQTMH 357

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E   + D+E LT IY + L  +F
Sbjct: 358 QIDERTPVADIEALTKIYRSVLDRYF 383


>gi|149908926|ref|ZP_01897585.1| succinyl-diaminopimelate desuccinylase [Moritella sp. PE36]
 gi|149807937|gb|EDM67880.1| succinyl-diaminopimelate desuccinylase [Moritella sp. PE36]
          Length = 378

 Score =  255 bits (652), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 155/383 (40%), Positives = 212/383 (55%), Gaps = 13/383 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L+    L+   SVTP+D G   +++  L+ LGF+IE   F+        NL+AR GT A
Sbjct: 6   VLQLAKDLLSRKSVTPEDAGCQQMIIERLEGLGFTIETMVFED-----TTNLWARRGTAA 60

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P   FAGH DVVP G    W   PF  T+ +G ++GRG  DMKGSIA F+ AV  F+   
Sbjct: 61  PVFCFAGHTDVVPVGKIEDWDTDPFVPTVIDGYLHGRGAADMKGSIASFLVAVENFVNDN 120

Query: 125 K-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
             + GSI+LLIT DEEGP INGT +++  +E + EK D CIVGEP+  + +GD +K GRR
Sbjct: 121 PNHQGSIALLITSDEEGPFINGTTRVIDTLEARNEKIDWCIVGEPSSTNKVGDIVKNGRR 180

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL+G+I + G QGHVAYPHL +NPI  L P L +L+ + +D GN  F  T ++IT I  
Sbjct: 181 GSLTGDIVVKGIQGHVAYPHLADNPIHKLAPALTELSQVVWDQGNEYFPATTLQITDIRS 240

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + N++P +    FN+R++       +K  I     K   N     + + +     P 
Sbjct: 241 GAGASNIVPGEATCQFNLRYSTELTADLIKYRIEGIFAKHGLN-----YEISWIHSGQPF 295

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
                  L + ++ SI +  G    LSTSGGTSD RFI      V+E G V  T+H +NE
Sbjct: 296 LTEPGN-LLNAITDSIESVCGYPSELSTSGGTSDGRFIAPTGAQVVELGPVNATIHKVNE 354

Query: 363 NASLQDLEDLTCIYENFLQNWFI 385
              + D+E L  IYE  L     
Sbjct: 355 CVKIADIEQLAEIYEQTLVKLLA 377


>gi|32034256|ref|ZP_00134467.1| COG0624: Acetylornithine deacetylase/Succinyl-diaminopimelate
           desuccinylase and related deacylases [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126209335|ref|YP_001054560.1| succinyl-diaminopimelate desuccinylase [Actinobacillus
           pleuropneumoniae L20]
 gi|190151230|ref|YP_001969755.1| succinyl-diaminopimelate desuccinylase [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|238055196|sp|A3N3G9|DAPE_ACTP2 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238055197|sp|B3H2U3|DAPE_ACTP7 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|126098127|gb|ABN74955.1| succinyl-diaminopimelate desuccinylase [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
 gi|189916361|gb|ACE62613.1| succinyl-diaminopimelate desuccinylase [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
          Length = 377

 Score =  255 bits (652), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 149/388 (38%), Positives = 213/388 (54%), Gaps = 13/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  + +     LI+ PSV+P D G   ++   L  LGF++E   F         NL+A  
Sbjct: 1   MKHNIINLAQDLIRRPSVSPDDQGCQQVIAERLAQLGFTLEWLPFGD-----TLNLWATH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT+ P ++FAGH DVVP GD   W YPPFSA I +G +YGRG  DMKGS+A  + A   F
Sbjct: 56  GTQDPCVVFAGHTDVVPVGDETQWQYPPFSAEIVDGTLYGRGAADMKGSLAALVIAAETF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G I+LLIT DEE  A  GT K++  +  + E     +VGEP+   ++GD IK
Sbjct: 116 VKNNPNHKGKIALLITSDEEAAAKAGTVKVVETLMARQEAVHYAVVGEPSSGKVLGDVIK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++GE+ I G QGHVAYPHL ENP+   +  L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITGELYIEGVQGHVAYPHLAENPVHTSLNFLTELTTYQWDNGNEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN+R+     ++ +K ++   L K         H + ++  
Sbjct: 236 NIKAGTGSNNVIPGELYVQFNLRYCTEVTDEIIKNKVAEMLAKHQLK-----HRISWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P    +  +L     +++ N T   P L TSGGTSD RFI      V+EFG +  T+H
Sbjct: 291 GQPFLAGN-GELVKATVQAVENVTKITPRLDTSGGTSDGRFIALMGAEVVEFGPLNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFIT 386
            +NE  S++DL     +Y + L+    +
Sbjct: 350 KVNECVSVEDLGKCGEVYYHILERLLKS 377


>gi|332283977|ref|YP_004415888.1| succinyl-diaminopimelate desuccinylase [Pusillimonas sp. T7-7]
 gi|330427930|gb|AEC19264.1| succinyl-diaminopimelate desuccinylase [Pusillimonas sp. T7-7]
          Length = 378

 Score =  255 bits (652), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 168/382 (43%), Positives = 225/382 (58%), Gaps = 13/382 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L+   +LI  PSVTP D G    L + L   GF+ E   F       V NL+AR GT A
Sbjct: 6   TLQLAKELISRPSVTPDDLGCQQALASRLTAAGFNCETLAFGD-----VVNLWARRGTAA 60

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P L+FAGH DVVP G  + W   PF+ T   G +YGRG  DMK SIA F+ AV  F+  +
Sbjct: 61  PLLVFAGHTDVVPTGPLDRWDSDPFTPTERGGNLYGRGAADMKSSIAAFMVAVEEFVAAH 120

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               GSI+LLIT DEEGP+++GT K+   + ++GE+ D CIVGEPT    +GDT+K GRR
Sbjct: 121 PQHSGSIALLITSDEEGPSVDGTVKVCQALAQRGEQLDYCIVGEPTSVDTLGDTVKNGRR 180

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSLSG++TI GKQGHVAYPHL  NPI  L P L +LT   +D GN  F  T  +++ +  
Sbjct: 181 GSLSGKLTIKGKQGHVAYPHLARNPIHLLGPALVELTAEQWDEGNEYFPATTFQVSNLHA 240

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NV+P    + FN RF+      TLK  + + L K   +     + + ++    P 
Sbjct: 241 GTGATNVVPGAAVLDFNFRFSTASTPDTLKARVAAILHKHKLD-----YDLDWTQGGEP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMHALNE 362
           FLT   +L++ +S++I + TG I  LST+GGTSD RFI   CP VIEFG +  ++H +NE
Sbjct: 295 FLTPKGELSTAMSQAILDETGVITQLSTTGGTSDGRFIAKICPQVIEFGPINASIHQVNE 354

Query: 363 NASLQDLEDLTCIYENFLQNWF 384
           +  L  LE L  IY   L++  
Sbjct: 355 HVRLDTLEPLKNIYRRTLEHLL 376


>gi|119946093|ref|YP_943773.1| succinyl-diaminopimelate desuccinylase [Psychromonas ingrahamii 37]
 gi|238064780|sp|A1SXF9|DAPE_PSYIN RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|119864697|gb|ABM04174.1| succinyldiaminopimelate desuccinylase [Psychromonas ingrahamii 37]
          Length = 377

 Score =  255 bits (652), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 159/382 (41%), Positives = 223/382 (58%), Gaps = 13/382 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L  L  LI   S+TP D G   +L++ L+ LGF  E   F         NL+AR GTE 
Sbjct: 6   VLALLKDLISRRSITPSDEGCQQLLISRLEKLGFECEVMIFAD-----TTNLWARRGTEK 60

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIP-K 123
           P   FAGH DVVP G   +WTYPPF  T+ +G ++GRG  DMK  IA FI A+ +FI   
Sbjct: 61  PLFCFAGHTDVVPTGPEENWTYPPFEPTVVDGFLFGRGAADMKSGIAAFIIALEQFIKAH 120

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
             + GSI+LLIT DEEGP INGT +++  +E + EK D CIVGEP+    +GDTIK GRR
Sbjct: 121 QDHQGSIALLITSDEEGPFINGTVRVIETLEARNEKIDYCIVGEPSSTEHVGDTIKNGRR 180

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL+ ++TI+G QGHVAYPH+ ENPI   I  L +L+ + +D GN  F PT+ ++T  + 
Sbjct: 181 GSLTADLTINGVQGHVAYPHMVENPIHTCIGPLTELSQMEWDKGNKYFPPTSFQVTNFNA 240

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NV+P + ++ FN R++     + +   + + L K   N     + + ++   SP 
Sbjct: 241 GTGASNVVPGEAQIQFNFRYSTELTAEMIIARVVAILQKHKLN-----YQIKWTYNGSPF 295

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
                  LT+ +S++I+   G    LSTSGGTSDARFI      V+E G   +T+H +NE
Sbjct: 296 ITQPGS-LTNAVSEAIFAVNGLTTELSTSGGTSDARFIAPTGAQVVELGPGNKTIHKVNE 354

Query: 363 NASLQDLEDLTCIYENFLQNWF 384
           +  + DLE+L  I+   L+   
Sbjct: 355 SVKIADLEELVHIHRLTLEKLL 376


>gi|84514593|ref|ZP_01001957.1| succinyl-diaminopimelate desuccinylase [Loktanella vestfoldensis
           SKA53]
 gi|84511644|gb|EAQ08097.1| succinyl-diaminopimelate desuccinylase [Loktanella vestfoldensis
           SKA53]
          Length = 379

 Score =  255 bits (652), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 161/384 (41%), Positives = 221/384 (57%), Gaps = 9/384 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +     L++CPSVTP +GGA  +L + L   GF+    D        V NL+AR+G +
Sbjct: 3   DPVALTADLVRCPSVTPVEGGALVLLEDLLTKGGFTCTRVD-----RGGVSNLFARWGRQ 57

Query: 64  A--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
                  F GH DVVP GD   WT PPF A I +G +YGRG  DMK  +A F AA   F+
Sbjct: 58  GANRTFGFNGHTDVVPLGDEAAWTMPPFGAVIKDGYLYGRGSTDMKSGVAAFAAAALDFV 117

Query: 122 PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
                 G++ L ITGDEEG A++GT  +L W+   GE    C+VGEPTC  ++G+ +KIG
Sbjct: 118 TDTPPDGAVILAITGDEEGDALDGTTALLDWMATNGEAMSVCLVGEPTCPDVMGEAMKIG 177

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSL+   T+ G QGH AYPH  +NP+  +  L+  L +   D G   F P+ + + TI
Sbjct: 178 RRGSLNATFTVTGVQGHSAYPHRAKNPLPAVARLVDILASHALDQGTAHFDPSTLAVVTI 237

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
           D GNP+ NVIPAQ K   NIRFNDL +  +L E ++    +   +           S   
Sbjct: 238 DTGNPATNVIPAQTKAGVNIRFNDLHSGASLTEWMQGIADQVAADFGVRIAMQVKVSG-- 295

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALN 361
             F+T    L+ L+ K++   TG  P+LSTSGGTSDARF++ +CPV+EFGLVG+TMH ++
Sbjct: 296 ESFITPPGPLSDLVGKAVKAETGRDPVLSTSGGTSDARFVQHHCPVVEFGLVGKTMHQVD 355

Query: 362 ENASLQDLEDLTCIYENFLQNWFI 385
           E  ++  +  L  IY   L ++F 
Sbjct: 356 ERVAVDQIVQLKAIYGRILADYFA 379


>gi|209886646|ref|YP_002290503.1| succinyl-diaminopimelate desuccinylase [Oligotropha carboxidovorans
           OM5]
 gi|238064763|sp|B6JJP4|DAPE_OLICO RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|209874842|gb|ACI94638.1| succinyl-diaminopimelate desuccinylase [Oligotropha carboxidovorans
           OM5]
          Length = 384

 Score =  255 bits (651), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 180/382 (47%), Positives = 228/382 (59%), Gaps = 4/382 (1%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L+    L+ CPSVTP D GA  +L   LK  GF      F         NLYAR G   
Sbjct: 4   ALDIARDLLACPSVTPADAGALGVLEKLLKDAGFETYRLTFSEPGADDTDNLYARIGAGH 63

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           PH+ FAGH DVVPPGD   W++  F+AT+  G +YGRG VDMKG+IAC  AAV  ++   
Sbjct: 64  PHITFAGHTDVVPPGDNAAWSHDAFAATVDGGVLYGRGAVDMKGAIACAAAAVLDYLEAN 123

Query: 125 --KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
             K  GSIS LITGDEEGPA+NGT K+L W  K+GEK+D C++GEP+  + +GD IK GR
Sbjct: 124 GGKPKGSISFLITGDEEGPAVNGTVKLLDWAAKRGEKFDHCLLGEPSNVNALGDCIKAGR 183

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSLSG + + GKQGH AYP    NP+  +  L+  L     D G+  F P+N+E  +ID
Sbjct: 184 RGSLSGTLIVEGKQGHAAYPDRAHNPLPEIASLVAALDADPLDQGSDHFPPSNLEFLSID 243

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
            GNP+ NVIPAQ +  FNIR ND   +  L+  I +R+ K   N       + +    + 
Sbjct: 244 TGNPAWNVIPAQARARFNIRHNDCRTQDALRALIEARVEKLTGNRITAR--IEWEPSNAD 301

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNE 362
            FLT     T L+  +I   TG  P L T GGTSDARFI  YCPV+EFGLVG+TMH ++E
Sbjct: 302 AFLTQPGAFTDLVIDAIEEVTGRKPKLDTGGGTSDARFITHYCPVLEFGLVGQTMHQIDE 361

Query: 363 NASLQDLEDLTCIYENFLQNWF 384
              + DL+ LT IY   L  +F
Sbjct: 362 RTPVADLDALTQIYRGVLTRYF 383


>gi|301168760|emb|CBW28351.1| N-succinyl-diaminopimelate deacylase [Haemophilus influenzae 10810]
          Length = 377

 Score =  255 bits (651), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 156/388 (40%), Positives = 217/388 (55%), Gaps = 13/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +     LI+ PS++P D G   I+   L+ LGF IE   F     +   NL+A+ 
Sbjct: 1   MREKVVSLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPF-----NDTLNLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT  P + FAGH DVVP GD N W+ PPFSA I +G +YGRG  DMKGS+A  I A   +
Sbjct: 56  GTSEPVIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEY 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G+I+LLIT DEE  A +GT +++  +  + EK   C+VGEP+    +GD +K
Sbjct: 116 VKTNPNHKGTIALLITSDEEAAAKDGTVRVVETLMARDEKITYCMVGEPSSAKNLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++G + I G QGHVAYPHL ENPI    P L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITGNLYIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDKGNEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIPA++ + FN+R+     ++ +K+++   L K         + + ++  
Sbjct: 236 NIHAGTGSNNVIPAELYIQFNLRYCTEVTDEIIKQKVAEMLEKHNLK-----YRIEWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P FLT   KL   ++ +I  T G  P   T GGTSD RFI      V+EFG +  T+H
Sbjct: 291 GKP-FLTKPGKLLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFIT 386
            +NE  S++DL     IY   L N   +
Sbjct: 350 KVNECVSVEDLGKCGEIYHKMLVNLLDS 377


>gi|68248712|ref|YP_247824.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           86-028NP]
 gi|229847068|ref|ZP_04467174.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           7P49H1]
 gi|81336873|sp|Q4QP83|DAPE_HAEI8 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|68056911|gb|AAX87164.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           86-028NP]
 gi|229810152|gb|EEP45872.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           7P49H1]
          Length = 377

 Score =  255 bits (651), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 156/388 (40%), Positives = 217/388 (55%), Gaps = 13/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +     LI+ PS++P D G   I+   L+ LGF IE   F     +   NL+A+ 
Sbjct: 1   MREKVVSLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPF-----NDTLNLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT  P + FAGH DVVP GD N W+ PPFSA I +G +YGRG  DMKGS+A  I A   +
Sbjct: 56  GTSEPVIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEY 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G+I+LLIT DEE  A +GT +++  +  + EK   C+VGEP+    +GD +K
Sbjct: 116 VKANPNHKGTIALLITSDEEAAAKDGTIRVVETLMARDEKITYCMVGEPSSAKNLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++G + I G QGHVAYPHL ENPI    P L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITGNLYIKGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDKGNEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIPA++ + FN+R+     ++ +K+++   L K         + + ++  
Sbjct: 236 NIHAGTGSNNVIPAELYIQFNLRYCTEVTDEIIKQKVAEMLEKHNLK-----YRIEWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P FLT   KL   ++ +I  T G  P   T GGTSD RFI      V+EFG +  T+H
Sbjct: 291 GKP-FLTKPGKLLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFIT 386
            +NE  S++DL     IY   L N   +
Sbjct: 350 KVNECVSIEDLGKCGEIYHKMLVNLLDS 377


>gi|260429516|ref|ZP_05783493.1| succinyl-diaminopimelate desuccinylase [Citreicella sp. SE45]
 gi|260420139|gb|EEX13392.1| succinyl-diaminopimelate desuccinylase [Citreicella sp. SE45]
          Length = 380

 Score =  255 bits (651), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 164/388 (42%), Positives = 228/388 (58%), Gaps = 10/388 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT D +     LI+CPSVTP+DGGA  +L + L+  GF+    D        + NLYAR+
Sbjct: 1   MT-DPVALTADLIRCPSVTPEDGGALCVLQSLLEGAGFACTRVD-----RGGISNLYARW 54

Query: 61  GTEA--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
           G +       F GH DVVP GD + W+  PF A I +G ++GRG  DMK  +A F AA  
Sbjct: 55  GDKGHARTFGFNGHTDVVPVGDVDAWSADPFGAEIRDGIMFGRGATDMKSGVAAFAAAAV 114

Query: 119 RFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
            F+      G++ L ITGDEEG A +GT  +L W+  +GE+   C+VGEPTC   +G+ +
Sbjct: 115 DFVRDTPPEGAVVLAITGDEEGDAEHGTVALLDWMAAEGERMSVCLVGEPTCPSEMGEMM 174

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGS++   T+ G+QGH AYPH   NP+  +  L+ +L +   D G   F  T + +
Sbjct: 175 KIGRRGSMTAWFTVTGRQGHAAYPHRALNPMPAVARLMDRLASHELDRGTEHFDATTLAV 234

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
            TID GNP+ NVIPAQ + + NIRFND     +L E +R+   K        +  V    
Sbjct: 235 VTIDTGNPATNVIPAQTRAAVNIRFNDAHTGASLSEWLRAEAAKIDSE-FGCTTEVRIKI 293

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
                FLT    L+ L++ ++   TG  P LST+GGTSDARF+KD+CPV+EFGLVG+TMH
Sbjct: 294 SG-ESFLTPPGALSDLIAGAVEAETGRRPELSTTGGTSDARFVKDHCPVVEFGLVGKTMH 352

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFIT 386
            ++EN  +  + +L  IY   L+++F T
Sbjct: 353 QVDENVPVAQIGELKAIYTRILRDYFAT 380


>gi|307264580|ref|ZP_07546163.1| Succinyl-diaminopimelate desuccinylase [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|306870109|gb|EFN01870.1| Succinyl-diaminopimelate desuccinylase [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 382

 Score =  255 bits (651), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 149/388 (38%), Positives = 213/388 (54%), Gaps = 13/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  + +     LI+ PSV+P D G   ++   L  LGF++E   F         NL+A  
Sbjct: 6   MKHNIINLAQDLIRRPSVSPDDQGCQQVIAERLAQLGFTLEWLPFGD-----TLNLWATH 60

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT+ P ++FAGH DVVP GD   W YPPFSA I +G +YGRG  DMKGS+A  + A   F
Sbjct: 61  GTQDPCVVFAGHTDVVPVGDETQWQYPPFSAEIVDGTLYGRGAADMKGSLAALVIAAETF 120

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G I+LLIT DEE  A  GT K++  +  + E     +VGEP+   ++GD IK
Sbjct: 121 VKNNPNHKGKIALLITSDEEAAAKAGTVKVVETLMARQEAVHYAVVGEPSSGKVLGDVIK 180

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++GE+ I G QGHVAYPHL ENP+   +  L +LT   +D GN  F PT+++I 
Sbjct: 181 NGRRGSITGELYIEGVQGHVAYPHLAENPVHTSLNFLTELTTYQWDNGNEFFPPTSLQIA 240

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN+R+     ++ +K ++   L K         H + ++  
Sbjct: 241 NIKAGTGSNNVIPGELYVQFNLRYCTEVTDEIIKNKVAEMLAKHQLK-----HRISWNLS 295

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P    +  +L     +++ N T   P L TSGGTSD RFI      V+EFG +  T+H
Sbjct: 296 GQPFLAGN-GELVKATVQAVENVTKITPRLDTSGGTSDGRFIALMGAEVVEFGPLNATIH 354

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFIT 386
            +NE  S++DL     +Y + L+    +
Sbjct: 355 KVNECVSVEDLGKCGEVYYHILERLLKS 382


>gi|237807902|ref|YP_002892342.1| succinyl-diaminopimelate desuccinylase [Tolumonas auensis DSM 9187]
 gi|259595048|sp|C4LDG0|DAPE_TOLAT RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|237500163|gb|ACQ92756.1| succinyl-diaminopimelate desuccinylase [Tolumonas auensis DSM 9187]
          Length = 380

 Score =  255 bits (651), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 167/388 (43%), Positives = 222/388 (57%), Gaps = 14/388 (3%)

Query: 1   MTPDCL-EHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT   +      LI  PSVTP D G   ++   L  LGF IE   F         NL+AR
Sbjct: 1   MTDSLVLSLAKDLIARPSVTPIDEGCQKMMAEFLAPLGFEIEPMVFHD-----TTNLWAR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT  P   FAGH DVVP G    W  PPF  TI +G +YGRG  DMKGSIA  +AAV R
Sbjct: 56  RGTTGPVFCFAGHTDVVPSGPAEKWHTPPFEPTIIDGMLYGRGAADMKGSIASMMAAVQR 115

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F   Y  + GSI+ LIT DEEGP INGT K++  +E + EK   C+VGEP+  + +GD +
Sbjct: 116 FTTDYPAHQGSIAFLITSDEEGPFINGTPKVIETLEARQEKITWCLVGEPSSTNHVGDVV 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSL+G++TI+G QGHVAYPHL ENP+   IP L++L +  +D GN  F  T+ +I
Sbjct: 176 KNGRRGSLTGDLTIYGIQGHVAYPHLAENPVHLAIPALNELASKQWDQGNEFFPATSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
             I+ G  + NVIP ++++ FN R++    +  +K+++ + L     +   L + + ++ 
Sbjct: 236 ANINSGTGASNVIPGEMQVQFNFRYSTELTDSQIKQQVAAIL-----DNHGLRYELKWTL 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTM 357
              P FLT   KL      +I   TG    LSTSGGTSD RFI      VIE G V  T+
Sbjct: 291 SGQP-FLTGSGKLVEATQNAIKAITGQETELSTSGGTSDGRFIAPTGAQVIELGPVNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H +NE   + DLE L+ IY N +Q   +
Sbjct: 350 HKVNECVRVADLETLSDIYYNMMQQLLV 377


>gi|145642012|ref|ZP_01797584.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           R3021]
 gi|145273283|gb|EDK13157.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           22.4-21]
          Length = 377

 Score =  255 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 155/388 (39%), Positives = 216/388 (55%), Gaps = 13/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +     LI+ PS++P D G   I+   L+ LGF IE   F     +   NL+A+ 
Sbjct: 1   MKEKVVSLAQDLIRRPSISPNDEGCQQIIAEGLEKLGFQIEWMPF-----NDTLNLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT  P + F GH DVVP GD N W+ PPFSA I +G +YGRG  DMKGS+A  I A   +
Sbjct: 56  GTSEPVIAFVGHTDVVPTGDENQWSSPPFSAEIIDGILYGRGAADMKGSLAAMIVAAEEY 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G+I+LLIT DEE  A +GT +++  +  + EK   C+VGEP+    +GD +K
Sbjct: 116 VKANPNHKGTIALLITSDEEAAAKDGTIRVVETLIARDEKITYCMVGEPSSAKNLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++G + I G QGHVAYPHL ENPI    P L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITGNLYIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDKGNEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIPA++ + FN+R+     ++ +K+++   L K         + + ++  
Sbjct: 236 NIHAGTGSNNVIPAELYIQFNLRYCTEVTDEIIKQKMAEMLAKHNLK-----YRIEWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P FLT   KL   ++ +I   TG  P   T GGTSD RFI      V+EFG +  T+H
Sbjct: 291 GKP-FLTKPGKLLDSITSAIEEITGIKPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFIT 386
            +NE  S++DL     IY   L N   +
Sbjct: 350 KVNECVSVEDLGKCGEIYHKMLVNLLDS 377


>gi|238055320|sp|A7IH44|DAPE_XANP2 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 375

 Score =  255 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 178/380 (46%), Positives = 244/380 (64%), Gaps = 8/380 (2%)

Query: 7   EHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPH 66
               +LI+ PSVTP    A  ++   L+  G+ +E   F+T     + NLYAR GT+ P+
Sbjct: 2   ALAAELIRAPSVTPHADDALELVAKRLEAAGYRVERLTFETGGVP-IPNLYARIGTDGPN 60

Query: 67  LMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKN 126
           L FAGH+DVVP GD   W + PF+ T+ +G ++GRG VDMKG++A F    A        
Sbjct: 61  LCFAGHVDVVPEGDATQWHHAPFAGTVEDGVLHGRGAVDMKGAVAAF--LAAALAFGRPQ 118

Query: 127 FGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSL 186
            GS+S LITGDEEGPA++GT K++ W++ +GE  D C++GEPT    +GD  K+GRRGSL
Sbjct: 119 RGSLSFLITGDEEGPALDGTVKVVEWLKARGETIDHCVLGEPTNPDALGDAFKVGRRGSL 178

Query: 187 SGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNP 246
           SG +T+ G QGHVAYPHL +NPI  L+ L+  LT    D G+  F P+N+E+ ++DVGNP
Sbjct: 179 SGILTVKGVQGHVAYPHLADNPIPRLLKLIGDLTAAPLDHGSDFFPPSNLEVVSVDVGNP 238

Query: 247 SKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLT 306
             N+IPAQ    FN+RFNDL++ ++LK EI  RL     +   L++ + F +  S  FLT
Sbjct: 239 VFNLIPAQATARFNVRFNDLFSLESLKSEIIRRL-----DGAGLTYDLAFQTGASQSFLT 293

Query: 307 HDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASL 366
                T L++ ++   TG  P  STSGGTSDARFIKD CPV+EFGLVGRTMH ++E   +
Sbjct: 294 APGPFTDLVASAVEEVTGRRPEPSTSGGTSDARFIKDICPVVEFGLVGRTMHKVDEATPV 353

Query: 367 QDLEDLTCIYENFLQNWFIT 386
           +D+E LT IY   +  +F T
Sbjct: 354 KDIEALTAIYGRIIARYFST 373


>gi|322515391|ref|ZP_08068384.1| succinyl-diaminopimelate desuccinylase [Actinobacillus ureae ATCC
           25976]
 gi|322118573|gb|EFX90803.1| succinyl-diaminopimelate desuccinylase [Actinobacillus ureae ATCC
           25976]
          Length = 377

 Score =  255 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 144/388 (37%), Positives = 214/388 (55%), Gaps = 13/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  + +     LI+ PS++P D G   ++ + L+ LGF++E   F         NL+A+ 
Sbjct: 1   MKNNIINLAQDLIRRPSISPADQGCQQVIADRLQQLGFTLEWLPFGD-----TLNLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G+  P + FAGH DVVP GD   WTYPPF A I +  +YGRG  DMKGS++  + A   F
Sbjct: 56  GSGHPVIAFAGHTDVVPVGDETQWTYPPFEARIVDNMLYGRGAADMKGSLSALVVAAEEF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G+I+LLIT DEE  A +GT K++  +  +GE    C+VGEP+   ++GD IK
Sbjct: 116 VKANPNHVGTIALLITSDEEAAAKDGTVKVVETLMARGEPIHYCVVGEPSSGKVLGDVIK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++G++ I G QGHVAYPHL ENP+   +  L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITGDLYIEGVQGHVAYPHLAENPVHTALNFLTELTTYQWDNGNEFFLPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN+R+     +  +K ++   L K         H + ++  
Sbjct: 236 NIKAGTGSNNVIPGELYVQFNLRYCTSVTDDIIKNKVAEMLAKHQLK-----HRISWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P    +  +L     +++ N T   P L TSGGTSD RFI      ++EFG +  T+H
Sbjct: 291 GKPFLAGN-GQLVKAAVQAVENVTKFTPRLDTSGGTSDGRFIALMGAEIVEFGPLNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFIT 386
            +NE  ++ DL     +Y   L+    +
Sbjct: 350 KVNECVNVDDLGKCGEVYYQILEYLLKS 377


>gi|307246808|ref|ZP_07528874.1| Succinyl-diaminopimelate desuccinylase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307255791|ref|ZP_07537593.1| Succinyl-diaminopimelate desuccinylase [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307260243|ref|ZP_07541951.1| Succinyl-diaminopimelate desuccinylase [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|307262374|ref|ZP_07544020.1| Succinyl-diaminopimelate desuccinylase [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306852279|gb|EFM84518.1| Succinyl-diaminopimelate desuccinylase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306861254|gb|EFM93246.1| Succinyl-diaminopimelate desuccinylase [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306865690|gb|EFM97570.1| Succinyl-diaminopimelate desuccinylase [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306867922|gb|EFM99752.1| Succinyl-diaminopimelate desuccinylase [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 382

 Score =  255 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 149/388 (38%), Positives = 214/388 (55%), Gaps = 13/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  + +     LI+ PSV+P D G   ++   L  LGF++E   F         NL+A  
Sbjct: 6   MKHNIINLAQDLIRRPSVSPADQGCQQVIAERLAQLGFTLEWLPFGD-----TLNLWATH 60

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT+ P ++FAGH DVVP GD   W YPPFSA I +G +YGRG  DMKGS+A  + A   F
Sbjct: 61  GTQDPCVVFAGHTDVVPVGDETQWQYPPFSAEIVDGTLYGRGAADMKGSLAALVIAAETF 120

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G I+LLIT DEE  A +GT K++  +  + E     +VGEP+   ++GD IK
Sbjct: 121 VKNNPNHKGKIALLITSDEEAAAKDGTVKVVETLMARQEAVHYAVVGEPSSGKVLGDVIK 180

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++GE+ I G QGHVAYPHL ENP+   +  L +LT   +D GN  F PT+++I 
Sbjct: 181 NGRRGSITGELYIEGVQGHVAYPHLAENPVHTSLNFLTELTTYQWDNGNEFFPPTSLQIA 240

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN+R+     ++ +K ++   L K         H + ++  
Sbjct: 241 NIKAGTGSNNVIPGELYVQFNLRYCTEVTDEIIKNKVAEMLAKHQLK-----HRISWNLS 295

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P    +  +L     +++ N T   P L TSGGTSD RFI      V+EFG +  T+H
Sbjct: 296 GQPFLAGN-GELVKATVQAVENVTKITPRLDTSGGTSDGRFIALMGAEVVEFGPLNATIH 354

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFIT 386
            +NE  S++DL     +Y + L+    +
Sbjct: 355 KVNECVSVEDLGKCGEVYYHILERLLKS 382


>gi|33592831|ref|NP_880475.1| succinyl-diaminopimelate desuccinylase [Bordetella pertussis Tohama
           I]
 gi|81425091|sp|Q7VXJ5|DAPE_BORPE RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|33572479|emb|CAE42050.1| succinyl-diaminopimelate desuccinylase [Bordetella pertussis Tohama
           I]
 gi|332382244|gb|AEE67091.1| succinyl-diaminopimelate desuccinylase [Bordetella pertussis CS]
          Length = 379

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 161/389 (41%), Positives = 208/389 (53%), Gaps = 14/389 (3%)

Query: 1   MT-PDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    L+ +  LI  PSVTP D     +L   L+ +GF  E           V NL+AR
Sbjct: 1   MTASAVLDLVKDLIARPSVTPDDVDCQMLLAQRLERIGFQCETI-----ARGGVTNLWAR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            G  AP  +FAGH DVVPPG  + W   PF  T  +G +YGRG  DMK SIA F+ A   
Sbjct: 56  RGAGAPLTVFAGHTDVVPPGPRDKWDSDPFVPTERDGFLYGRGAADMKSSIAAFVVAAEE 115

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+  +  + GSI+LLIT DEEGPA++GT  +   + ++GE+ D CIVGEPT    +GD  
Sbjct: 116 FVAVHPEHPGSIALLITSDEEGPAVDGTVIVCDELRQRGEQLDYCIVGEPTSTEALGDVC 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG + + G QGHVAYPHL  NP+  L P L +L  I +D GN  F PT  ++
Sbjct: 176 KNGRRGSLSGRLLVKGVQGHVAYPHLARNPVHQLAPALTELVAIEWDQGNEYFPPTTFQV 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + +  G  + NV+P +    FN RF+       LK  +   L +         + + +  
Sbjct: 236 SNLHAGTGATNVVPGEAVALFNFRFSTASTPGQLKARVHEVLDRHGLE-----YQLDWEL 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTM 357
              P FLT    LT  L  +I   TG    LST+GGTSD RFI   CP VIEFG    T+
Sbjct: 291 GGEP-FLTPRGSLTDALVSAIQAETGLQAELSTTGGTSDGRFIARICPQVIEFGPCNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFIT 386
           H +NE   L  L  L  IY   L+N  + 
Sbjct: 350 HKVNERIELSSLAPLKNIYRRTLENLLLA 378


>gi|33601165|ref|NP_888725.1| succinyl-diaminopimelate desuccinylase [Bordetella bronchiseptica
           RB50]
 gi|81431247|sp|Q7WKC6|DAPE_BORBR RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|33575600|emb|CAE32678.1| succinyl-diaminopimelate desuccinylase [Bordetella bronchiseptica
           RB50]
          Length = 379

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 161/389 (41%), Positives = 208/389 (53%), Gaps = 14/389 (3%)

Query: 1   MT-PDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    L+ +  LI  PSVTP D     +L   L+ +GF  E           V NL+AR
Sbjct: 1   MTASAVLDLVKDLIARPSVTPDDVDCQMLLAQRLERIGFQCETI-----ARGGVTNLWAR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            G  AP  +FAGH DVVPPG  + W   PF  T  +G +YGRG  DMK SIA F+ A   
Sbjct: 56  RGAGAPLTVFAGHTDVVPPGPRDKWDSDPFVPTERDGFLYGRGAADMKSSIAAFVVAAEE 115

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+  +  + GSI+LLIT DEEGPA++GT  +   + ++GE+ D CIVGEPT    +GD  
Sbjct: 116 FVAAHPEHPGSIALLITSDEEGPAVDGTVIVCDELRQRGEQLDYCIVGEPTSTEALGDVC 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG + + G QGHVAYPHL  NP+  L P L +L  I +D GN  F PT  ++
Sbjct: 176 KNGRRGSLSGRLLVKGVQGHVAYPHLARNPVHQLAPALTELVAIEWDQGNEYFPPTTFQV 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + +  G  + NV+P +    FN RF+       LK  +   L +         + + +  
Sbjct: 236 SNLHAGTGATNVVPGEAVALFNFRFSTASTPGQLKARVHEVLDRHGLE-----YQLDWEL 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTM 357
              P FLT    LT  L  +I   TG    LST+GGTSD RFI   CP VIEFG    T+
Sbjct: 291 GGEP-FLTPRGSLTDALVSAIQAETGLQAELSTTGGTSDGRFIARICPQVIEFGPCNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFIT 386
           H +NE   L  L  L  IY   L+N  + 
Sbjct: 350 HKVNERIELSSLAPLKNIYRRTLENLLLA 378


>gi|251792039|ref|YP_003006759.1| succinyl-diaminopimelate desuccinylase [Aggregatibacter aphrophilus
           NJ8700]
 gi|247533426|gb|ACS96672.1| succinyl-diaminopimelate desuccinylase [Aggregatibacter aphrophilus
           NJ8700]
          Length = 377

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 156/386 (40%), Positives = 218/386 (56%), Gaps = 13/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    ++    LI+ PS++P D G   ++   L+ LGF IE   F     +   NL+A+ 
Sbjct: 1   MKQHIIQLSQSLIRRPSISPNDEGCQQLIAERLEKLGFHIEWMPF-----NDTLNLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G+  P + FAGH DVVP GD   WTYPPFSA I +G +YGRG  DMKGS+A  I A   +
Sbjct: 56  GSGEPVIAFAGHTDVVPTGDERQWTYPPFSAEIVDGMLYGRGAADMKGSLAAMIVAAEAY 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G+I+LLIT DEE  A +GT +++  +   GEK   C+VGEP+ +  +GD +K
Sbjct: 116 VKVNPNHAGTIALLITSDEEAAAKDGTVRVVESLMACGEKITYCMVGEPSSSKTLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++G + + G QGHVAYPHL ENPI    P L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITGNLYVQGVQGHVAYPHLAENPIHKAAPFLQELTTYQWDNGNEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN+R+     ++ +K+++   L K         + + ++  
Sbjct: 236 NIHAGTGSNNVIPGELYVQFNLRYCTEVTDEIIKQKVAEMLEKHGLK-----YRIEWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P FLT   KL   L+ +I  TTG  P   T GGTSD RFI      V+EFG +  T+H
Sbjct: 291 GKP-FLTKPGKLLDALTAAIEQTTGITPQAETGGGTSDGRFIALMGAEVVEFGPLNVTIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            +NE  S++DL     IY   L N  
Sbjct: 350 KVNECVSVEDLAKCGQIYHQMLVNLL 375


>gi|254461599|ref|ZP_05075015.1| succinyl-diaminopimelate desuccinylase [Rhodobacterales bacterium
           HTCC2083]
 gi|206678188|gb|EDZ42675.1| succinyl-diaminopimelate desuccinylase [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 381

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 158/388 (40%), Positives = 228/388 (58%), Gaps = 10/388 (2%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           M P D ++    L++CPSVTP++GGA  +L   L   GF     D      + + NL+AR
Sbjct: 1   MQPIDPVKLTADLVRCPSVTPEEGGALILLQKLLDDAGFECSRVD-----RAGISNLFAR 55

Query: 60  FGTEA--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAV 117
           +G +       F GH DVVP GD   W + PFSA I +G +YGRG  DMK  +A F AA 
Sbjct: 56  WGIKGAVKTFGFNGHTDVVPIGDQTAWMHGPFSADIVDGIMYGRGTTDMKAGVAAFAAAA 115

Query: 118 ARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDT 177
             F+      G++ L ITGDEEG A++GT  +L ++E++ E+   C+VGEPTC + +G+ 
Sbjct: 116 IDFVATTPPDGAVILTITGDEEGDALDGTTALLDYMERENERMSVCLVGEPTCPNEMGEM 175

Query: 178 IKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNME 237
           +KIGRRGSL+    + GKQGH AYPH  +NP+  L  L+ +L     D G   F  + + 
Sbjct: 176 MKIGRRGSLTCWFEVTGKQGHSAYPHRAKNPLPALARLMDRLAGHELDQGTDHFDASTLA 235

Query: 238 ITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFS 297
           + TID GNP+ NVIPA  + + NIRFNDL +  +L E ++    K   +   +  T+   
Sbjct: 236 VVTIDTGNPATNVIPANCRATVNIRFNDLHSGASLSEWLQVEADKV-ASEFDMPITLKIK 294

Query: 298 SPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTM 357
                        L+ L++KS+   TG  P +ST+GGTSDARF+K++CPV+EFGLVG+TM
Sbjct: 295 ISGESFITPP-GPLSDLIAKSVEAETGVTPEMSTTGGTSDARFVKNHCPVVEFGLVGKTM 353

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H ++EN  ++ +  L  IY   L+++F 
Sbjct: 354 HQVDENVPIEQIAQLKSIYLRILKDYFA 381


>gi|42520627|ref|NP_966542.1| succinyl-diaminopimelate desuccinylase [Wolbachia endosymbiont of
           Drosophila melanogaster]
 gi|99036071|ref|ZP_01315106.1| hypothetical protein Wendoof_01000052 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
 gi|81652435|sp|Q73GZ0|DAPE_WOLPM RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|42410366|gb|AAS14476.1| succinyl-diaminopimelate desuccinylase [Wolbachia endosymbiont of
           Drosophila melanogaster]
          Length = 398

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 167/385 (43%), Positives = 224/385 (58%), Gaps = 11/385 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D +E   +LI   S+TP+D GA   +    K  GF  E  +F  K    VKNLYA++
Sbjct: 1   MKIDPVELTRKLISFESITPEDSGAIEYIATIFKKSGFDCEILEFGDK----VKNLYAKY 56

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIA-AVAR 119
               P+L FAGH+DVVPPG    W + PF   + +G +YGRG  DMK  +A FIA  V  
Sbjct: 57  INGVPNLCFAGHVDVVPPGQLKDWAFGPFKPEVRDGMLYGRGAADMKSGVAAFIAAMVNL 116

Query: 120 FIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
              K++  GSIS LIT  EE     GTK +L W++ K +K D C+VGEPT +  +GDTIK
Sbjct: 117 IAEKFQFNGSISALITSAEESMEEYGTKAVLEWMKNKQKKIDFCVVGEPTSSEKLGDTIK 176

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGS++ E+  HGKQGHVAYP L +NPI  +I +L ++ N  FD GN  F P++ E+T
Sbjct: 177 IGRRGSVTFELICHGKQGHVAYPDLADNPIYKVISILSKVKNTTFDHGNKYFQPSHCEVT 236

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           TIDVGN + N+IP      FNIR+N+      L + I         +     H+      
Sbjct: 237 TIDVGNNTSNLIPGSATTRFNIRYNNEQTPGGLYKLIDEICSSVTNDYKLSMHSSRDVFL 296

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
            +P   T       ++  +I   T    +LSTSGGTSDA FIKD CPVIEFG++ +T H 
Sbjct: 297 STPDRNT------DIMLDAISKVTNIDAILSTSGGTSDAAFIKDVCPVIEFGIINKTAHQ 350

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           +NE  S+ D+  LT IY+ F++N+F
Sbjct: 351 INECVSVNDIHKLTAIYKEFIENYF 375


>gi|83859288|ref|ZP_00952809.1| succinyl-diaminopimelate desuccinylase [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852735|gb|EAP90588.1| succinyl-diaminopimelate desuccinylase [Oceanicaulis alexandrii
           HTCC2633]
          Length = 388

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 185/384 (48%), Positives = 236/384 (61%), Gaps = 8/384 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +    +LI+ PSVTP D GA  +L   L+ LGF      F+      V NLYAR G  
Sbjct: 9   DPIPLARRLIQAPSVTPADAGALDVLSEALETLGFECTRFKFEE-----VDNLYARLGQT 63

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
           AP   FAGH DVVPPGD   W+  PF A IA+  ++GRG  DMKG+IA  +A VAR +  
Sbjct: 64  APVFCFAGHTDVVPPGDEAAWSRGPFEAEIADDVLWGRGASDMKGAIAAMVAGVARLLQS 123

Query: 124 YKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
                GSI+ LITGDEEGPA+NGTKK+L  + +KGE++D C+VGEPT  H +GDTIK+GR
Sbjct: 124 QGRPAGSIAFLITGDEEGPAVNGTKKLLKAVAEKGERFDHCLVGEPTNPHHLGDTIKVGR 183

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSL+G +T+ G+QGHVAYP   ENPI  LI  L+++T    D G   F P+N+E+TTID
Sbjct: 184 RGSLNGVVTVTGQQGHVAYPEKAENPIPVLIDFLNRITLRTLDEGAPHFQPSNLEVTTID 243

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
           VGN   NVIPA+    FNIRFN       LK  +R + +   +        +  +     
Sbjct: 244 VGNAPHNVIPAKATAKFNIRFNTAQTGDGLKTWLREQAVAA-EQGFFGDIDLDLTVTGDA 302

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNE 362
             LT     T LL  ++ + TG+ P L+T GGTSDARFIKDYCPV EFGLVG TMH ++E
Sbjct: 303 F-LTETGPFTDLLRAAVRDQTGHDPALTTGGGTSDARFIKDYCPVAEFGLVGETMHQVDE 361

Query: 363 NASLQDLEDLTCIYENFLQNWFIT 386
              + D+  L  IY + LQ +F T
Sbjct: 362 RVPVSDVTRLAAIYADVLQRYFKT 385


>gi|91776221|ref|YP_545977.1| succinyl-diaminopimelate desuccinylase [Methylobacillus flagellatus
           KT]
 gi|123078811|sp|Q1H051|DAPE_METFK RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|91710208|gb|ABE50136.1| succinyldiaminopimelate desuccinylase [Methylobacillus flagellatus
           KT]
          Length = 375

 Score =  254 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 162/382 (42%), Positives = 223/382 (58%), Gaps = 13/382 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            LE    LI   SVTP D G   +L++ L+ LGFSIE   F       V N YAR G   
Sbjct: 4   TLELAKDLIARKSVTPDDAGCQELLISRLEPLGFSIERLRFGD-----VDNFYARRGNTG 58

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P L+FAGH DVVP G    W  PPF+ T+ +G +YGRG  DMK S+A FI A+  F+  +
Sbjct: 59  PLLVFAGHTDVVPTGPVAQWHTPPFTPTVKDGMLYGRGAADMKTSLAAFITAIEAFVADH 118

Query: 125 K-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
             + GSI L+IT DEEG AINGT K++  ++ + E  D CIVGEPT + ++GD IK GRR
Sbjct: 119 PDHPGSIGLIITSDEEGVAINGTVKVVETLKARNELIDYCIVGEPTSSKVVGDMIKNGRR 178

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSLSG++T+ G QGH+AYPHL +NPI    P + +L+   +D GN  F PT+ +I+ I  
Sbjct: 179 GSLSGKLTVKGIQGHIAYPHLVKNPIHMAAPAIKELSETIWDEGNEYFPPTSWQISNIHG 238

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NV+P +V++ FN RF+     + LK+ + + L +         + + +     P 
Sbjct: 239 GTGATNVVPGEVEILFNFRFSTASTAENLKQRVHAILDRHQLE-----YDLAWELSGKP- 292

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLT    L + +S +I    G  P LSTSGGTSD RFI D    ++EFG +  T+H LNE
Sbjct: 293 FLTPRGSLVTAISSAIDQAFGVTPALSTSGGTSDGRFIADIAGQIVEFGPLNATIHKLNE 352

Query: 363 NASLQDLEDLTCIYENFLQNWF 384
             ++ D+E L   Y+  L+   
Sbjct: 353 CVAVADIEPLRRTYQLTLEALL 374


>gi|148825625|ref|YP_001290378.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           PittEE]
 gi|319896542|ref|YP_004134735.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           F3031]
 gi|238064747|sp|A5UB44|DAPE_HAEIE RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|148715785|gb|ABQ97995.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           PittEE]
 gi|309972769|gb|ADO95970.1| N-succinyl-diaminopimelate deacylase [Haemophilus influenzae R2846]
 gi|317432044|emb|CBY80393.1| putative succinyl-diaminopimelate desuccinylase [Haemophilus
           influenzae F3031]
          Length = 377

 Score =  254 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 154/388 (39%), Positives = 216/388 (55%), Gaps = 13/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +     LI+ PS++P D G   I+   L+ LGF IE   F     +   NL+A+ 
Sbjct: 1   MKEKVVSLAQDLIRRPSISPNDEGCQQIIAEGLEKLGFQIEWMPF-----NDTLNLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT  P + F GH DVVP GD N W+ PPFSA I +G +YGRG  DMKGS+A  I A   +
Sbjct: 56  GTSEPVIAFVGHTDVVPTGDENQWSSPPFSAEIIDGILYGRGAADMKGSLAAMIVAAEEY 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G+I+LLIT DEE  A +GT +++  +  + EK   C+VGEP+    +GD +K
Sbjct: 116 VKANPNHKGTIALLITSDEEAAAKDGTIRVVETLMTRDEKITYCMVGEPSSAKNLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++G + I G QGHVAYPHL ENPI    P L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITGNLYIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDKGNEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIPA++ + FN+R+     ++ +K+++   L K         + + ++  
Sbjct: 236 NIHAGTGSNNVIPAELYIQFNLRYCTEVTDEIIKQKVAEMLAKHNLK-----YRIEWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P FLT   KL   ++ +I   TG  P   T GGTSD RFI      V+EFG +  ++H
Sbjct: 291 GKP-FLTKPGKLLDSITSAIEEITGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSSIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFIT 386
            +NE  S++DL     IY   L N   +
Sbjct: 350 KVNECVSVEDLGKCGEIYHKMLVNLLDS 377


>gi|319775041|ref|YP_004137529.1| putative succinyl-diaminopimelate desuccinylase [Haemophilus
           influenzae F3047]
 gi|329123051|ref|ZP_08251622.1| succinyl-diaminopimelate desuccinylase [Haemophilus aegyptius ATCC
           11116]
 gi|317449632|emb|CBY85838.1| Putative succinyl-diaminopimelate desuccinylase [Haemophilus
           influenzae F3047]
 gi|327471982|gb|EGF17422.1| succinyl-diaminopimelate desuccinylase [Haemophilus aegyptius ATCC
           11116]
          Length = 377

 Score =  254 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 156/388 (40%), Positives = 217/388 (55%), Gaps = 13/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +     LI+ PS++P D G   I+   L+ LGF IE   F     +   NL+A+ 
Sbjct: 1   MREKVVSLAQDLIRLPSISPNDEGCQQIIAERLEKLGFQIEWMPF-----NDTLNLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT  P + FAGH DVVP GD N W+ PPFSA I +G +YGRG  DMKGS+A  I A   +
Sbjct: 56  GTSEPVIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEY 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G+I+LLIT DEE  A +GT +++  +  + EK   C+VGEP+    +GD +K
Sbjct: 116 VKANPNHKGTIALLITSDEEAAAKDGTVRVVETLMARDEKITYCMVGEPSSAKNLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++G + I G QGHVAYPHL ENPI    P L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITGNLYIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDKGNEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIPA++ + FN+R+     ++ +K+++   L K         + + ++  
Sbjct: 236 NIHAGTGSNNVIPAELYIQFNLRYCTEVTDEIIKQKVAEMLEKHNLK-----YRIEWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P FLT   KL   ++ +I  T G  P   T GGTSD RFI      V+EFG +  T+H
Sbjct: 291 GKP-FLTKPGKLLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFIT 386
            +NE  S++DL     IY   L N   +
Sbjct: 350 KVNECVSVEDLGKCGEIYHKMLVNLLDS 377


>gi|260574126|ref|ZP_05842131.1| succinyl-diaminopimelate desuccinylase [Rhodobacter sp. SW2]
 gi|259023592|gb|EEW26883.1| succinyl-diaminopimelate desuccinylase [Rhodobacter sp. SW2]
          Length = 381

 Score =  254 bits (647), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 159/384 (41%), Positives = 221/384 (57%), Gaps = 9/384 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +     LI+CPSVTP +GGA  +L   L+  GF     D        + NLYAR+G +
Sbjct: 5   DPVALTADLIRCPSVTPAEGGALGVLQAVLQGAGFDCTRVD-----RGGIANLYARWGRK 59

Query: 64  A--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
                  F GH DVVP GD   WT  PF A + +G +YGRG  DMK  +A F+AA   F+
Sbjct: 60  GANKAFGFNGHTDVVPVGDAAAWTQDPFGAAVVDGWMYGRGATDMKSGVAAFVAAAVDFV 119

Query: 122 PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
                 G++ L ITGDEEG +++GT+ +L W+   GE    C+VGEPTC  ++G+ +KIG
Sbjct: 120 TDTPPDGAVILAITGDEEGESVDGTRALLDWMAANGEAMSHCLVGEPTCPEVMGEMMKIG 179

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSL+   T  G QGH AYPH  +NP+  ++ L+ QL     D G   F  + + ITTI
Sbjct: 180 RRGSLTAYFTARGVQGHSAYPHRAKNPVTAMVALMAQLEAQPLDAGTAHFDASTLAITTI 239

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
           D GNP+ NVIPA  + + NIRFND  +  +L + +R+                   S   
Sbjct: 240 DTGNPATNVIPAVCRGTVNIRFNDAHSGASLSDWLRAEAAAVQAQTGVEIAVAVSISG-- 297

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALN 361
             FLT   + ++L++ S+   TG +P+ STSGGTSDARF+KD+CPV+EFGLVG+TMH ++
Sbjct: 298 ESFLTPPGEFSALVAASVQAETGRLPVASTSGGTSDARFVKDHCPVVEFGLVGKTMHQVD 357

Query: 362 ENASLQDLEDLTCIYENFLQNWFI 385
           E   +  +  L  IY   L+++F 
Sbjct: 358 ERVEVAQILALKAIYGRILRDYFA 381


>gi|319779617|ref|YP_004130530.1| N-succinyl-L,L-diaminopimelate desuccinylase [Taylorella
           equigenitalis MCE9]
 gi|317109641|gb|ADU92387.1| N-succinyl-L,L-diaminopimelate desuccinylase [Taylorella
           equigenitalis MCE9]
          Length = 381

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 157/385 (40%), Positives = 210/385 (54%), Gaps = 15/385 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            LE L  LI   S++P D G   +L + LK  GF  E  +F       VKNL+ R G  A
Sbjct: 8   TLELLKDLISRESISPNDAGCQDVLADLLKKQGFKAEFMEF-----GAVKNLWIRHGDLA 62

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P ++FAGH DVVP G  + W  PPF  TI   K+YGRG  DMK  +A    A   F+  Y
Sbjct: 63  PLVVFAGHTDVVPSGPRDLWDSPPFEPTIRNNKLYGRGAADMKAGVAASAIASYEFVKAY 122

Query: 125 K-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
             + GS++LLIT DEE  AI+GT K+   +EK+GE  D C+V EP+C   +GDTIKIGRR
Sbjct: 123 PNHNGSVALLITSDEESIAIDGTVKVCEVLEKRGESIDYCVVAEPSCVDKLGDTIKIGRR 182

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS    +TI GKQGHVAYPH  +NPI   +P + +L +  +D GN  F PT+ +I+    
Sbjct: 183 GSYGATLTIKGKQGHVAYPHKVKNPIHLAVPAVAELCSTVWDEGNKFFPPTSFQISNYRA 242

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NV+P    + FN RF      ++LK  +   L K   +     + + +     P 
Sbjct: 243 GTGAANVVPGIAHIEFNFRFCTESTPESLKNRVEEILNKHNLD-----YEIEWILGGEP- 296

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP---VIEFGLVGRTMHAL 360
           FLT    LT  +  SI   TG    LST+GGTSD RFI    P   V+EFG++  ++H +
Sbjct: 297 FLTEAEDLTKAMIDSIKEVTGVDAQLSTTGGTSDGRFIAKMNPKPKVLEFGVINASIHQI 356

Query: 361 NENASLQDLEDLTCIYENFLQNWFI 385
           NE+  + DLE    IY   L+    
Sbjct: 357 NEHVDVDDLEKSKDIYFKVLEKLLA 381


>gi|74317289|ref|YP_315029.1| succinyl-diaminopimelate desuccinylase [Thiobacillus denitrificans
           ATCC 25259]
 gi|123611919|sp|Q3SJE0|DAPE_THIDA RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|74056784|gb|AAZ97224.1| succinyl-diaminopimelate desuccinylase [Thiobacillus denitrificans
           ATCC 25259]
          Length = 392

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 159/386 (41%), Positives = 224/386 (58%), Gaps = 13/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           +  + L   ++L+K  SVTP D G   ++   L+ LGF IE         + V NL+AR 
Sbjct: 11  LASETLALAVELLKRRSVTPDDAGCHDLIAARLQALGFHIERH-----RHNDVDNLWARR 65

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT +P + FAGH DVVPPG    W   PF  T+ +GK+Y RG  DMK S A F+ A  RF
Sbjct: 66  GTASPVVCFAGHTDVVPPGPLEQWLSDPFEPTLRDGKLYARGAADMKTSDAAFVTATERF 125

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + +   + GSI+ L+T DEEGPA +GT +++  ++ +GE  D CIVGEPT     GDTIK
Sbjct: 126 LARRPDHPGSIAFLLTSDEEGPATDGTVRVVEALKARGELLDYCIVGEPTSAAEFGDTIK 185

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSLSG + + G QGH+AYPHL +NPI    P + +L    +D GN+ F PT  +I+
Sbjct: 186 NGRRGSLSGTLRVKGVQGHIAYPHLAKNPIHLAAPAIAELAETMWDEGNSYFPPTTWQIS 245

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G    NVIP  V++ FN RF+     + L + +   L     +   L + + ++  
Sbjct: 246 NIHAGTGVTNVIPGMVEIQFNFRFSTASTAEGLMDAVNEIL-----DSHGLDYEIDWNLS 300

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMH 358
             P FLT    L   LS++++  TG  P LST+GGTSD RFI D C  V+EFG +  ++H
Sbjct: 301 GKP-FLTPRGALCDRLSEAVHEVTGLTPELSTTGGTSDGRFIADICREVVEFGPLNMSIH 359

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            LNE+ +L+++E L  +YE  L+   
Sbjct: 360 KLNEHVALENVEQLAAVYEKALEKLL 385


>gi|309750482|gb|ADO80466.1| N-succinyl-diaminopimelate deacylase [Haemophilus influenzae R2866]
          Length = 377

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 156/388 (40%), Positives = 218/388 (56%), Gaps = 13/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +     LI+ PS++P D G   I+   L+ LGF IE   F     +   NL+A+ 
Sbjct: 1   MREKVVSLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPF-----NDTLNLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT  P + FAGH DVVP GD N W+ PPFSA I +G +YGRG  DMKGS+A  I A   +
Sbjct: 56  GTSEPVIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEY 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G+I+LLIT DEE  A +GT +++  +  + EK   C+VGEP+    +GD +K
Sbjct: 116 VKANPNHKGTIALLITSDEEAAAKDGTIRVVETLMTRDEKITYCMVGEPSSAKNLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++G + I G QGHVAYPHL ENPI    P L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITGNLYIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDKGNEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIPA++ + FN+R+     ++ +K+++      G+     L + + ++  
Sbjct: 236 NIHAGTGSNNVIPAELYIQFNLRYCTEVTDEIIKQKV-----AGMLEKHNLKYRIEWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P FLT   KL   ++ +I  T G  P   T GGTSD RFI      V+EFG +  T+H
Sbjct: 291 GKP-FLTKPGKLLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFIT 386
            +NE  S++DL     IY   L N   +
Sbjct: 350 KVNECVSVEDLGKCGEIYHKMLVNLLDS 377


>gi|183599378|ref|ZP_02960871.1| hypothetical protein PROSTU_02847 [Providencia stuartii ATCC 25827]
 gi|188021616|gb|EDU59656.1| hypothetical protein PROSTU_02847 [Providencia stuartii ATCC 25827]
          Length = 376

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 146/387 (37%), Positives = 213/387 (55%), Gaps = 13/387 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    ++   +LI  PS++P D G   +L+  L+ +GF++E+  F         N +A  
Sbjct: 1   MDCPVIQLAQELISRPSISPDDQGCQALLIERLEKVGFTVEKMLFDD-----TANFWAYR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVP GD   W  PPF  TI    +YGRG  DMKGS+A  + A  RF
Sbjct: 56  GADGETLAFAGHTDVVPAGDETKWQTPPFIPTIINQHLYGRGAADMKGSVAAMVVAAERF 115

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + K+  + G ++ LIT DEE  A NGT K++  + ++ E+ D C+VGEP+    +GD +K
Sbjct: 116 VQKHPDHRGRLAFLITSDEEAKATNGTVKVVETLMQRNERLDYCLVGEPSSQTQLGDIVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++  +TI G QGHVAYPHL +NP+      L +L +  +D GN  F  T+M+I 
Sbjct: 176 NGRRGSITANLTILGTQGHVAYPHLADNPVHRATNFLQELVSTQWDQGNEFFPATSMQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            +  G  + NVIP +  + FN RF+    +K ++E +   L        +L + + +   
Sbjct: 236 NLHAGTGATNVIPGEFFVQFNFRFSTELTDKIIRERVEEML-----ARHQLRYEIEWKLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL     ++I+  TG    LSTSGGTSD RFI      VIE G +  T+H
Sbjct: 291 GQP-FLTRTGKLVDATVQAIHEFTGRTTELSTSGGTSDGRFIAQMGAQVIELGPLNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            ++E  S+ DL+ L  IYE  ++   +
Sbjct: 350 KVDECVSVHDLQQLARIYERIMELLLL 376


>gi|261867491|ref|YP_003255413.1| succinyl-diaminopimelate desuccinylase [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261412823|gb|ACX82194.1| succinyl-diaminopimelate desuccinylase [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 377

 Score =  253 bits (646), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 152/386 (39%), Positives = 214/386 (55%), Gaps = 13/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +     LI+  S++P D G   ++   L+ LGF IE   F     +   NL+A+ 
Sbjct: 1   MKEKVVSLAQALIRXASISPNDEGCQQLIAERLEKLGFQIEWLPF-----NDTLNLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G+  P + FAGH DVVP GD + WTYPPF A I +  +YGRG  DMKGS+A  + A   +
Sbjct: 56  GSGDPVIAFAGHTDVVPTGDESQWTYPPFDAKIVDDMLYGRGAADMKGSLAAMVVATEEY 115

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  +  + G+I+LLIT DEE  A +GT +++  +  +GEK   C+VGEP+    +GD +K
Sbjct: 116 VKAHPNHQGTIALLITSDEEAAAKDGTVRVVETLMARGEKITYCMVGEPSSTQTLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++G + I G QGHVAYPHL ENPI    P L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITGNLYIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDNGNDFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN+R+     +  +K+++   L K         + + ++  
Sbjct: 236 NIHAGTGSNNVIPGELYVQFNLRYCTEVTDGMIKQKVAEMLEKHGLK-----YRIEWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P FLT   KL S L  S+    G  P L T GGTSD RFI      V+EFG +  T+H
Sbjct: 291 GKP-FLTKPGKLVSALVDSLQQIAGITPKLETGGGTSDGRFIALMGAEVVEFGPLNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            +NE  S++DL     IY   L N  
Sbjct: 350 KVNECVSVEDLGKCGQIYHQMLVNLL 375


>gi|260913015|ref|ZP_05919500.1| succinyl-diaminopimelate desuccinylase [Pasteurella dagmatis ATCC
           43325]
 gi|260633005|gb|EEX51171.1| succinyl-diaminopimelate desuccinylase [Pasteurella dagmatis ATCC
           43325]
          Length = 377

 Score =  253 bits (646), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 150/386 (38%), Positives = 217/386 (56%), Gaps = 13/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +E   +LI+ PSV+P D G   ++   L+ LGF IE   F     +   NL+A+ 
Sbjct: 1   MKNSIIELASELIRRPSVSPDDQGCQQVIAERLQKLGFQIEWMPF-----NDTLNLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G  +P + FAGH DVVP GD   W YPPFSA I +  +YGRG  DMKGS+A  + AV +F
Sbjct: 56  GVGSPVITFAGHTDVVPVGDEKQWQYPPFSAQIVDDVLYGRGAADMKGSLAAMVVAVEKF 115

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +     + G+I+LLIT DEE  A +GT  ++  +  + E  D CIVGEP+ +  +GD +K
Sbjct: 116 VKANPNHQGTIALLITSDEEAAAKDGTVCVVETLMARNEPIDYCIVGEPSSSQKLGDIVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++  + I G QGHVAYPHL ENP+   +  L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITANLYIQGIQGHVAYPHLAENPVHKALAFLSELTTYQWDNGNEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  S NVIP ++ + FN+R+     ++ +K+ +   L K      +L+H + ++  
Sbjct: 236 NINAGTGSNNVIPGELYVQFNLRYCTEVTDEIIKKTVAEMLQK-----YQLTHRIEWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P    +  KL      ++   T N P L T GGTSDARFI      V+EFG + +T+H
Sbjct: 291 GKPFLTRN-GKLVEATISAVQKITKNTPHLDTGGGTSDARFIALMGAEVVEFGPLNKTIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            +NE   + DL     +Y+  L N  
Sbjct: 350 KVNECVDVNDLAKCGDVYQQILINLL 375


>gi|254418255|ref|ZP_05031979.1| succinyl-diaminopimelate desuccinylase [Brevundimonas sp. BAL3]
 gi|196184432|gb|EDX79408.1| succinyl-diaminopimelate desuccinylase [Brevundimonas sp. BAL3]
          Length = 388

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 167/382 (43%), Positives = 226/382 (59%), Gaps = 6/382 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVK----NLYAR 59
           D +E    LI+ PSVTP D GA  +L   L  LGF      F+      V     NLYAR
Sbjct: 3   DPVELTRDLIRIPSVTPADEGAMDVLERHLTALGFHCRRLAFEGPGGEGVHARIENLYAR 62

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT +P+L FAGH DVVP G  + W+  PF+A + +G +YGRG VDMKG IA ++AAV++
Sbjct: 63  RGTASPNLCFAGHTDVVPTGPSDQWSAQPFNAEVRDGLLYGRGAVDMKGGIAAWVAAVSQ 122

Query: 120 FIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
            + + +  GS+S LITGDEEGPA++GTK+++  +  +GE  DACIVGEP+ +  +GD IK
Sbjct: 123 VLAEGEPAGSLSFLITGDEEGPALHGTKRVVETLAAEGEVIDACIVGEPSSSQHLGDMIK 182

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           +GRRGSL+  IT+ GKQGHVAYP    NP   +  L+ +L +   D G   F P+N+EIT
Sbjct: 183 VGRRGSLNTWITVTGKQGHVAYPERAANPAPVIARLMSRLNDHVLDEGYEGFPPSNLEIT 242

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           TID+GNP+ N+IPA+ K   NIRFN       L + +                  H  S 
Sbjct: 243 TIDIGNPATNIIPAEAKARLNIRFNPSHTGDGLIDWLNREAGAVQAETGLQIRLDHLCSG 302

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
               FLT      + +  ++    G  P  ST+GGTSDARFI+  CPV+E GLVG+TMH 
Sbjct: 303 --EAFLTEPGVFVAAVQDAVEAVAGRRPEASTTGGTSDARFIRALCPVLELGLVGQTMHQ 360

Query: 360 LNENASLQDLEDLTCIYENFLQ 381
           ++E     +LE LT +Y   ++
Sbjct: 361 IDERVPTAELETLTAVYRRVIE 382


>gi|255320550|ref|ZP_05361730.1| succinyl-diaminopimelate desuccinylase [Acinetobacter
           radioresistens SK82]
 gi|262379107|ref|ZP_06072263.1| succinyl-diaminopimelate desuccinylase [Acinetobacter
           radioresistens SH164]
 gi|255302400|gb|EET81637.1| succinyl-diaminopimelate desuccinylase [Acinetobacter
           radioresistens SK82]
 gi|262298564|gb|EEY86477.1| succinyl-diaminopimelate desuccinylase [Acinetobacter
           radioresistens SH164]
          Length = 378

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 154/385 (40%), Positives = 221/385 (57%), Gaps = 13/385 (3%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           + D L+  +QL++ PSVTP D     I+   L  +GF IE   F+      V NL+AR G
Sbjct: 4   SSDTLDLSLQLLRQPSVTPVDHNCQNIMAERLSKVGFHIENMRFED-----VDNLWARRG 58

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
           T+ P   FAGH DVVP G+ + W   PF   I +GK+YGRG  DMK ++A  + A  RF+
Sbjct: 59  TKDPVFCFAGHTDVVPTGNLDAWNSDPFIPEIRDGKLYGRGSADMKTALAAMVIASERFV 118

Query: 122 PKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
            K+ +  GSI+ LIT DEEGP+INGT K++  +E + EK   C+VGEP+  H +GD IK 
Sbjct: 119 AKHPDHKGSIAFLITSDEEGPSINGTVKVVETLESRNEKMTWCLVGEPSSTHQLGDIIKN 178

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGSL+G +T+ GKQGHVAYPHL  NPI      L +L    +D+GN  F  T+ +I+ 
Sbjct: 179 GRRGSLNGVLTVKGKQGHVAYPHLAINPIHTASAALAELCETVWDSGNEYFPATSFQISN 238

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV 300
           I  G  + NV+P  + ++FN R++       LK  + + L +   +       + ++   
Sbjct: 239 IQAGTGATNVVPGTMTVTFNFRYSTEVTADELKARVITILQRHQVD-----FDIKWTLSG 293

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHA 359
            P FLT   +L +   ++I+   G    LSTSGGTSD RFI      V+E G++  ++H 
Sbjct: 294 LP-FLTPVGELVNAAVQAIHEVNGVEAKLSTSGGTSDGRFIAPTGAQVLELGVLNASIHQ 352

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           ++E+ ++ DLE L  IYE  L    
Sbjct: 353 IDEHVNVDDLEPLAEIYEKILIQLL 377


>gi|145639602|ref|ZP_01795206.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           PittII]
 gi|145271393|gb|EDK11306.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           PittII]
          Length = 377

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 155/388 (39%), Positives = 217/388 (55%), Gaps = 13/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +     LI+ PS++P D G   I+   L+ LGF IE   F     +   NL+A+ 
Sbjct: 1   MREKVVSLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPF-----NDTLNLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT  P + FAGH DVVP GD N W+ PPFSA I +G +YGRG  DMKGS+A  I A   +
Sbjct: 56  GTSEPVIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEY 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G+I+LLIT DEE  A +GT +++  +  + EK   C+VGEP+    +GD +K
Sbjct: 116 VKANPNHKGTIALLITSDEEAAAKDGTIRVVETLMTRDEKITYCMVGEPSSAKNLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++G + I G QGHVAYPHL ENPI    P L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITGNLYIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDKGNEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIPA++ +  N+R+     ++ +K+++      G+     L + + ++  
Sbjct: 236 NIHAGTGSNNVIPAELYIQLNLRYCTEVTDEIIKQKV-----AGMLEKHNLKYRIEWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P FLT   KL   ++ +I  T G  P   T GGTSD RFI      V+EFG +  T+H
Sbjct: 291 GKP-FLTKPGKLLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFIT 386
            +NE  S++DL     IY   L N   +
Sbjct: 350 KVNECVSVEDLGKCGEIYHKMLVNLLDS 377


>gi|83949862|ref|ZP_00958595.1| succinyl-diaminopimelate desuccinylase [Roseovarius nubinhibens
           ISM]
 gi|83837761|gb|EAP77057.1| succinyl-diaminopimelate desuccinylase [Roseovarius nubinhibens
           ISM]
          Length = 381

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 157/387 (40%), Positives = 225/387 (58%), Gaps = 10/387 (2%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT  D ++   +L++C SVTP++GGA  +L   L+  GF+    D        V NL+AR
Sbjct: 1   MTAIDPVDLTAKLVRCASVTPEEGGALVLLQGLLEEAGFACTRID-----RGGVSNLFAR 55

Query: 60  FGTEA--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAV 117
           +G +       F GH DVVP GD   W+  PF A I +GK++GRG  DMK  +A F+AA 
Sbjct: 56  WGDKGATKSFGFNGHTDVVPVGDAVAWSVDPFGAEIRDGKLWGRGSTDMKSGVAAFVAAA 115

Query: 118 ARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDT 177
              +      G++ + +TGDEEG A++GT  +L W+E  GE+ D C+VGEPTC   +G+ 
Sbjct: 116 IDLVRDAPPEGAVIITVTGDEEGDAVDGTTAILDWMEDAGERMDVCLVGEPTCPETMGEM 175

Query: 178 IKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNME 237
           IKIGRRGSLS   TI G QGH AYPH   NPI  +  L+ +L++   D G   F P+ + 
Sbjct: 176 IKIGRRGSLSAWFTITGTQGHAAYPHRANNPIPAMARLVDRLSSRELDQGTEHFDPSTLA 235

Query: 238 ITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFS 297
           + +ID GNP+ NVIPAQ     NIRFND  +  +L   +   L +       +   +   
Sbjct: 236 VVSIDTGNPASNVIPAQTSGIVNIRFNDSHSGASLSAWLHEELARV-AEEFGVETEIKIK 294

Query: 298 SPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTM 357
                        L+ L+++S+   TG  P+LST+GGTSDARF+K +CPV+EFGLVG+TM
Sbjct: 295 ISGESFITPP-GALSELVARSVEAETGVKPVLSTTGGTSDARFVKSHCPVVEFGLVGQTM 353

Query: 358 HALNENASLQDLEDLTCIYENFLQNWF 384
           H ++E+  +  +E L  +Y   L+++F
Sbjct: 354 HQVDEHVVVDHIEQLKGVYSRILRDYF 380


>gi|34496911|ref|NP_901126.1| succinyl-diaminopimelate desuccinylase [Chromobacterium violaceum
           ATCC 12472]
 gi|81656252|sp|Q7NY19|DAPE_CHRVO RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|34102767|gb|AAQ59131.1| succinyl-diaminopimelate desuccinylase [Chromobacterium violaceum
           ATCC 12472]
          Length = 377

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 155/383 (40%), Positives = 217/383 (56%), Gaps = 13/383 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L+   +LI+  SVTP+D G   +++  L+ +GF +E+          V N +AR G   
Sbjct: 4   TLDLARELIRRDSVTPRDEGCQALMIERLEAIGFKVEKM-----RHGDVDNFWARRGDAG 58

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P   FAGH DVVP G  + W  PPF  T+  G +YGRG  DMK S+A F+ A  RF+ ++
Sbjct: 59  PLFCFAGHTDVVPTGPLDKWDSPPFEPTVRNGLLYGRGAADMKASLAAFVTACERFVAEH 118

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
            +  GS++LLIT DEEG A++GT K++  +E +GE  D CIVGEPT    +GDT+K GRR
Sbjct: 119 PDHKGSLALLITSDEEGVAVDGTVKVVDALEARGETIDYCIVGEPTSEQRLGDTVKNGRR 178

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSLSG + +HG QGH+AYP L +NPI  + P L +L    +D GN  F PT+ +++ I  
Sbjct: 179 GSLSGRLVVHGIQGHIAYPQLAKNPIHLMAPALAELAATRWDEGNAFFPPTSWQVSNIQA 238

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NVIP   ++ FN RF+     ++LKE +   L K       L + +H+     P 
Sbjct: 239 GTGATNVIPGHCELLFNFRFSPESTAESLKERVYQILDK-----HGLGYELHWQLSGQPF 293

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
                  LT  LS +I   +G    LST+GGTSD RFIK     ++EFG +  T+H LNE
Sbjct: 294 ITPP-GALTDALSAAIAEVSGAKAELSTTGGTSDGRFIKRIARELVEFGPINATIHKLNE 352

Query: 363 NASLQDLEDLTCIYENFLQNWFI 385
              + D+E L  IY   L+    
Sbjct: 353 CVEVADVEPLAAIYRRTLEGLLA 375


>gi|254785167|ref|YP_003072595.1| succinyl-diaminopimelate desuccinylase [Teredinibacter turnerae
           T7901]
 gi|259595047|sp|C5BQE9|DAPE_TERTT RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|237684078|gb|ACR11342.1| succinyl-diaminopimelate desuccinylase [Teredinibacter turnerae
           T7901]
          Length = 375

 Score =  253 bits (645), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 156/387 (40%), Positives = 211/387 (54%), Gaps = 14/387 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+P  L+    LI   SVTP+D G   ++   L+ +GF IE   F       V N +A  
Sbjct: 1   MSP-TLQLACDLISRASVTPEDAGCQALMTERLRAIGFHIESLRFDD-----VDNFWAVR 54

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   P L FAGH DVVP GD   W  PP+  TI +G +YGRG  DMKGS+A  + A   F
Sbjct: 55  GASGPILCFAGHTDVVPEGDPAKWQSPPYEPTITDGLLYGRGAADMKGSLAAMVTACEAF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G I+ LIT DEEG A NGT K++ W+E +GEK   C+VGEP+    +GD IK
Sbjct: 115 VAEHPNHTGRIAFLITSDEEGIAANGTVKVVEWLEARGEKVTWCLVGEPSSTQSVGDVIK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL  ++T+ GKQGHVAYPHL +NPI  + P L  L    +D GN  F  T+ +++
Sbjct: 175 NGRRGSLGCKLTVKGKQGHVAYPHLAKNPIHLVAPALADLAAEQWDEGNDFFPATSFQVS 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
             + G  + NVIP +  + FN RF+       LK+   + L K   +     + +H+   
Sbjct: 235 NFNAGTGATNVIPGEAAIVFNFRFSTESTADELKQRTEAILAKHGLD-----YDIHWHLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT    L      +I    G  P LSTSGGTSD RFI      V+E G V  T+H
Sbjct: 290 GEP-FLTPAGALVDAAVTAIRAECGAEPELSTSGGTSDGRFIAPTGAQVLELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            +NE  ++ DL+ L+  Y+  L+    
Sbjct: 349 QINECVNVADLDKLSATYQRILKELLA 375


>gi|145629016|ref|ZP_01784815.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           22.1-21]
 gi|144978519|gb|EDJ88242.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           22.1-21]
          Length = 377

 Score =  252 bits (644), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 157/388 (40%), Positives = 218/388 (56%), Gaps = 13/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +     LI+ PS++P D G   I+   L+ LGF IE   F     +   NL+A+ 
Sbjct: 1   MKEKVVSLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPF-----NDTLNLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT  P + FAGH DVVP GD N W+ PPFSA I +G +YGRG  DMKGS+A  I A   +
Sbjct: 56  GTSEPVIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEY 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G+I+LLIT DEE  A +GT +++  +  + EK   C+VGEP+    +GD +K
Sbjct: 116 VKANPNHKGTIALLITSDEEAAAKDGTIRVVETLMTRDEKITYCMVGEPSSAKNLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++G + I G QGHVAYPHL ENPI    P L +LT   +D GN  F PTN++I 
Sbjct: 176 NGRRGSITGNLYIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDKGNEFFPPTNLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIPA++ + FN+R+     ++ +K+++      G+     L + + ++  
Sbjct: 236 NIHAGTGSNNVIPAELYIQFNLRYCTEVTDEIIKQKV-----AGMLEKHNLKYRIEWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P FLT   KL   ++ +I  T G  P   T GGTSD RFI      V+EFG +  T+H
Sbjct: 291 GKP-FLTKPGKLLDSITFAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFIT 386
            +NE  S++DL     IY   L N   +
Sbjct: 350 KVNECVSVEDLGKCGEIYHKMLVNLLDS 377


>gi|296775671|gb|ADH42948.1| acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase
           [uncultured SAR11 cluster alpha proteobacterium
           H17925_23J24]
          Length = 379

 Score =  252 bits (643), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 177/380 (46%), Positives = 251/380 (66%), Gaps = 8/380 (2%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           L+    LI+ PS+TP+D GA  +L   L+ +GF+ +  +F+      +KNLYA+ G  +P
Sbjct: 6   LKLAKDLIRKPSITPKDAGAINLLAKNLRSIGFNCKIINFK-----NIKNLYAKLGKSSP 60

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
           +  +AGH DVVPPG+  +WT  PF   +   K+ GRG  DMK SIACF+AAV+RF  + K
Sbjct: 61  NFCYAGHTDVVPPGNIKNWTINPFKPIVRNNKLIGRGANDMKASIACFVAAVSRFKNQNK 120

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           NF GSISLLITGDEEG A+NGTK+++ ++++K EK + C+VGEPT  + +G+ IKIGRRG
Sbjct: 121 NFKGSISLLITGDEEGMALNGTKRVVKYLKRKKEKINFCLVGEPTNPNKLGEMIKIGRRG 180

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SL+G +T+ G QGHVAYPH   NP   LI +L ++ ++  D G   F P+N+E+T I++ 
Sbjct: 181 SLTGRLTVIGSQGHVAYPHRANNPSNTLIKILKRIKDLKLDRGTKNFQPSNLEVTKINID 240

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
           N + NVIP      FNIRFND  +  +LK ++ +++ K +    K    V++        
Sbjct: 241 NHADNVIPGSAYAVFNIRFNDKHSSGSLKRKL-NKIFKAVTKTNKSKFKVNYEVSGEAF- 298

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENA 364
           LT   K+T ++  +I   TG  P LSTSGGTSDARFIK+  P +EFGLVG+TMH ++E+ 
Sbjct: 299 LTKPNKITFMIQNTIKKITGIKPKLSTSGGTSDARFIKNIAPCLEFGLVGKTMHKIDESV 358

Query: 365 SLQDLEDLTCIYENFLQNWF 384
           S+ DL+ LT IYEN L ++F
Sbjct: 359 SVSDLKKLTKIYENILVSYF 378


>gi|16124530|ref|NP_419094.1| succinyl-diaminopimelate desuccinylase [Caulobacter crescentus
           CB15]
 gi|221233216|ref|YP_002515652.1| succinyl-diaminopimelate desuccinylase [Caulobacter crescentus
           NA1000]
 gi|81536207|sp|Q9ABF3|DAPE_CAUCR RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064717|sp|B8GYE7|DAPE_CAUCN RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|13421412|gb|AAK22262.1| succinyl-diaminopimelate desuccinylase [Caulobacter crescentus
           CB15]
 gi|220962388|gb|ACL93744.1| succinyl-diaminopimelate desuccinylase [Caulobacter crescentus
           NA1000]
          Length = 386

 Score =  252 bits (643), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 176/383 (45%), Positives = 225/383 (58%), Gaps = 10/383 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +E    LI+ PSVTP D GA   L   L+ LGF+     F       ++NLYAR GT 
Sbjct: 12  DPVELAQALIRRPSVTPADAGAMDTLQRQLEALGFACRRMKFGE-----IENLYARRGTA 66

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            P+L FAGH DVVP GD   WT  PF A I EG +YGRG VDMK +IA F   VA     
Sbjct: 67  RPNLCFAGHTDVVPVGDDAAWTAGPFEAEIKEGVLYGRGAVDMKSAIAAF---VAAVANV 123

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
             + GSIS LITGDEEG A +GT K++  +  +GE  D CIVGEPT  +++GD +KIGRR
Sbjct: 124 PDHPGSISFLITGDEEGVAEDGTVKVVEALAAEGEIIDHCIVGEPTSANLLGDMVKIGRR 183

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++  IT+ G+QGHVAYPH   NP+  L+ +L  L     D G T F P+N+EITTIDV
Sbjct: 184 GSINAWITVEGRQGHVAYPHRAANPVPVLVDILSALKARVLDDGYTGFQPSNLEITTIDV 243

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GN + NVIPA  K   NIRFN     K L   I     K  +     +  +   S     
Sbjct: 244 GNTATNVIPAAAKARVNIRFNPAHKGKDLAAWIEGECAKAAEGFDGAATALCKISG--EA 301

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           FLT     T ++  ++ + TG  P LST+GGTSDARFI+  CPV+EFGLVG TMH ++E 
Sbjct: 302 FLTEPGDFTDVIVAAVTDATGRAPELSTTGGTSDARFIRALCPVVEFGLVGSTMHQVDER 361

Query: 364 ASLQDLEDLTCIYENFLQNWFIT 386
             ++++  L   YE  ++ +F  
Sbjct: 362 VPVEEVRQLAGAYEALIRRYFAA 384


>gi|307317992|ref|ZP_07597429.1| succinyl-diaminopimelate desuccinylase [Sinorhizobium meliloti
           AK83]
 gi|306896394|gb|EFN27143.1| succinyl-diaminopimelate desuccinylase [Sinorhizobium meliloti
           AK83]
          Length = 397

 Score =  252 bits (643), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 214/388 (55%), Positives = 264/388 (68%), Gaps = 7/388 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D + +L  LI+CPSVTP +GGA   L   L  +GF ++    +   T  ++NLYAR G E
Sbjct: 5   DPVSNLAALIRCPSVTPAEGGALAALEAMLAPVGFKVDRVVAKEPGTPDIENLYARIGGE 64

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVP GD   W+ PPFSA IAEG++YGRG VDMKG IACF+AAVAR + K
Sbjct: 65  GPHLMFAGHTDVVPVGDEAAWSRPPFSAAIAEGEMYGRGAVDMKGGIACFVAAVARHVEK 124

Query: 124 YK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
           +    GSIS LITGDEEGPAINGT K+L W   +GE+WDAC+VGEPT    IGD IKIGR
Sbjct: 125 HGAPKGSISFLITGDEEGPAINGTVKLLEWAAARGERWDACLVGEPTNPDCIGDMIKIGR 184

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSLSG IT+HG QGH AYPHL +NP+R ++ L   L +  FD G   F P+N+E+TTID
Sbjct: 185 RGSLSGRITVHGIQGHAAYPHLADNPVRSILQLAQALMDPPFDDGTENFQPSNLEVTTID 244

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKG------IQNVPKLSHTVHF 296
           VGN + NVIPA+   +FNIRFND W  ++L  EI +RL +               + + +
Sbjct: 245 VGNTAVNVIPAKASAAFNIRFNDRWTAESLMAEIVARLDRAAAGSALRPGRGSARYEIVW 304

Query: 297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRT 356
           +   S VFLT +  L   LS ++   TG  P LST+GGTSDARFIKDYCPV+EFGLVG+T
Sbjct: 305 NERPSHVFLTRNNALIDSLSGAVEAVTGRQPQLSTTGGTSDARFIKDYCPVVEFGLVGKT 364

Query: 357 MHALNENASLQDLEDLTCIYENFLQNWF 384
           MH ++E  +L DLE LT IYE F+  WF
Sbjct: 365 MHMVDERVALADLETLTGIYETFIARWF 392


>gi|304387061|ref|ZP_07369313.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis ATCC
           13091]
 gi|304338860|gb|EFM04962.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis ATCC
           13091]
          Length = 398

 Score =  252 bits (643), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 167/391 (42%), Positives = 223/391 (57%), Gaps = 14/391 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    LE    LI  PSVTP D     +L   L  +GF+ E   F        KN++ R
Sbjct: 18  MTETQSLELAKALISRPSVTPDDQNCQKLLAERLHKIGFAAEALHFGD-----TKNIWLR 72

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+AP + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK SIACF+ A  R
Sbjct: 73  RGTKAPVVCFAGHTDVVPTGPIEKWDSPPFEPTERDGRLYGRGAADMKTSIACFVTACER 132

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ ++  + GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD I
Sbjct: 133 FVAEHPDHQGSIALLITSDEEGDALDGTTKVVDILKARDELIDYCIVGEPTTVDKLGDMI 192

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I
Sbjct: 193 KNGRRGSLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQI 252

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S 
Sbjct: 253 SNINGGTGATNVIPGELSVKFNFRFSTESTEAGLKQRVHAILDK-----HGVQYDLQWSC 307

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTM 357
              P FLTH  KLT +   +I    G    LST+GGTSD RFIK     +IE G    T+
Sbjct: 308 SGQP-FLTHAGKLTDVARAAIAEICGIEAELSTTGGTSDGRFIKAIAKELIELGPSNATI 366

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFITPS 388
           H +NEN  L D+  L+ +YE  L       +
Sbjct: 367 HQINENVRLDDIPKLSAVYEGILARLLAGNA 397


>gi|84503467|ref|ZP_01001522.1| succinyl-diaminopimelate desuccinylase [Oceanicola batsensis
           HTCC2597]
 gi|84388145|gb|EAQ01098.1| succinyl-diaminopimelate desuccinylase [Oceanicola batsensis
           HTCC2597]
          Length = 380

 Score =  252 bits (643), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 160/387 (41%), Positives = 221/387 (57%), Gaps = 9/387 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D +     LI+CPSVTP++GGA  +L   L   GF+    D      +   NL+AR+
Sbjct: 1   MPTDPVALTADLIRCPSVTPEEGGALVLLEKVLGRAGFTCIRVD-----RNGTSNLFARW 55

Query: 61  GTEA--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
           G         F GH DVVP GD   W+ PPF A   +G ++GRG  DMK  +A F AA  
Sbjct: 56  GHRGANRSFGFNGHTDVVPVGDAAAWSVPPFGAVEKDGMLWGRGATDMKSGVAAFAAAAI 115

Query: 119 RFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
            F+ +    G++ L ITGDEEG A +GT  +L W+ + GE    C+VGEPTC   +G+ +
Sbjct: 116 DFVTETPPDGAVILAITGDEEGDATDGTVALLDWMRETGEAMTDCLVGEPTCPDRMGEMM 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGSL+    + G QGH AYPH  +NP+  L  L+ +L +   D G   F  + +  
Sbjct: 176 KIGRRGSLNAWFEVTGVQGHSAYPHRAKNPVPALARLMDRLASHDLDHGTDHFQASTVVP 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
            T+D GNP+ NVIPAQ + + NIRF+D  +  +L   +R     GI     +S  V    
Sbjct: 236 VTMDTGNPATNVIPAQCRGAVNIRFSDAHSGDSLSAWLRQEA-AGIAETFGVSVDVRIKV 294

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
                FLT    L++L++ ++   TG  P LSTSGGTSDARF+KD+CPV+EFGLVG+TMH
Sbjct: 295 SG-ESFLTPPGPLSNLVATAVRAETGIAPELSTSGGTSDARFVKDHCPVVEFGLVGKTMH 353

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
           A++E   +  +  L  IY   L+++F 
Sbjct: 354 AVDERVEIAQIRQLKEIYGRILRDYFA 380


>gi|225677185|ref|ZP_03788181.1| succinyl-diaminopimelate desuccinylase [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|225590772|gb|EEH12003.1| succinyl-diaminopimelate desuccinylase [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
          Length = 398

 Score =  252 bits (643), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 167/385 (43%), Positives = 224/385 (58%), Gaps = 11/385 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D +E   +LI   S+TP+D GA   +    K  GF  E  +F  K    VKNLYA++
Sbjct: 1   MKIDPVELTRKLISFESITPEDSGAIEYIAAIFKKSGFDCEILEFGDK----VKNLYAKY 56

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIA-AVAR 119
               P+L FAGH+DVVPPG    W + PF+  + +G +YGRG  DMK  +A FIA  V  
Sbjct: 57  INGVPNLCFAGHVDVVPPGQLKDWAFGPFNPEVRDGMLYGRGAADMKSGVAAFIAAMVNL 116

Query: 120 FIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
              K++  GSIS LIT  EE     GTK +L W++ K +K D C+VGEPT +  +GDTIK
Sbjct: 117 IAEKFQFNGSISALITSAEESMEEYGTKAVLEWMKNKQKKIDFCVVGEPTSSKKLGDTIK 176

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGS++ E+  HGKQGHVAYP L +NPI  +I +L ++ N  FD GN  F P++ E+T
Sbjct: 177 IGRRGSVTFELICHGKQGHVAYPDLADNPIYKVISILSKVKNTTFDHGNKYFQPSHCEVT 236

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           TIDVGN + N+IP      FNIR+N+      L + I         +     H+      
Sbjct: 237 TIDVGNNTSNLIPGSATTRFNIRYNNEQTPGGLYKLIDEICSSVTNDYKLFMHSSRDVFL 296

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
            +P   T       ++  +I   T     LSTSGGTSDA FIKD CPVIEFG++ +T H 
Sbjct: 297 STPDRNT------DIMLDAINKVTSIDAALSTSGGTSDAAFIKDVCPVIEFGIINKTAHQ 350

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           +NE  S+ D+  LT IY+ F++N+F
Sbjct: 351 INECVSVNDIHKLTAIYKEFIENYF 375


>gi|332525857|ref|ZP_08401998.1| succinyl-diaminopimelate desuccinylase [Rubrivivax benzoatilyticus
           JA2]
 gi|332109408|gb|EGJ10331.1| succinyl-diaminopimelate desuccinylase [Rubrivivax benzoatilyticus
           JA2]
          Length = 381

 Score =  252 bits (642), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 148/386 (38%), Positives = 216/386 (55%), Gaps = 11/386 (2%)

Query: 3   PDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF-- 60
            + L    QLI   SVTP+D G   ++ + L  LGF  E       +   V NL AR   
Sbjct: 2   NNALRLAEQLIARRSVTPEDAGCQDLIASRLAALGFECETIVCGPDDF-RVTNLLARRAG 60

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
               P L FAGH DVVP G  + WT  PF  +  +G++YGRG  DMK S+A  + AV  F
Sbjct: 61  SEPGPVLAFAGHTDVVPTGPLDRWTSDPFVPSHRDGRLYGRGAADMKSSLAAMVVAVEEF 120

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           I       G+I+ L+T DEEGP+++GT +++  ++++GE+ DACIVGEPT    +GD +K
Sbjct: 121 IAAQPRHAGAITFLLTSDEEGPSVDGTVRLVELLQQRGERLDACIVGEPTSVSRLGDMLK 180

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSLSG +T+ GKQGH+AYP L +NPI    P L +L  + +D GN  F PT+ +++
Sbjct: 181 NGRRGSLSGRLTVIGKQGHIAYPQLAKNPIHVFAPALAELAAMRWDEGNAFFPPTSWQVS 240

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            +  G  + NVIP ++ + FN RF+     ++L+  +   L +         H + ++  
Sbjct: 241 NLHGGTGASNVIPGELVVDFNFRFSTESTPESLQARVAEVLARHGVE-----HRLEWTLS 295

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMH 358
             P   T    L + LS +I    G  P LST+GGTSD RFI   CP V+EFG +  T+H
Sbjct: 296 GRPFLTTP-GPLIAALSAAIVTECGVEPELSTTGGTSDGRFIAAICPQVVEFGPLNATIH 354

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E+     +E L  +Y   L+++ 
Sbjct: 355 QIDEHVDAASVETLKNVYRRTLEHYL 380


>gi|84684540|ref|ZP_01012441.1| succinyl-diaminopimelate desuccinylase [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84667519|gb|EAQ13988.1| succinyl-diaminopimelate desuccinylase [Rhodobacterales bacterium
           HTCC2654]
          Length = 381

 Score =  252 bits (642), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 157/388 (40%), Positives = 224/388 (57%), Gaps = 10/388 (2%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT  + +E   +LI+CPSVTP++GGA   L + L+  GF     D        + NL+AR
Sbjct: 1   MTETNPVEITRRLIECPSVTPEEGGALVYLADLLEGAGFVCTRVD-----RGGIANLFAR 55

Query: 60  FGTEAP--HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAV 117
            G +     L F GH DVVP GD   WT  PF A   +G ++GRG  DMK  +A ++AA 
Sbjct: 56  LGPKGARLTLGFNGHTDVVPVGDTGAWTVQPFGAEERDGHLWGRGATDMKSGVAAWVAAA 115

Query: 118 ARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDT 177
                   +  ++ L ITGDEEG A +GTK +L W+++ GE  DAC+VGEPTC   +G+ 
Sbjct: 116 MDATRDLPDDCALILAITGDEEGDATDGTKALLDWMDQNGEAMDACVVGEPTCPDTMGEM 175

Query: 178 IKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNME 237
           +KIGRRGS++   T  G QGH AYPH  +NP+  L  L+  L     D G   F  + + 
Sbjct: 176 MKIGRRGSMTAFFTARGVQGHAAYPHRAKNPVPALARLVSDLDAHVLDEGTAHFDASTLA 235

Query: 238 ITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFS 297
           +TT DVGNP+ NVIPA+ K + NIRFND      L + +++++ +           V   
Sbjct: 236 VTTFDVGNPATNVIPAEAKATVNIRFNDAHTSADLTDWLQAQMDRVAGETGIEIGMVVKV 295

Query: 298 SPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTM 357
           S     F+T    L+  ++ ++   TG  P++STSGGTSDARF+KD+CPV+EFGLVG+TM
Sbjct: 296 SG--ESFVTPPGPLSDTVAAAVEAETGLRPVMSTSGGTSDARFVKDHCPVVEFGLVGKTM 353

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H ++E   +  +  L  IY   ++++F 
Sbjct: 354 HQVDERVEIAQIGQLKSIYGRIIRDFFA 381


>gi|312884928|ref|ZP_07744618.1| succinyl-diaminopimelate desuccinylase [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309367405|gb|EFP94967.1| succinyl-diaminopimelate desuccinylase [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 377

 Score =  252 bits (642), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 157/382 (41%), Positives = 224/382 (58%), Gaps = 13/382 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L     LI+ PSVTP+D G   +++  LK LGF+IE   F+        N +AR GTE+
Sbjct: 6   TLALAKDLIRRPSVTPKDEGCQEVMIERLKALGFNIEVMVFED-----TTNFWARRGTES 60

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P  +FAGH DVVP G+   W YPPF  T+ +G ++GRG  DMKGS+A  + AV  FI   
Sbjct: 61  PLFVFAGHTDVVPAGNIEQWQYPPFEPTVKDGFLFGRGAADMKGSLASMVVAVEEFISTN 120

Query: 125 K-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
             + GSI  LIT DEEGP INGT +++  +  +GE  + CIVGEP+   I+GD IK GRR
Sbjct: 121 PDHQGSIGFLITSDEEGPFINGTVRVVDTLMARGENIEMCIVGEPSSTDIVGDVIKNGRR 180

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++G+ITI G QGHVAYPHL  NP+   +  L +LTN+ +D GN  F PT+ +I  I+ 
Sbjct: 181 GSITGDITIKGIQGHVAYPHLANNPVHHSLAALQELTNMEWDQGNKYFPPTSFQIPNINA 240

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NVIP ++K+ FN+RF+   N   +  ++ + L K   +     + + ++    P 
Sbjct: 241 GTGASNVIPGELKVQFNLRFSTELNNDIIMSKVIAVLDKHQLD-----YGIDWTFNGDPF 295

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
                  L   + K++ +     P L T+GGTSD RFI      V+E G V  T+H +NE
Sbjct: 296 LTD-TGALLESVVKAVNDVNQTEPQLLTTGGTSDGRFIARMGGQVVELGPVNATIHKVNE 354

Query: 363 NASLQDLEDLTCIYENFLQNWF 384
             +++DLE LT +Y+  ++N  
Sbjct: 355 CVNIEDLEKLTNMYKKTMENLL 376


>gi|254805296|ref|YP_003083517.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           alpha14]
 gi|254668838|emb|CBA06878.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           alpha14]
          Length = 381

 Score =  252 bits (642), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 168/391 (42%), Positives = 225/391 (57%), Gaps = 14/391 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    LE   +LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R
Sbjct: 1   MTETQSLELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGD-----TKNIWLR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+AP + FAGH DVVP G    W  PPF     +G++YGRG  DMK SIACF+ A  R
Sbjct: 56  RGTKAPVVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACER 115

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ ++  + GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GD I
Sbjct: 116 FVAEHPDHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVDKLGDMI 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I
Sbjct: 176 KNGRRGSLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S 
Sbjct: 236 SNINGGTGATNVIPGELSVKFNFRFSTESTEAGLKQRVHAILDK-----HGVQYDLQWSC 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTM 357
              P FLTH  KLT +   +I    G    LST+GGTSD RFIK     +IE G    T+
Sbjct: 291 SGQP-FLTHAGKLTDVARAAIAEICGVETELSTTGGTSDGRFIKAIAKELIELGPSNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFITPS 388
           H +NEN  L D+  L+ +YE  L       +
Sbjct: 350 HQINENVRLDDIPKLSAVYEGILARLLAGNA 380


>gi|254452230|ref|ZP_05065667.1| succinyl-diaminopimelate desuccinylase [Octadecabacter antarcticus
           238]
 gi|198266636|gb|EDY90906.1| succinyl-diaminopimelate desuccinylase [Octadecabacter antarcticus
           238]
          Length = 380

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 161/386 (41%), Positives = 218/386 (56%), Gaps = 9/386 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D +     LI+CPSVTP +GGA  +L   L   GF     D          NLYAR+
Sbjct: 1   MPVDPIALTADLIRCPSVTPVEGGALQLLDRLLSDAGFETWRVDRAD-----TPNLYARW 55

Query: 61  GTEA--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
           G         F GH DVVP GD   WT  PF   I +G +YGRG  DMK  +A F AA  
Sbjct: 56  GARGANKSFGFNGHTDVVPVGDAAAWTVDPFGGEIRDGILYGRGATDMKSGVAAFAAAAI 115

Query: 119 RFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
            F+      G+I L ITGDEEG + +GT  +L W++  GE   ACIVGEPTC  ++G+ I
Sbjct: 116 DFVQDTPPDGAIILAITGDEEGASTDGTIALLDWMQSNGEAMTACIVGEPTCQDVMGEMI 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K+GRRGSL+   T+ GKQGH AYPH   NP+  +  L+ +L +   D G+  F P+ + +
Sbjct: 176 KVGRRGSLTSHFTVTGKQGHSAYPHRANNPLPAMARLMDRLASHEMDAGSDHFDPSTLAV 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
            TID GNP+ NVIPA  K S N+RFNDL+   T+   ++  +                 S
Sbjct: 236 VTIDTGNPATNVIPAICKASANVRFNDLYTSHTVIAWMQGEVDAVAAEFRVQIDIDTRVS 295

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
                F+T   +L+ L+S ++   TG  P LST+GGTSDARF+K++CPV+E GLVG+TMH
Sbjct: 296 G--ESFVTPPGELSDLISAAVLAETGITPELSTTGGTSDARFVKNHCPVVEVGLVGKTMH 353

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E   ++ +  L  IY   L+++F
Sbjct: 354 QVDECVPVEQITQLKAIYARILRDYF 379


>gi|309378734|emb|CBX22684.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 381

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 168/391 (42%), Positives = 224/391 (57%), Gaps = 14/391 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    LE    LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R
Sbjct: 1   MTETQSLELAKALISRPSVTPDDQNCQKLLAERLHKIGFAAEELHFGD-----TKNIWLR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+AP + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK  IACF+ A  R
Sbjct: 56  RGTKAPVVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTGIACFVTACER 115

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ ++  + GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD I
Sbjct: 116 FVAEHPDHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMI 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I
Sbjct: 176 KNGRRGSLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S 
Sbjct: 236 SNINGGTGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDK-----HGVQYDLQWSC 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTM 357
              P FLTH  KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+
Sbjct: 291 SGQP-FLTHAGKLTDVARAAIAETCGVETELSTTGGTSDGRFIKAIAKELIELGPSNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFITPS 388
           H +NEN  L D+  L+ +YE  L       +
Sbjct: 350 HQINENVRLDDIPKLSAVYEGILARLLAGNA 380


>gi|302381744|ref|YP_003817567.1| succinyl-diaminopimelate desuccinylase [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302192372|gb|ADK99943.1| succinyl-diaminopimelate desuccinylase [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 395

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 170/382 (44%), Positives = 226/382 (59%), Gaps = 6/382 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSI----VKNLYAR 59
           D +E    LI+ PSVTP D GA   L   L  LGF+     F+    +     ++NLYAR
Sbjct: 10  DPVELTRDLIRRPSVTPVDAGAMDTLERVLTGLGFTCRRMAFEGSTGAATDARIENLYAR 69

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT +P+L FAGH DVVP G+   W+  PF A +  G +YGRG VDMKG IA ++AAV++
Sbjct: 70  RGTASPNLCFAGHTDVVPTGEAAAWSSDPFEAEVRNGLLYGRGAVDMKGGIAAWVAAVSQ 129

Query: 120 FIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
            +   +  GS+S LITGDEEGPA++GTKK++  +  +GE  DAC+VGEP+    +GD IK
Sbjct: 130 ILADGEPAGSLSFLITGDEEGPALHGTKKVVEALMAEGEVIDACVVGEPSSQTQLGDMIK 189

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGSL+  IT+HGKQGHVAYP    NP   L+ LL  L     D G   F P+N+EIT
Sbjct: 190 IGRRGSLNTWITVHGKQGHVAYPARAANPAPVLVRLLAALDAHVLDEGYEAFQPSNLEIT 249

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           TID+GNP+ NVIPA+ +   NIRFN       L + +     +            H  S 
Sbjct: 250 TIDIGNPATNVIPAEARARLNIRFNPAQTGDGLIDWLNREAGRVQAETGLQITLEHMCSG 309

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
               FLT      + +  ++  +TG  P  ST+GGTSDARFI+  CPV+E GLVG+TMH 
Sbjct: 310 --EAFLTPHGPFVTAVQDAVEASTGVRPEASTTGGTSDARFIRAMCPVLELGLVGQTMHQ 367

Query: 360 LNENASLQDLEDLTCIYENFLQ 381
           ++E   + +L  LT  Y   ++
Sbjct: 368 VDERVPVAELVALTAAYRRVIE 389


>gi|127512790|ref|YP_001093987.1| succinyl-diaminopimelate desuccinylase [Shewanella loihica PV-4]
 gi|238055161|sp|A3QE30|DAPE1_SHELP RecName: Full=Succinyl-diaminopimelate desuccinylase 1; Short=SDAP
           desuccinylase 1; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase 1
 gi|126638085|gb|ABO23728.1| succinyldiaminopimelate desuccinylase [Shewanella loihica PV-4]
          Length = 376

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 151/386 (39%), Positives = 211/386 (54%), Gaps = 13/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+ D L     LI   SVTP D G   ++   L   GF+IE   F+        N++AR 
Sbjct: 1   MSQDVLTLAQDLIARASVTPLDEGCQPLMAKRLAAKGFNIEPMVFED-----TTNMWARR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G + P   FAGH DVVP GD N W  PPF   + +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GDQGPLFCFAGHTDVVPVGDLNRWHTPPFEPVVIDGYLHGRGAADMKGSLAAMVVATERF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + K+ +  GSI+ LIT DEEGP INGT +++  +E + EK    +VGEP+  H +GD +K
Sbjct: 116 VDKHPDHKGSIAFLITSDEEGPFINGTTRVIDTLEARNEKITWSLVGEPSSTHKLGDIVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+G +T+ G QGHVAYPHL +NPI    P L +L  + +D GN  F PT+ +I 
Sbjct: 176 NGRRGSLTGNLTVKGVQGHVAYPHLADNPIHKAAPALDELARMKWDNGNEFFPPTSFQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NVIP  +++ FN R++     + L + + + L     +   L + + +   
Sbjct: 236 NINGGTGASNVIPGSLEVMFNFRYSTEVTAEILIQRVLNIL-----DAHGLDYDISWIFN 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P        L     ++IY  TG      TSGGTSD RFI      VIE G V  T+H
Sbjct: 291 GLPFLTDA-GPLLDATREAIYEITGTETDPQTSGGTSDGRFIAPTGAQVIELGPVNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            +NE   ++D+E L  +YE  L+   
Sbjct: 350 KVNECVKVEDIEQLAKVYERILEKLL 375


>gi|226940852|ref|YP_002795926.1| succinyl-diaminopimelate desuccinylase [Laribacter hongkongensis
           HLHK9]
 gi|254767083|sp|C1D8X7|DAPE_LARHH RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|226715779|gb|ACO74917.1| Succinyl-diaminopimelate desuccinylase [Laribacter hongkongensis
           HLHK9]
          Length = 376

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 155/387 (40%), Positives = 228/387 (58%), Gaps = 14/387 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M P  LE   +LI+  S TP D G   +++  L+ +GF++E   F       V N +AR 
Sbjct: 1   MNP-TLELACELIRRNSTTPDDAGCQELMIARLERIGFTVERMRFGE-----VDNFWARR 54

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G+++P L FAGH DVVP G    W   PF     +G ++GRG  DMK S+A F+ A+  F
Sbjct: 55  GSDSPTLCFAGHTDVVPTGPLTAWHSDPFEPVERDGHLFGRGAADMKASLAAFVTAIEDF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  + +  GSI+LL+T DEEG A++GT+ ++  +  +GE +D CIVGEPT     GDTIK
Sbjct: 115 VAGHPDHKGSIALLVTSDEEGVAVHGTRAVVETLAARGETFDWCIVGEPTSARQFGDTIK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSLSG++T+ G QGH+AYPHL  NP+  L P L +L  I +D GN  F PT+ +++
Sbjct: 175 NGRRGSLSGKLTVKGVQGHIAYPHLARNPVHLLAPALAELAAIRWDEGNAHFPPTSWQVS 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  + N+IP  V++ FN RF+       LK  + S L +   +     + + ++  
Sbjct: 235 NIHGGTGATNIIPGTVEVQFNFRFSTEQTADGLKNAVHSLLDRHGLD-----YELEWNLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMH 358
            +P FLT    L + +  ++ + TG +P L+TSGGTSD RFIKD C  V+EFG +  T+H
Sbjct: 290 GNP-FLTATGDLIAAIETAVKDVTGIMPELNTSGGTSDGRFIKDVCREVVEFGPLNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            +NE  +++D+  L+ IY   L +   
Sbjct: 349 KVNECVAVEDVPKLSEIYRRTLASLLA 375


>gi|326794428|ref|YP_004312248.1| Succinyl-diaminopimelate desuccinylase [Marinomonas mediterranea
           MMB-1]
 gi|326545192|gb|ADZ90412.1| Succinyl-diaminopimelate desuccinylase [Marinomonas mediterranea
           MMB-1]
          Length = 388

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 164/386 (42%), Positives = 224/386 (58%), Gaps = 14/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           +TP  LE  I L+   SVTP+D G    ++  L+ +GF++E+  F       VKN YA+ 
Sbjct: 14  LTP-TLELAIDLMSRASVTPEDAGCQETMIKRLEKIGFTVEKMPFGD-----VKNFYAKR 67

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G + P+L FAGH DVVP G    W  PPF   I +G +YGRG  DMKGS+A  I AV RF
Sbjct: 68  GNDGPNLCFAGHTDVVPTGPEAEWKVPPFEPQIIDGILYGRGAADMKGSLASMIIAVERF 127

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           I    N  G IS LIT DEEGP ++GT +++  +  + EK D CIVGEP+  + +GD IK
Sbjct: 128 IDNNPNHKGQISFLITSDEEGPFVDGTTRVVDTLMARNEKVDWCIVGEPSSTNTLGDIIK 187

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS SG++T+ GKQGHVAYPHL +NPI    P + +L+   +D GN  F PT+ +++
Sbjct: 188 NGRRGSFSGDLTVFGKQGHVAYPHLAKNPIHLASPAITELSETVWDQGNDFFPPTSFQVS 247

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NV+P  +   FN RF+   +  +LKE++ S L K   N     + V ++  
Sbjct: 248 NINAGTGATNVVPGTLNAQFNFRFSSELDFDSLKEKVISILDKHELN-----YEVDWTYN 302

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P       +L   ++K+I  T    P LSTSGGTSD RFI      V+E G +  T+H
Sbjct: 303 GLPFLTRP-GELVDAITKAIEKTVDITPTLSTSGGTSDGRFIAKMGTQVVELGPINATIH 361

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            +NE+     L  LT IYE  L+N F
Sbjct: 362 QINEHIEANSLNQLTSIYEGVLENLF 387


>gi|261365438|ref|ZP_05978321.1| succinyl-diaminopimelate desuccinylase [Neisseria mucosa ATCC
           25996]
 gi|288566103|gb|EFC87663.1| succinyl-diaminopimelate desuccinylase [Neisseria mucosa ATCC
           25996]
          Length = 381

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 169/391 (43%), Positives = 225/391 (57%), Gaps = 14/391 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    LE   +LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R
Sbjct: 1   MTDTQSLELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHF-----GNTKNIWLR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+AP + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK SIACF+ A  R
Sbjct: 56  RGTKAPVVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTSIACFVTACER 115

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ ++  + GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD I
Sbjct: 116 FVAEHPDHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMI 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG +T+ GKQGH+AYPHL  NP     P L +LT   +D GN  F PT+ +I
Sbjct: 176 KNGRRGSLSGNLTVKGKQGHIAYPHLAINPAHTFAPALLELTQEVWDEGNEYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S 
Sbjct: 236 SNINGGTGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDK-----HGVQYDLQWSC 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTM 357
              P FLTH  KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+
Sbjct: 291 SGQP-FLTHAGKLTDVARAAIAETCGVETELSTTGGTSDGRFIKAIAKELIELGPSNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFITPS 388
           H +NEN  L D+  L+ +YE  L       +
Sbjct: 350 HQINENVRLDDIPKLSAVYEGILARLLAEKA 380


>gi|50084006|ref|YP_045516.1| succinyl-diaminopimelate desuccinylase [Acinetobacter sp. ADP1]
 gi|81393640|sp|Q6FE14|DAPE_ACIAD RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|49529982|emb|CAG67694.1| succinyl-diaminopimelate desuccinylase [Acinetobacter sp. ADP1]
          Length = 377

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 154/385 (40%), Positives = 221/385 (57%), Gaps = 13/385 (3%)

Query: 3   PDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT 62
            D L+  + L++ PSVTP+D     ++   L   GF IE   F       V NL+AR GT
Sbjct: 4   SDTLDLSLNLMRRPSVTPEDHDCQAVMAERLAKAGFQIENMRFDD-----VDNLWARRGT 58

Query: 63  EAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIP 122
           + P   FAGH DVVP G+ ++W   PF+  + +G +YGRG  DMK ++A  + A  RF+ 
Sbjct: 59  QQPVFCFAGHTDVVPTGNLDNWNSDPFAPEVRDGILYGRGAADMKTALAAMVVASERFVE 118

Query: 123 KYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
           K+ N  GSI+ LIT DEEGP+INGT K++  +E + EK   C+VGEP+  H +GD IK G
Sbjct: 119 KHPNHKGSIAFLITSDEEGPSINGTVKVIETLEARHEKMTWCLVGEPSSTHQLGDIIKNG 178

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSL+  +TI GKQGHVAYPHL  NPI      +H+L    +D GN  F  T+ +I+ I
Sbjct: 179 RRGSLNAVLTIKGKQGHVAYPHLARNPIHLASAAIHELCETVWDQGNEYFPATSFQISNI 238

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
             G  + NV+P  + ++FN R++     + LKE +   L +   +     + + ++    
Sbjct: 239 HAGTGATNVVPGTMAVTFNFRYSTEVTAEQLKERVVEVLQRHGLD-----YDIVWTHSGL 293

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHAL 360
           P FLT   +L +  + +I   TG    LSTSGGTSD RFI      V+E G++  ++H +
Sbjct: 294 P-FLTPVGELVNAATHAIKTVTGVDTQLSTSGGTSDGRFIAPTGAQVLELGVLNASIHQI 352

Query: 361 NENASLQDLEDLTCIYENFLQNWFI 385
           NE+ ++ DLE L  IYE  L+    
Sbjct: 353 NEHVNVADLEPLAEIYEKILEQLLA 377


>gi|85705193|ref|ZP_01036293.1| succinyl-diaminopimelate desuccinylase [Roseovarius sp. 217]
 gi|85670515|gb|EAQ25376.1| succinyl-diaminopimelate desuccinylase [Roseovarius sp. 217]
          Length = 383

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 155/384 (40%), Positives = 223/384 (58%), Gaps = 9/384 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D       LI+C SVTP++GGA  +L   L   GF+    D        + NL+AR+G +
Sbjct: 7   DAARLTADLIRCASVTPEEGGALQLLEQVLTGAGFTCVRVD-----RGGIANLFARWGEK 61

Query: 64  A--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
                  F GH DVVP GD   W+ PPF A    G ++GRG  DMK ++A F+AA    +
Sbjct: 62  GAARAFGFNGHTDVVPVGDVEAWSVPPFGAVEKAGMLWGRGATDMKSAVAAFVAAAVDMV 121

Query: 122 PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
                 G+I + ITGDEEG A++GT  +L W+    E+  AC+VGEPTC   +G+ IKIG
Sbjct: 122 RDAPPKGAIIITITGDEEGDAVDGTVALLDWMAANDERMTACLVGEPTCPERMGEMIKIG 181

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSLS    + G QGH AYPH  +NP+  +  L+ +L +   D+G   F P+ + + TI
Sbjct: 182 RRGSLSAWFALTGVQGHSAYPHRAKNPLPAMARLMDRLASHTLDSGTAHFDPSTLAVVTI 241

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
           D GNP+ NVIPA  + + NIRFND    ++L   +++ L  G+ +   ++  +       
Sbjct: 242 DTGNPATNVIPASCRATVNIRFNDAHTSQSLIAWMQAEL-DGVSDEFGVACEMRVKVSG- 299

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALN 361
             FLT    L+ L+++++   TG  P+LST+GGTSDARF+KD+CPV+EFGLVG+TMH ++
Sbjct: 300 ESFLTPPGPLSDLVTRAVEAETGVKPVLSTTGGTSDARFVKDHCPVVEFGLVGQTMHQVD 359

Query: 362 ENASLQDLEDLTCIYENFLQNWFI 385
           E   +  +  L  IY   L ++F 
Sbjct: 360 ERVEVAQIHQLKAIYARILSDYFA 383


>gi|56698156|ref|YP_168528.1| succinyl-diaminopimelate desuccinylase [Ruegeria pomeroyi DSS-3]
 gi|81349000|sp|Q5LN80|DAPE_SILPO RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|56679893|gb|AAV96559.1| succinyl-diaminopimelate desuccinylase [Ruegeria pomeroyi DSS-3]
          Length = 380

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 161/390 (41%), Positives = 225/390 (57%), Gaps = 15/390 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT D       LI+C SVTP D GA  +L   L   GFS    D        + NL+AR+
Sbjct: 1   MTLDAARLTADLIRCASVTPADDGALDVLERVLSQAGFSCTRVD-----RGGICNLFARW 55

Query: 61  GTEA--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
           G +       F GH DVVP GD   WT  PF A   +G +YGRG  DMK  +A F+AA  
Sbjct: 56  GDKGHARSFGFNGHTDVVPVGDAAAWTVAPFGAEEKDGFLYGRGATDMKSGVAAFVAAAV 115

Query: 119 RFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
             +      G++ + ITGDEEG A++GTK +L ++   GE+   C+VGEPTC   +G+ I
Sbjct: 116 DLVTTTPPEGAVIVTITGDEEGDALDGTKALLDYMAASGERMSVCLVGEPTCPDRMGEMI 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGS++   T+ G QGH AYPH  +NP+  +  L+ +L + G D G   F P+ + +
Sbjct: 176 KIGRRGSMTAWFTVTGVQGHSAYPHRAKNPLPAMARLMDRLASHGLDQGTDHFDPSTLAV 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIR---SRLIKGIQNVPKLSHTVH 295
            TID GN + NVIPAQ + + NIRFNDL +  +L   ++    R+ +      ++   + 
Sbjct: 236 VTIDTGNTATNVIPAQCRGAVNIRFNDLHSGASLTGWMQGEADRVAEEFGVAVEMKVKIS 295

Query: 296 FSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGR 355
             S     FLT   +L+ L++ ++   TG  P+LSTSGGTSDARF+KD+CPV+EFGLVGR
Sbjct: 296 GES-----FLTPPGELSDLVAAAVEAETGVTPVLSTSGGTSDARFVKDHCPVVEFGLVGR 350

Query: 356 TMHALNENASLQDLEDLTCIYENFLQNWFI 385
           TMH ++E   +  +  L  IY   L+++F 
Sbjct: 351 TMHQVDERVEIAQIHQLKAIYGRILRDFFA 380


>gi|261380040|ref|ZP_05984613.1| succinyl-diaminopimelate desuccinylase [Neisseria subflava NJ9703]
 gi|284797248|gb|EFC52595.1| succinyl-diaminopimelate desuccinylase [Neisseria subflava NJ9703]
          Length = 377

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 169/387 (43%), Positives = 228/387 (58%), Gaps = 14/387 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    LE   +LI  PSVTP D     +L   L+ +GF++EE  F        KN++ R
Sbjct: 1   MTETQSLELAKELISRPSVTPDDQNCQQLLAERLQKIGFAVEELHFGD-----TKNIWLR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+AP   FAGH DVVP G    W  PPF  T  E ++YGRG  DMK SIACF+ A  R
Sbjct: 56  RGTQAPVFCFAGHTDVVPTGPVEKWDSPPFEPTEREDRLYGRGAADMKTSIACFVTACER 115

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ +Y  + GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GD +
Sbjct: 116 FVAEYPDHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVDKLGDML 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG +TI GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I
Sbjct: 176 KNGRRGSLSGNLTIKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP ++ + FN RF+    E+ LK+ + + L K       + + + +S 
Sbjct: 236 SNINGGTGATNVIPGELNVKFNFRFSTESTEEGLKQRVHTILDK-----HGVQYDLQWSC 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTM 357
              P FLT   KLT +  ++I    G    LST+GGTSD RFIK     +IE G    T+
Sbjct: 291 SGQP-FLTQAGKLTDVAREAIAEICGVEAELSTTGGTSDGRFIKAIAKELIELGPSNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWF 384
           H +NEN  L+D+  L+ +YE  L+   
Sbjct: 350 HQINENVRLEDIPKLSAVYEGMLKRLL 376


>gi|15964178|ref|NP_384531.1| succinyl-diaminopimelate desuccinylase [Sinorhizobium meliloti
           1021]
 gi|307301322|ref|ZP_07581084.1| succinyl-diaminopimelate desuccinylase [Sinorhizobium meliloti
           BL225C]
 gi|81635219|sp|Q92SH1|DAPE_RHIME RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|15073354|emb|CAC41862.1| Probable succinyl-diaminopimelate desuccinylase [Sinorhizobium
           meliloti 1021]
 gi|306903778|gb|EFN34365.1| succinyl-diaminopimelate desuccinylase [Sinorhizobium meliloti
           BL225C]
          Length = 397

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 214/388 (55%), Positives = 264/388 (68%), Gaps = 7/388 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D + +L  LI+CPSVTP +GGA   L   L  +GF ++    +   T  ++NLYAR G E
Sbjct: 5   DPVSNLAALIRCPSVTPAEGGALAALEAMLAPVGFKVDRVVAKEPGTPDIENLYARTGGE 64

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            PHLMFAGH DVVP GD   W+ PPFSA IAEG++YGRG VDMKG IACF+AAVAR I K
Sbjct: 65  GPHLMFAGHTDVVPVGDEAAWSRPPFSAAIAEGEMYGRGAVDMKGGIACFVAAVARHIEK 124

Query: 124 YK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
           +    GSIS LITGDEEGPAINGT K+L W   +GE+WDAC+VGEPT    IGD IKIGR
Sbjct: 125 HGAPKGSISFLITGDEEGPAINGTVKLLEWAAARGERWDACLVGEPTNPDCIGDMIKIGR 184

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSLSG IT+HG QGH AYPHL +NP+R ++ +   L +  FD G   F P+N+E+TTID
Sbjct: 185 RGSLSGRITVHGVQGHAAYPHLADNPVRSILQIAQALMDPPFDDGTENFQPSNLEVTTID 244

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKG------IQNVPKLSHTVHF 296
           VGN + NVIPA+   +FNIRFND W  ++L  EI +RL +               + + +
Sbjct: 245 VGNTAVNVIPAKASAAFNIRFNDRWTAESLMAEIVARLDRAAAGSALRPGRAPARYEIVW 304

Query: 297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRT 356
           +   S VFLT +  L   LS ++   TG  P LST+GGTSDARFIKDYCPV+EFGLVG+T
Sbjct: 305 NERPSHVFLTRNNALIDSLSGAVEAVTGRQPQLSTTGGTSDARFIKDYCPVVEFGLVGKT 364

Query: 357 MHALNENASLQDLEDLTCIYENFLQNWF 384
           MH ++E  +L DLE LT IYE F+  WF
Sbjct: 365 MHMVDERVALADLETLTGIYETFIARWF 392


>gi|152978483|ref|YP_001344112.1| succinyl-diaminopimelate desuccinylase [Actinobacillus succinogenes
           130Z]
 gi|238055199|sp|A6VMI0|DAPE_ACTSZ RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|150840206|gb|ABR74177.1| succinyl-diaminopimelate desuccinylase [Actinobacillus succinogenes
           130Z]
          Length = 376

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 150/386 (38%), Positives = 215/386 (55%), Gaps = 13/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  + +E    LI+ PSV+P D G   ++   L+ LGF+IE   F     +   NL+A+ 
Sbjct: 1   MKHNIIELAQNLIRRPSVSPDDQGCQQMIAQRLEKLGFTIEWMPF-----NNTLNLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G  AP + FAGH DVVP GD + W YPPF A I +  +YGRG  DMKGS+A  + A   +
Sbjct: 56  GCGAPVIAFAGHTDVVPTGDKSQWVYPPFEAEIVDDMLYGRGAADMKGSLAAMVVAAEEY 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G+I+ LIT DEE  A +GT +++  +  +GEK D C+VGEP+ +  +GD +K
Sbjct: 116 VKANPNHAGTIAFLITSDEEAAAKDGTVRVVETLMARGEKIDFCMVGEPSSSKTLGDIVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++G + I G  GHVAYPHL ENP+   +P L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSVTGNLYIEGVLGHVAYPHLAENPVHKALPFLQELTAYQWDNGNEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN+R+     ++ +K  +   L K         + + ++  
Sbjct: 236 NIQAGTGSNNVIPGELYVQFNLRYCTEVTDEFIKNTVAEMLKKHGLA-----YRIEWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P FLT   KL   +  S+ +  G  P L T GGTSD RFI      V+E G +  T+H
Sbjct: 291 GKP-FLTEPGKLVDAVVDSLESVAGVKPKLDTGGGTSDGRFIALMGAEVVELGPLNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E  S+ DL  L  +Y   L N  
Sbjct: 350 KVDERVSVTDLVTLGAVYNQMLVNLL 375


>gi|238064721|sp|B0T134|DAPE_CAUSK RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 387

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 171/383 (44%), Positives = 227/383 (59%), Gaps = 9/383 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +     LI+ PSVTP D GA  +L   L+ LGF+     F       ++NLYAR GTE
Sbjct: 12  DSVALAQALIRRPSVTPADEGAMDVLQRQLEALGFNCRRMKFGE-----IENLYARRGTE 66

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            P+L FAGH DVVP GD   WT  PF A I +G +YGRG VDMK +IA F+AAV+     
Sbjct: 67  RPNLCFAGHTDVVPVGDSAAWTQGPFEAEIQDGMLYGRGAVDMKSAIAAFVAAVSNLPRD 126

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               GS+S LITGDEEG A +GT +++  +  +GE  D CIVGEPT  +++GD +KIGRR
Sbjct: 127 LP--GSLSFLITGDEEGVAEDGTVRVVQALAAEGEVIDHCIVGEPTSANLLGDMVKIGRR 184

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++  I + G+QGHVAYP    NPI  ++ +L +L +   D G   F P+N+E+TTIDV
Sbjct: 185 GSINAWIAVDGRQGHVAYPQRAANPIPVMVDILSRLQSRVLDEGYEGFQPSNLEVTTIDV 244

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GN + NVIPA  K   NIRFN     K L+  I                 +         
Sbjct: 245 GNTATNVIPASAKARINIRFNPAHQGKDLRAWIEQECRDAADGFSGRVEALCKIGG--EA 302

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           FLT     T ++  ++ + TG +P LST+GGTSDARFI+  CPV+EFGLVG TMHA++E 
Sbjct: 303 FLTQPGAFTDVIVAAVGDATGRVPELSTTGGTSDARFIRSLCPVVEFGLVGATMHAVDER 362

Query: 364 ASLQDLEDLTCIYENFLQNWFIT 386
             +Q++ DL  IY+  +  +F  
Sbjct: 363 VPVQEIRDLANIYQALIGRYFAA 385


>gi|167648517|ref|YP_001686180.1| succinyl-diaminopimelate desuccinylase [Caulobacter sp. K31]
 gi|167350947|gb|ABZ73682.1| succinyl-diaminopimelate desuccinylase [Caulobacter sp. K31]
          Length = 388

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 171/383 (44%), Positives = 227/383 (59%), Gaps = 9/383 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +     LI+ PSVTP D GA  +L   L+ LGF+     F       ++NLYAR GTE
Sbjct: 13  DSVALAQALIRRPSVTPADEGAMDVLQRQLEALGFNCRRMKFGE-----IENLYARRGTE 67

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            P+L FAGH DVVP GD   WT  PF A I +G +YGRG VDMK +IA F+AAV+     
Sbjct: 68  RPNLCFAGHTDVVPVGDSAAWTQGPFEAEIQDGMLYGRGAVDMKSAIAAFVAAVSNLPRD 127

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               GS+S LITGDEEG A +GT +++  +  +GE  D CIVGEPT  +++GD +KIGRR
Sbjct: 128 LP--GSLSFLITGDEEGVAEDGTVRVVQALAAEGEVIDHCIVGEPTSANLLGDMVKIGRR 185

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++  I + G+QGHVAYP    NPI  ++ +L +L +   D G   F P+N+E+TTIDV
Sbjct: 186 GSINAWIAVDGRQGHVAYPQRAANPIPVMVDILSRLQSRVLDEGYEGFQPSNLEVTTIDV 245

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GN + NVIPA  K   NIRFN     K L+  I                 +         
Sbjct: 246 GNTATNVIPASAKARINIRFNPAHQGKDLRAWIEQECRDAADGFSGRVEALCKIGG--EA 303

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           FLT     T ++  ++ + TG +P LST+GGTSDARFI+  CPV+EFGLVG TMHA++E 
Sbjct: 304 FLTQPGAFTDVIVAAVGDATGRVPELSTTGGTSDARFIRSLCPVVEFGLVGATMHAVDER 363

Query: 364 ASLQDLEDLTCIYENFLQNWFIT 386
             +Q++ DL  IY+  +  +F  
Sbjct: 364 VPVQEIRDLANIYQALIGRYFAA 386


>gi|158422176|ref|YP_001523468.1| succinyl-diaminopimelate desuccinylase [Azorhizobium caulinodans
           ORS 571]
 gi|158329065|dbj|BAF86550.1| proteobacterial succinyl-diaminopimelate desuccinylase
           [Azorhizobium caulinodans ORS 571]
          Length = 390

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 181/385 (47%), Positives = 239/385 (62%), Gaps = 8/385 (2%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           +   L     LI+ PSVTP  G A  ++ + LK  G+ +E   F T     V NLYAR G
Sbjct: 11  SDQALAFAKALIQAPSVTPDAGQALDVVADALKAAGYHVERLVFSTAGVP-VDNLYARIG 69

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
           T +P+L FAGH+DVVPPGD   W + PFS  + +G +YGRG VDMKG++A F    A   
Sbjct: 70  TASPNLCFAGHVDVVPPGDAASWRHGPFSGAVEDGVLYGRGAVDMKGAVAAF--LAAALA 127

Query: 122 PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
                 GS+S LITGDEEGP+I+GT K++ W+  KGE  D CIVGEPT  + +GD +KIG
Sbjct: 128 YGAPAQGSLSFLITGDEEGPSIDGTAKVVDWLAAKGEVIDHCIVGEPTNPNALGDMVKIG 187

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSLSG IT+ G+QGHVAYPHL +NP+  L+ LL  LT    D G+  F P+N+E+ ++
Sbjct: 188 RRGSLSGLITVEGRQGHVAYPHLADNPVPRLVRLLTALTAAPLDNGSAHFPPSNLEVISV 247

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
           DVGN + NVIP      FN+R+NDL++ ++L  EI  RL    +      + + F    S
Sbjct: 248 DVGNTAYNVIPGAATAKFNVRYNDLYSLESLMAEIARRLDTAGE-----PYVLTFRDGAS 302

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALN 361
             FLT        +  ++ + TG  P +ST+GGTSDARFIK  CPV+EFGLVG+TMH +N
Sbjct: 303 ESFLTAPGPFVETVLDAVADVTGQRPQMSTTGGTSDARFIKSLCPVVEFGLVGQTMHMVN 362

Query: 362 ENASLQDLEDLTCIYENFLQNWFIT 386
           E   + DL  LT IYE  +  +F T
Sbjct: 363 EATPVADLTALTAIYERLIARYFAT 387


>gi|332533563|ref|ZP_08409425.1| N-succinyl-L,L-diaminopimelate desuccinylase [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332036965|gb|EGI73424.1| N-succinyl-L,L-diaminopimelate desuccinylase [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 376

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 158/387 (40%), Positives = 221/387 (57%), Gaps = 13/387 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D ++    LI+  SVTP+D G   ++ + L  +GF+IE   F         N +AR 
Sbjct: 1   MKDDVIKLAQALIQRESVTPEDAGCQQMMNDRLAAVGFNIESLFFTD-----TLNTWARK 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT++PH  FAGH DVVP G   +W +PPFS  I +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GTQSPHFCFAGHTDVVPTGPEKNWQHPPFSGLIKDGLLHGRGAADMKGSLAAMLVATERF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + K+ +  GSIS LIT DEEGP INGT +++  +E +GEK D C+VGEP+   ++GD +K
Sbjct: 116 VTKHPDHKGSISFLITSDEEGPFINGTTRVIDTLEARGEKIDMCLVGEPSSRDVLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +T+ G QGHVAYPHL +NPI    P L +L+   +D GN  F  T+ +I+
Sbjct: 176 NGRRGSLTAFLTVKGVQGHVAYPHLAQNPIHLATPALTELSQTVWDNGNEYFPATSFQIS 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NVIP ++++ FN RF+     + L+  +   L K   N     + + +   
Sbjct: 236 NINGGTGAGNVIPGELEVQFNFRFSTQVTHEQLQHRVNDILQKHNLN-----YELSWIVN 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P F+T    L     K+I + TG    L T+GGTSD RFI      VIE G    T+H
Sbjct: 291 GLP-FITEHGPLVDATVKAIKSVTGLTTNLETTGGTSDGRFIAQTGAKVIELGPRNETIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            ++E  S  DL  LT IYE  L+    
Sbjct: 350 KVDECVSTDDLIALTDIYEQILEQLLA 376


>gi|121635201|ref|YP_975446.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           FAM18]
 gi|238064802|sp|A1KUW7|DAPE_NEIMF RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|120866907|emb|CAM10666.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           FAM18]
          Length = 381

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 167/391 (42%), Positives = 224/391 (57%), Gaps = 14/391 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    LE   +LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R
Sbjct: 1   MTETQSLELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGD-----TKNIWLR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+AP + FAGH DVVP G    W  PPF     +G++YGRG  DMK SIACF+ A  R
Sbjct: 56  RGTKAPVVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACER 115

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ ++  + GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD I
Sbjct: 116 FVAEHPDHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMI 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I
Sbjct: 176 KNGRRGSLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S 
Sbjct: 236 SNINGGTGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDK-----HGVQYDLQWSC 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTM 357
              P FLT   KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+
Sbjct: 291 SGQP-FLTQAGKLTDVARAAIAETCGIEAELSTTGGTSDGRFIKAIAKELIELGPSNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFITPS 388
           H +NEN  L D+  L+ +YE  L       +
Sbjct: 350 HQINENVRLDDIPKLSAVYEGILARLLAGNA 380


>gi|145637669|ref|ZP_01793323.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           PittHH]
 gi|145269129|gb|EDK09078.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           PittHH]
          Length = 377

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 155/388 (39%), Positives = 218/388 (56%), Gaps = 13/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +     LI+ PSV+P D G   ++   LK LGF IE   F     +   NL+A+ 
Sbjct: 1   MKEKVVSLAQNLIRRPSVSPNDEGCQQMIAERLKKLGFQIEWMPF-----NDTLNLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT+ P + FAGH DVVP GD N W+ PPFSA I +  +YGRG  DMKGS+A  I A   +
Sbjct: 56  GTDEPVIAFAGHTDVVPIGDENQWSSPPFSAKIIDSMLYGRGAADMKGSLAAMIVAAEEY 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G+I+LLIT DEE  A +GT +++  +  + EK   C+VGEP+    +GD +K
Sbjct: 116 VKANPNHKGTIALLITSDEEAAAKDGTVRVVETLMARDEKITYCMVGEPSSAKNLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++G + I G QGHVAYP+L ENPI    P L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITGNLYIQGIQGHVAYPYLAENPIHKAAPFLQELTTYQWDKGNEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIPA++ + FN+R+     ++ +K+++   L K         + + ++  
Sbjct: 236 NIHAGTGSNNVIPAELYIQFNLRYCTEVTDEIIKQKVAEMLEKHNLK-----YRIEWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P FLT   KL   ++ +I  TT  +P   T GGTSD RFI      V+EFG +  T+H
Sbjct: 291 GKP-FLTKPGKLLDSITSAIEETTCIMPKAETGGGTSDGRFIALMGAEVVEFGPLNTTIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFIT 386
            +NE  S++DL     IY   L N   +
Sbjct: 350 KVNECVSVEDLGKCGEIYHKMLVNLLDS 377


>gi|319639253|ref|ZP_07994004.1| succinyl-diaminopimelate desuccinylase [Neisseria mucosa C102]
 gi|317399437|gb|EFV80107.1| succinyl-diaminopimelate desuccinylase [Neisseria mucosa C102]
          Length = 377

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 169/387 (43%), Positives = 229/387 (59%), Gaps = 14/387 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    LE    LI  PSVTP D     +L   L+ +GF++EE  F        KN++ R
Sbjct: 1   MTETQSLELAKALISRPSVTPDDQNCQQLLAERLQKIGFAVEELHFGD-----TKNVWLR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+AP   FAGH DVVP G    W  PPF  T  EG++YGRG  DMK SIACF+ A  R
Sbjct: 56  RGTQAPVFCFAGHTDVVPTGPVEKWDSPPFEPTEREGRLYGRGAADMKTSIACFVTACER 115

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ ++  + GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GD +
Sbjct: 116 FVAEHPDHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVDKLGDML 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I
Sbjct: 176 KNGRRGSLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP ++ + FN RF+    E+ LK+ + + L K       + + + +S 
Sbjct: 236 SNINGGTGATNVIPGELNVKFNFRFSTESTEEGLKQRVHTILDK-----HGVQYDLQWSC 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTM 357
              P FLTH  KLT +  ++I    G    LST+GGTSD RFIK     +IE G    T+
Sbjct: 291 SGQP-FLTHAGKLTDVAREAIAEICGVEAELSTTGGTSDGRFIKAIAKELIELGPSNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWF 384
           H +NEN  L+D+  L+ +YE  L+   
Sbjct: 350 HQINENVRLEDIPKLSAVYEGMLKRLL 376


>gi|37680684|ref|NP_935293.1| succinyl-diaminopimelate desuccinylase [Vibrio vulnificus YJ016]
 gi|37199433|dbj|BAC95264.1| succinyl-diaminopimelate desuccinylase [Vibrio vulnificus YJ016]
          Length = 401

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 152/388 (39%), Positives = 213/388 (54%), Gaps = 14/388 (3%)

Query: 1   MTPD-CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    L     LI   SVTP+D G   +++  L+ LGF+IE   F+        N +AR
Sbjct: 25  MTDSPVLALTKDLISRQSVTPEDAGCQDVMIARLEALGFTIERMVFED-----TTNFWAR 79

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+AP   FAGH DVVP G   HW  PPF  T  EG +YGRG  DMKGS+A  I A  R
Sbjct: 80  RGTQAPLFAFAGHTDVVPAGKLEHWHTPPFEPTEKEGYLYGRGAADMKGSLAAMIVATER 139

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           FI ++  + GSI  LIT DEEGP INGT +++  +  + E  D CIVGEP+   ++GD +
Sbjct: 140 FIAEHPDHQGSIGFLITSDEEGPFINGTVRVVETLMARDENIDMCIVGEPSSTEVVGDVV 199

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGS++G++T+ G QGHVAYPHL +NP+   +  +H L    +D GN  F PT+ +I
Sbjct: 200 KNGRRGSITGDLTVIGTQGHVAYPHLADNPVHKSLLAIHALATTEWDKGNEYFPPTSFQI 259

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
             +  G  + NVIP +  + FN+RF+     + + E +   L +   N     + + ++ 
Sbjct: 260 PNVQAGTGASNVIPGEFHVQFNLRFSTELCNERIVERVTQTLDQHDLN-----YDLKWTY 314

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTM 357
              P        L   +  ++ +     P L T+GGTSD RFI      V+E G V  T+
Sbjct: 315 NGDPFLTD-TGALLDAVVDAVDSVNQTKPALLTTGGTSDGRFIARMGGQVVELGPVNATI 373

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H +NE   + DLE LT +Y+  L+N   
Sbjct: 374 HKVNECVKIDDLEKLTDMYQKTLENLLA 401


>gi|325132686|gb|EGC55370.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           M6190]
 gi|325138542|gb|EGC61105.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           ES14902]
          Length = 381

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 167/391 (42%), Positives = 224/391 (57%), Gaps = 14/391 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    LE   +LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R
Sbjct: 1   MTETQSLELAKELISRPSVTPDDQNCQKLLAERLHKIGFAAEELHFGD-----TKNIWLR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+AP + FAGH DVVP G    W  PPF     +G++YGRG  DMK SIACF+ A  R
Sbjct: 56  RGTKAPVVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACER 115

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ ++  + GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD I
Sbjct: 116 FVAEHPDHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMI 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I
Sbjct: 176 KNGRRGSLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNKYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S 
Sbjct: 236 SNINGGTGATNVIPGELSVKFNFRFSTESTEAGLKQRVHAILDK-----HGVQYDLQWSC 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTM 357
              P FLT   KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+
Sbjct: 291 SGQP-FLTQAGKLTDVARAAIAETCGIEAELSTTGGTSDGRFIKAIAKELIELGPSNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFITPS 388
           H +NEN  L D+  L+ +YE  L       +
Sbjct: 350 HQINENVRLDDIPKLSAVYEGILARLLAGNA 380


>gi|312115826|ref|YP_004013422.1| succinyl-diaminopimelate desuccinylase [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311220955|gb|ADP72323.1| succinyl-diaminopimelate desuccinylase [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 383

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 178/381 (46%), Positives = 230/381 (60%), Gaps = 4/381 (1%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT    E+   LI+C SVTP D GA   L   L   GF+ E   F    T+ V+NLYAR 
Sbjct: 1   MTSAT-EYAQTLIRCESVTPDDAGALAYLERELGAAGFACERLRFSEPGTADVENLYARL 59

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   PH+ FAGHIDVVPPGD   W  PPF+  I  G +YGRG VDMKG++A  +AA   +
Sbjct: 60  GDGTPHICFAGHIDVVPPGDEAAWRLPPFAGEIENGVLYGRGAVDMKGAVAASLAAALEY 119

Query: 121 IPKYKN-FGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + +  +  GSIS LIT DEEGP+INGT+K++  +  +GE+ DAC++GE T    + DTIK
Sbjct: 120 LREKPDLVGSISFLITADEEGPSINGTRKVVERLIARGERPDACVLGECTSEDAVADTIK 179

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGSL  E+ + G QGHVAYPH   NP+  LI  L +L     D G+  F P+N+EIT
Sbjct: 180 IGRRGSLGAELIVRGVQGHVAYPHKARNPLPALIDALTRLKARRLDDGSEHFQPSNLEIT 239

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           TID GN + N+IPAQ    FNIRFNDL     LK  I   +   + +   + HT++F  P
Sbjct: 240 TIDTGNKATNIIPAQASARFNIRFNDLHTAPQLKAWIEEEVAAALLDT-GVEHTLNFDQP 298

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
                 +       +L  ++   TG  P+LST GGTSDARFIKD CPV E GL+  T H 
Sbjct: 299 SDSFLTSPGG-FVKMLGAAVQAETGREPVLSTGGGTSDARFIKDMCPVAELGLLNATAHK 357

Query: 360 LNENASLQDLEDLTCIYENFL 380
           ++E+ +  D+E L  IY+ FL
Sbjct: 358 VDEHTATADIETLARIYKRFL 378


>gi|260581983|ref|ZP_05849778.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           NT127]
 gi|260094873|gb|EEW78766.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           NT127]
          Length = 377

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 155/388 (39%), Positives = 218/388 (56%), Gaps = 13/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +     LI+ PS++P D G   I+   L+ LGF IE   F     +   NL+A+ 
Sbjct: 1   MREKVISLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPF-----NDTLNLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT  P + FAGH DVVP GD N W+ PPFSA I +G +YGRG  DMKGS+A  I A   +
Sbjct: 56  GTSEPVIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEY 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G+I+LLIT DEE  A +GT +++  +  + EK   C+VGEP+    +GD +K
Sbjct: 116 VKANPNHKGTIALLITSDEEAAAKDGTIRVVETLMARDEKITYCMVGEPSSAKNLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++G + I G QGHVAYPHL ENPI    P L +LT   +D G+  F PT+++I 
Sbjct: 176 NGRRGSITGNLYIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDKGHEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIPA++ + FN+R+     ++ +K+++      G+     L + + ++  
Sbjct: 236 NIHAGTGSNNVIPAELYIQFNLRYCTEVTDEIIKQKV-----AGMLEKHNLKYRIEWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P FLT   KL   ++ +I  T G  P   T GGTSD RFI      V+EFG +  T+H
Sbjct: 291 GKP-FLTKPGKLLDSITFAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFIT 386
            +NE  S++DL     IY   L N   +
Sbjct: 350 KVNECVSVEDLGKCGEIYHKMLVNLLDS 377


>gi|83855368|ref|ZP_00948898.1| succinyl-diaminopimelate desuccinylase [Sulfitobacter sp. NAS-14.1]
 gi|83843211|gb|EAP82378.1| succinyl-diaminopimelate desuccinylase [Sulfitobacter sp. NAS-14.1]
          Length = 381

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 160/384 (41%), Positives = 226/384 (58%), Gaps = 9/384 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D ++   +L++CPSVTP DGGA  +L + L   GF     D        +KNL+AR+G  
Sbjct: 5   DPVDLTAKLVRCPSVTPADGGAQEVLFDLLTEAGFDCAWAD-----RGGIKNLFARWGNR 59

Query: 64  A--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
                  F GH DVVP G+   WT PPF A I +G +YGRG  DMK  +A F AA   F+
Sbjct: 60  GNTRSFGFNGHTDVVPIGNEADWTMPPFGAEIKDGIMYGRGTTDMKSGVAAFTAAAIDFV 119

Query: 122 PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
                 GSI L ITGDEE   I+GT+ +L ++++ GE+ D C+VGEPTC + +G+ IKIG
Sbjct: 120 RDTPPDGSIVLAITGDEEAEGIDGTRALLDYMQEAGERMDVCLVGEPTCPNKMGEMIKIG 179

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSL+    + GKQGH AYPH   NP+  ++ L+ QL +   D G   F P+ + I T+
Sbjct: 180 RRGSLNAHFRVIGKQGHAAYPHRANNPMPAMMRLMDQLASHQLDEGTDHFDPSTLAIVTV 239

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
           D GNP+ NVIPA+ + + NIRFND  +  +L   +  +    I++   +   +       
Sbjct: 240 DTGNPATNVIPAETRATVNIRFNDKHSGASLTTWLEEQA-AAIRDSFGVQVELKVKISGE 298

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALN 361
                   +L+ L+SK++   TG  P LSTSGGTSDARF+K +CPV+EFGLVG++MH ++
Sbjct: 299 SFITPP-GELSDLVSKAVQAETGVTPELSTSGGTSDARFMKHHCPVVEFGLVGQSMHEVD 357

Query: 362 ENASLQDLEDLTCIYENFLQNWFI 385
           EN  +  +  L  IY   L+++F 
Sbjct: 358 ENVEVAQIHQLKSIYTRILKDYFA 381


>gi|325134654|gb|EGC57294.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           M13399]
          Length = 381

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 166/391 (42%), Positives = 223/391 (57%), Gaps = 14/391 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    LE   +LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R
Sbjct: 1   MTETQSLELAKELISRPSVTPDDQNCQKLLAERLHKIGFAAEELHFGD-----TKNIWLR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+AP + FAGH DVVP G    W  PPF     +G++YGRG  DMK  IACF+ A  R
Sbjct: 56  RGTKAPVVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTGIACFVTACER 115

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ ++  + GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD I
Sbjct: 116 FVAEHPDHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMI 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I
Sbjct: 176 KNGRRGSLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNKYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S 
Sbjct: 236 SNINGGTGATNVIPGELSVKFNFRFSTESTEAGLKQRVHAILDK-----HGVQYDLQWSC 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTM 357
              P FLTH  KLT +   +I    G    LST+GGTSD RFIK     +IE G    T+
Sbjct: 291 SGQP-FLTHAGKLTDVARAAIAEICGVETELSTTGGTSDGRFIKAIAKELIELGPSNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFITPS 388
           H +NEN  L D+  L+ +YE  L       +
Sbjct: 350 HQINENVRLNDIPKLSAVYEGILARLLAGNA 380


>gi|262376721|ref|ZP_06069949.1| succinyl-diaminopimelate desuccinylase [Acinetobacter lwoffii
           SH145]
 gi|262308431|gb|EEY89566.1| succinyl-diaminopimelate desuccinylase [Acinetobacter lwoffii
           SH145]
          Length = 378

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 159/386 (41%), Positives = 219/386 (56%), Gaps = 13/386 (3%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           +   L+  +QL++ PSVTP D     I+   LK +GF+IE   F+      V N++AR G
Sbjct: 3   SSATLDLSLQLLRQPSVTPIDHDCQNIMAERLKKIGFNIESMRFED-----VDNIWARKG 57

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
           TE P   FAGH DVVP G+ + W   PF   I EGK+YGRG  DMK ++A  + A  RFI
Sbjct: 58  TEGPVFCFAGHTDVVPTGNLDAWNSDPFLPEIREGKLYGRGSADMKTALAAMVVATERFI 117

Query: 122 PKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
            KY N  GSI+ LIT DEEGP+INGT K++  +E + EK   C+VGEP+  + +GD +K 
Sbjct: 118 EKYPNHKGSIAYLITSDEEGPSINGTVKVIETLEARNEKITWCLVGEPSSTNKLGDIVKN 177

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGSL+  +T+ GKQGHVAYPHL  NPI      + +L +  +D GN  F  T  +I+ 
Sbjct: 178 GRRGSLNANLTVKGKQGHVAYPHLAVNPIHTASKAIAELCDTVWDHGNEYFPATTFQISN 237

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV 300
           I+ G  + NV+P  + +  N R++     + LK      L +   +     + V ++   
Sbjct: 238 INSGTGATNVVPGTMNLLCNWRYSTEVTAEELKVRTLEILDRHGVD-----YDVSWTLSG 292

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHA 359
            P FLT   +L +    +I N T     LSTSGGTSD RFI      V+E G++  T+H 
Sbjct: 293 LP-FLTPIGELVNAAKTAILNVTRTETELSTSGGTSDGRFIAPTGAQVLELGVLNATIHQ 351

Query: 360 LNENASLQDLEDLTCIYENFLQNWFI 385
           +NE+  + DLE LT IYE  L N   
Sbjct: 352 INEHVDIDDLEPLTEIYEQILVNLLA 377


>gi|259417952|ref|ZP_05741871.1| succinyl-diaminopimelate desuccinylase [Silicibacter sp. TrichCH4B]
 gi|259346858|gb|EEW58672.1| succinyl-diaminopimelate desuccinylase [Silicibacter sp. TrichCH4B]
          Length = 381

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 165/388 (42%), Positives = 230/388 (59%), Gaps = 10/388 (2%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT  D ++    L++CPSVTP +GGA  +L   L   GF+    D        V NL+AR
Sbjct: 1   MTATDPVQLTADLVRCPSVTPTEGGALVLLERLLSGAGFACTRVD-----RGEVSNLFAR 55

Query: 60  FGTEA--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAV 117
           +G +       F GH DVVP GD   WT+ PF A + EG +YGRG  DMK  +A F AA 
Sbjct: 56  WGDKGHARTFGFNGHTDVVPVGDAAAWTHDPFGAEVVEGVMYGRGTTDMKSGVAAFAAAA 115

Query: 118 ARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDT 177
             F+ +    G++ L ITGDEEG A++GT  +L ++++ GEK   C+VGEPTC + +G+ 
Sbjct: 116 IDFVRETPPDGAVVLTITGDEEGDAVDGTTALLDYMDQTGEKMSVCLVGEPTCPNHMGEM 175

Query: 178 IKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNME 237
           IKIGRRGS++   T+ G QGH AYPH   NP+ GL  L+ +L +   D G+  F  + + 
Sbjct: 176 IKIGRRGSMTAWFTVTGVQGHSAYPHRANNPLNGLSRLMDRLGSHQLDEGSEHFDASTLA 235

Query: 238 ITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFS 297
           I TID GNP+ NVIPAQ + + NIRFNDL +  +L + ++S   K  +            
Sbjct: 236 IVTIDTGNPATNVIPAQGRAAVNIRFNDLHSGASLTDWLQSEADKIAEEFGLKVEMKVQI 295

Query: 298 SPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTM 357
           S     F+T    L+ L+SK++   T  +P LST+GGTSDARF+K +CPV+EFGLVG+TM
Sbjct: 296 SG--ESFITPPGDLSELVSKAVQTETNQVPELSTTGGTSDARFVKAHCPVVEFGLVGKTM 353

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H ++EN  +  +  L  IY   L ++F 
Sbjct: 354 HQVDENVEVAQIHQLKSIYTRILTDYFA 381


>gi|148652454|ref|YP_001279547.1| succinyl-diaminopimelate desuccinylase [Psychrobacter sp. PRwf-1]
 gi|238064781|sp|A5WD56|DAPE_PSYWF RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|148571538|gb|ABQ93597.1| succinyldiaminopimelate desuccinylase [Psychrobacter sp. PRwf-1]
          Length = 402

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 161/389 (41%), Positives = 223/389 (57%), Gaps = 8/389 (2%)

Query: 3   PDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQT----KNTSIVKNLYA 58
              LE  I+L++  SVTP D G   +LV  L  LGF  E   F         + VKNL+A
Sbjct: 15  QQTLELSIELMRRDSVTPHDKGCQEVLVERLSPLGFVHEFMYFGDEQASGRDAQVKNLWA 74

Query: 59  RFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
           R G + P + FAGH DVVP G+ ++W   PF A + +G ++GRG  DMK  IA F  A  
Sbjct: 75  RRGNQDPVVCFAGHTDVVPTGNPDNWRIAPFDAKVHDGYLWGRGAADMKTGIAAFTVATE 134

Query: 119 RFIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDT 177
           RF+  +  + GSI++LIT DEEGP+INGT K++  +E + EK   C+VGEP+    +GD 
Sbjct: 135 RFVKNHPDHNGSIAMLITSDEEGPSINGTVKVIEVLEARNEKITYCLVGEPSSTDSLGDV 194

Query: 178 IKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNME 237
           IK GRRGSL G +T+ GKQGHVAYPHL  NPI  L+P L + +   +D GN  F  T+M+
Sbjct: 195 IKNGRRGSLGGILTVTGKQGHVAYPHLAVNPIHALLPALAEFSVTEWDKGNDFFPATSMQ 254

Query: 238 ITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFS 297
           I+ I+ G  + NVIP  V++ FN RF+    E+ L+ +    L K   N  + ++ + + 
Sbjct: 255 ISNINGGTGANNVIPETVEVVFNFRFSTETTEEELRAKTHEILDKHFANT-EATYEIDWK 313

Query: 298 SPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRT 356
               P FLT + KL      +I + TG    LSTSGGTSD RFI      V+E G+   T
Sbjct: 314 LSGHP-FLTAEGKLVDACKVAIKDITGTDTQLSTSGGTSDGRFIAPTGAQVVELGVRNAT 372

Query: 357 MHALNENASLQDLEDLTCIYENFLQNWFI 385
           +H ++E   + D+  L  IYE  L+   +
Sbjct: 373 IHQVDERVEIDDIGKLAQIYERMLEELLL 401


>gi|83941891|ref|ZP_00954353.1| succinyl-diaminopimelate desuccinylase [Sulfitobacter sp. EE-36]
 gi|83847711|gb|EAP85586.1| succinyl-diaminopimelate desuccinylase [Sulfitobacter sp. EE-36]
          Length = 381

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 159/384 (41%), Positives = 226/384 (58%), Gaps = 9/384 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D ++   +L++CPSVTP DGGA  +L + L   GF     D        +KN +AR+G +
Sbjct: 5   DPVDLTAKLVRCPSVTPADGGAQDVLFDLLTEAGFDCAWAD-----RGGIKNFFARWGNK 59

Query: 64  A--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
                  F GH DVVP G+   WT PPF A I +G +YGRG  DMK  +A F AA   F+
Sbjct: 60  GNTRSFGFNGHTDVVPIGNEADWTMPPFGAEIKDGIMYGRGTTDMKSGVAAFTAAAIDFV 119

Query: 122 PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
                 GSI L ITGDEE   I+GT+ +L ++++ GE+ D C+VGEPTC + +G+ IKIG
Sbjct: 120 RDTPPDGSIVLAITGDEEAEGIDGTRALLDYMQEAGERMDVCLVGEPTCPNKMGEMIKIG 179

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSL+    + GKQGH AYPH   NP+  ++ L+ QL +   D G   F P+ + I T+
Sbjct: 180 RRGSLNAHFRVIGKQGHAAYPHRANNPMPAMMRLMDQLASHQLDEGTDHFDPSTLAIVTV 239

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
           D GNP+ NVIPA+ + + NIRFND  +  +L   +  +    I++   +   +       
Sbjct: 240 DTGNPATNVIPAETRATVNIRFNDKHSGASLTTWLEEQA-AAIRDSFGVQVELKVKISGE 298

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALN 361
                   +L+ L+SK++   TG  P LSTSGGTSDARF+K +CPV+EFGLVG++MH ++
Sbjct: 299 SFITPP-GELSDLVSKAVQAETGVTPELSTSGGTSDARFMKHHCPVVEFGLVGQSMHEVD 357

Query: 362 ENASLQDLEDLTCIYENFLQNWFI 385
           EN  +  +  L  IY   L+++F 
Sbjct: 358 ENVEVAQIHQLKSIYTRILKDYFA 381


>gi|269213534|ref|ZP_05982180.2| succinyl-diaminopimelate desuccinylase [Neisseria cinerea ATCC
           14685]
 gi|269146359|gb|EEZ72777.1| succinyl-diaminopimelate desuccinylase [Neisseria cinerea ATCC
           14685]
          Length = 398

 Score =  250 bits (637), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 170/391 (43%), Positives = 226/391 (57%), Gaps = 14/391 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    LE   +LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R
Sbjct: 18  MTETQSLELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGD-----TKNIWLR 72

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+AP + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK SIACF+ A  R
Sbjct: 73  RGTQAPVVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTSIACFVTACER 132

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ ++  + GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD I
Sbjct: 133 FVAEHPDHPGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMI 192

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG +T+ GKQGH+AYPHL  NPI    P L +LT   +D GN  F PT+ +I
Sbjct: 193 KNGRRGSLSGNLTVKGKQGHIAYPHLAVNPIHTFAPALLELTQEVWDEGNEYFPPTSFQI 252

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S 
Sbjct: 253 SNINGGTGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDK-----HGVQYDLQWSC 307

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTM 357
              P FLTH  KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+
Sbjct: 308 SGQP-FLTHAGKLTDVARTAIAETCGVETELSTTGGTSDGRFIKAIAKELIELGPSNATI 366

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFITPS 388
           H +NEN  L D+  L+ +YE  L       +
Sbjct: 367 HQINENVRLDDIPKLSAVYEGILARLLAEKA 397


>gi|239998775|ref|ZP_04718699.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           35/02]
 gi|240014308|ref|ZP_04721221.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           DGI18]
 gi|240016743|ref|ZP_04723283.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           FA6140]
 gi|240080935|ref|ZP_04725478.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae FA19]
 gi|240112705|ref|ZP_04727195.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae MS11]
 gi|240117746|ref|ZP_04731808.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae PID1]
 gi|240121871|ref|ZP_04734833.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           PID24-1]
 gi|240123301|ref|ZP_04736257.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           PID332]
 gi|268594620|ref|ZP_06128787.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           35/02]
 gi|268597053|ref|ZP_06131220.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae FA19]
 gi|268598768|ref|ZP_06132935.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae MS11]
 gi|268603445|ref|ZP_06137612.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae PID1]
 gi|268681925|ref|ZP_06148787.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           PID332]
 gi|238064824|sp|B4RKY8|DAPE_NEIG2 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|268548009|gb|EEZ43427.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           35/02]
 gi|268550841|gb|EEZ45860.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae FA19]
 gi|268582899|gb|EEZ47575.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae MS11]
 gi|268587576|gb|EEZ52252.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae PID1]
 gi|268622209|gb|EEZ54609.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           PID332]
          Length = 381

 Score =  250 bits (637), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 170/391 (43%), Positives = 226/391 (57%), Gaps = 14/391 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    LE    LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R
Sbjct: 1   MTETQSLELAKALISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGD-----TKNIWLR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+AP + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK SIACF+ A  R
Sbjct: 56  RGTKAPVVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTSIACFVTACER 115

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ ++  + GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GD I
Sbjct: 116 FVAEHPDHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVDKLGDMI 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I
Sbjct: 176 KNGRRGSLSGNLTVKGKQGHIAYPHLAVNPVHTFAPALLELTQEVWDEGNEYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S 
Sbjct: 236 SNINGGTGATNVIPGELNVKFNFRFSTESTETGLKQRVHAILDK-----HGVQYDLQWSC 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTM 357
              P FLTH  KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+
Sbjct: 291 SGQP-FLTHAGKLTDVARTAIAETCGVEAELSTTGGTSDGRFIKAIAKELIELGPSNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFITPS 388
           H +NEN  L D+  L+ +YE  L       +
Sbjct: 350 HQINENVRLDDIPKLSAVYERILARLLAEKA 380


>gi|194098365|ref|YP_002001423.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           NCCP11945]
 gi|193933655|gb|ACF29479.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           NCCP11945]
 gi|317164066|gb|ADV07607.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 411

 Score =  250 bits (637), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 170/391 (43%), Positives = 226/391 (57%), Gaps = 14/391 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    LE    LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R
Sbjct: 31  MTETQSLELAKALISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGD-----TKNIWLR 85

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+AP + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK SIACF+ A  R
Sbjct: 86  RGTKAPVVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTSIACFVTACER 145

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ ++  + GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GD I
Sbjct: 146 FVAEHPDHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVDKLGDMI 205

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I
Sbjct: 206 KNGRRGSLSGNLTVKGKQGHIAYPHLAVNPVHTFAPALLELTQEVWDEGNEYFPPTSFQI 265

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S 
Sbjct: 266 SNINGGTGATNVIPGELNVKFNFRFSTESTETGLKQRVHAILDK-----HGVQYDLQWSC 320

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTM 357
              P FLTH  KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+
Sbjct: 321 SGQP-FLTHAGKLTDVARTAIAETCGVEAELSTTGGTSDGRFIKAIAKELIELGPSNATI 379

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFITPS 388
           H +NEN  L D+  L+ +YE  L       +
Sbjct: 380 HQINENVRLDDIPKLSAVYERILARLLAEKA 410


>gi|330720263|gb|EGG98625.1| N-succinyl-L2CL-diaminopimelate desuccinylase [gamma
           proteobacterium IMCC2047]
          Length = 377

 Score =  249 bits (636), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 153/388 (39%), Positives = 218/388 (56%), Gaps = 14/388 (3%)

Query: 1   MTPDCL-EHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT + + E    LI  PSVTP D     ++++ L+ +GF+IE  +F       V NL+A 
Sbjct: 1   MTNNAVLEFTKDLIAQPSVTPADCDCQEMMISRLEAVGFNIERLNFGE-----VTNLWAV 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            G   P L FAGH DVVP G   +WT  PF   + +G +YGRG  DMKGSIA    A  R
Sbjct: 56  HGESGPILAFAGHTDVVPTGPIENWTSHPFKPEVRDGYLYGRGAADMKGSIAAMTIAAER 115

Query: 120 FIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           FI    +  G ++ LIT DEEGPA+NGT K++  ++++GE+   C+VGEP+  + +GD I
Sbjct: 116 FISANPDHSGRLAFLITSDEEGPAVNGTVKVIEHLQQQGEQLRWCVVGEPSSTNKLGDVI 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSL+GE+TI GKQGH+AYPHL +NPI    P L  L    +D GN  F  T+ +I
Sbjct: 176 KNGRRGSLNGELTIQGKQGHIAYPHLADNPIHHACPALADLIAEQWDQGNDFFPATSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP   ++ FN R++    ++ L++   + L +   +     + + +  
Sbjct: 236 SNINSGTGATNVIPGTTEVVFNFRYSTEVTQEELQQRTEAILNRHQLD-----YKLDWKL 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTM 357
              P FLT   +L      ++    G+   LSTSGGTSD RFI      VIE G    T+
Sbjct: 291 SGLP-FLTEPGELVGAAQSALIEVMGSEAELSTSGGTSDGRFIAPTGAQVIELGPCNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H LNE   +++LE    IY++ + N   
Sbjct: 350 HQLNERVLVEELEQTAQIYQSIMSNLLA 377


>gi|328545262|ref|YP_004305371.1| acetylornithine deacetylase/Succinyl-diaminopimelate
           desuccinylase-like deacylase [polymorphum gilvum
           SL003B-26A1]
 gi|326415004|gb|ADZ72067.1| Acetylornithine deacetylase/Succinyl-diaminopimelate
           desuccinylase-like deacylase [Polymorphum gilvum
           SL003B-26A1]
          Length = 393

 Score =  249 bits (636), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 187/386 (48%), Positives = 239/386 (61%), Gaps = 4/386 (1%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +     LI+CPSVTP +GGA  +L   L+  GFS++   F   +T  V+NL+A  
Sbjct: 4   MQDIAVSLAQDLIRCPSVTPAEGGALQLLQERLEGAGFSVQRLTFSDTDTPDVENLFASI 63

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G  APH +FAGH DVVP G    W++ PF   I  G +YGRG VDMKG IA F AA   F
Sbjct: 64  GHGAPHFVFAGHTDVVPAGATADWSHGPFDGVIDAGLLYGRGAVDMKGGIAAFAAAALAF 123

Query: 121 IPKYK--NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           + +      G+IS LITGDEEGPA+NGT K+L W   +G  +DACIVGEPT    +GD I
Sbjct: 124 VAERGTDFGGTISFLITGDEEGPAVNGTVKLLDWARAQGHVFDACIVGEPTNPVRLGDAI 183

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           KIGRRGSLSG + + G QGHVAYPHL  NPI  L+ LL  L  +  D GN  F P+N+EI
Sbjct: 184 KIGRRGSLSGIVAVTGIQGHVAYPHLAHNPIPNLLRLLAALQALKLDEGNARFEPSNLEI 243

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
             ++VGN + NVIPA+ +  FNIR+ND W    LK ++ + +            ++ F  
Sbjct: 244 VNLEVGNAAFNVIPARAEARFNIRYNDEWTLDGLKAKVTAVIEA--AADRSCDWSLEFRR 301

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
             S  FLT D +L   L+ ++   TG  P LST GGTSDARFIKDYCPV+EFGLVG+TMH
Sbjct: 302 DASESFLTRDDRLIEGLADAVEAETGQRPDLSTGGGTSDARFIKDYCPVVEFGLVGQTMH 361

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E  ++ DL+ L  IY  FL  +F
Sbjct: 362 KVDECVAVVDLKRLAAIYRRFLDGYF 387


>gi|292492781|ref|YP_003528220.1| succinyl-diaminopimelate desuccinylase [Nitrosococcus halophilus
           Nc4]
 gi|291581376|gb|ADE15833.1| succinyl-diaminopimelate desuccinylase [Nitrosococcus halophilus
           Nc4]
          Length = 376

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 153/382 (40%), Positives = 218/382 (57%), Gaps = 13/382 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            LE   +LI C S+TPQD G   +L   LK LGF  E   F       V+N++ R G + 
Sbjct: 4   TLELAKKLIACASITPQDAGCQPLLAERLKALGFRGERLPFGE-----VENIWLRRGQKP 58

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P  +FAGH DVVPPG    W   PF+  + +  +YGRG  DMKGS+A  + A  RFI  +
Sbjct: 59  PLFVFAGHTDVVPPGPAEQWLSDPFTPELRDEMLYGRGAADMKGSLAAMVTASERFISAH 118

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
            +  GSI+ L+T DEEG A+NGT K++  +E +GEK D C+VGEPT    +GD +K GRR
Sbjct: 119 PDHLGSIAFLLTSDEEGRAVNGTVKVVETLEARGEKIDYCLVGEPTSRERVGDMVKNGRR 178

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSLSG + + G QGHVAYPHL +NPI  L P+L  L    +D GN  F PT  +++ I  
Sbjct: 179 GSLSGRLLVRGTQGHVAYPHLADNPIHSLAPVLVTLCTKEWDRGNEDFPPTTFQVSNIHG 238

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NVIP +V++ FN R++     + L++++ + L +   N     + + ++    P 
Sbjct: 239 GTGATNVIPGEVEVLFNFRYSTEVTHQQLQQQVEAILSQQNLN-----YELEWTLSGKPF 293

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
                  L + +S++I + TG     ST+GGTSD RFI      V+E G V  T+H +NE
Sbjct: 294 RTAPGN-LMTAVSQAIGDITGLETEFSTTGGTSDGRFIAPTGAQVVELGPVNATIHKVNE 352

Query: 363 NASLQDLEDLTCIYENFLQNWF 384
             ++ DLE L+ +Y   L+   
Sbjct: 353 CVAVADLEKLSQVYSRLLEILL 374


>gi|294668464|ref|ZP_06733564.1| hypothetical protein NEIELOOT_00379 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291309617|gb|EFE50860.1| hypothetical protein NEIELOOT_00379 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 378

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 168/389 (43%), Positives = 225/389 (57%), Gaps = 15/389 (3%)

Query: 1   MTPDC--LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYA 58
           MT +   L    QLI   SVTP D G   +L   L+ +GF++E+ DF        KN++A
Sbjct: 1   MTTETATLALAKQLIARASVTPDDQGCQELLAERLQKIGFTVEQLDF-----GQTKNIWA 55

Query: 59  RFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
           R G+ AP L FAGH DVVP G  + WT PPF  T  +G++YGRG  DMK SIA F+ A  
Sbjct: 56  RRGSGAPLLCFAGHTDVVPSGPEDKWTSPPFEPTERDGRLYGRGAADMKSSIAAFVTACE 115

Query: 119 RFIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDT 177
           RF+    +  GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GDT
Sbjct: 116 RFVAARPDHAGSIALLITSDEEGDALDGTTKVVDVLKARGETIDYCIVGEPTAVDTLGDT 175

Query: 178 IKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNME 237
           +K GRRGSLSG +T+ GKQGH+AYPHL ENP+    P L +LT   +D GN  F PT  +
Sbjct: 176 VKNGRRGSLSGNLTVKGKQGHIAYPHLAENPVHKATPALAELTAAEWDRGNAYFPPTGFQ 235

Query: 238 ITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFS 297
           I+ I+ G  + NVIP ++ + FN RF+   +   LK  +   L K   N     + + ++
Sbjct: 236 ISNINGGTGATNVIPGELNVKFNFRFSTESDSDGLKRRVHEILDKHGLN-----YDLQWT 290

Query: 298 SPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRT 356
               P FLT   +LT     ++    G    LSTSGGTSD RFIK     +IE G V  T
Sbjct: 291 LSGQP-FLTEAGRLTEAAQAAVAEICGVRAELSTSGGTSDGRFIKAIARELIELGPVNAT 349

Query: 357 MHALNENASLQDLEDLTCIYENFLQNWFI 385
           +H ++EN  L  L  L+ +YE  L    +
Sbjct: 350 IHQIDENVELSALPKLSAVYERMLAELLM 378


>gi|240128003|ref|ZP_04740664.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           SK-93-1035]
 gi|268686393|ref|ZP_06153255.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           SK-93-1035]
 gi|268626677|gb|EEZ59077.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           SK-93-1035]
          Length = 381

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 170/391 (43%), Positives = 226/391 (57%), Gaps = 14/391 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    LE    LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R
Sbjct: 1   MTETQSLELAKALISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGD-----TKNIWLR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+AP + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK SIACF+ A  R
Sbjct: 56  RGTKAPVVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTSIACFVTACER 115

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ ++  + GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GD I
Sbjct: 116 FVAEHPDHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVDKLGDMI 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I
Sbjct: 176 KNGRRGSLSGSLTVKGKQGHIAYPHLAVNPVHTFAPALLELTQEVWDEGNEYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S 
Sbjct: 236 SNINGGTGATNVIPGELNVKFNFRFSTESTETGLKQRVHAILDK-----HGVQYDLQWSC 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTM 357
              P FLTH  KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+
Sbjct: 291 SGQP-FLTHAGKLTDVARTAIAETCGVEAELSTTGGTSDGRFIKAIAKELIELGPSNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFITPS 388
           H +NEN  L D+  L+ +YE  L       +
Sbjct: 350 HQINENVRLDDIPKLSAVYERILARLLAEKA 380


>gi|217977205|ref|YP_002361352.1| succinyl-diaminopimelate desuccinylase [Methylocella silvestris
           BL2]
 gi|238064794|sp|B8ELJ6|DAPE_METSB RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|217502581|gb|ACK49990.1| succinyl-diaminopimelate desuccinylase [Methylocella silvestris
           BL2]
          Length = 388

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 188/385 (48%), Positives = 245/385 (63%), Gaps = 2/385 (0%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           +    +E   +L++ PSVTP D GA   L   L+  GF+     F  ++T  ++NLYAR 
Sbjct: 4   LAHTAVELCRELLRRPSVTPLDAGAQDFLAAKLREAGFATHSVVFSDESTPDIQNLYARA 63

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G    HL+FAGH DVVPPGD   W + PF   +  G I+GRG VDMKG+IA F AA   F
Sbjct: 64  GAGGRHLVFAGHTDVVPPGDSASWRFDPFGGEMEGGLIFGRGAVDMKGAIAAFAAAAMAF 123

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + +     GSIS LITGDEEGPAINGT K+L W  ++GE++D CI+GEPT    +GD IK
Sbjct: 124 VAEGGAQKGSISFLITGDEEGPAINGTDKLLRWAHQRGERFDHCILGEPTNQQALGDMIK 183

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGSL+G +T+ G QGHVAYPH  +NPI  L+ LL  LT    D G   F  +N+EI 
Sbjct: 184 IGRRGSLNGTLTVKGVQGHVAYPHRAKNPIPHLMRLLAALTAEPLDQGTELFDASNLEIV 243

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           ++DVGNP+ NVIPA+ +  FNIRFND+W    L  E+R+R  +        +  +HF   
Sbjct: 244 SVDVGNPTFNVIPAEARARFNIRFNDIWTPDALAAELRAR-AEKAGAAAGAASALHFEPC 302

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
            +  F+T     T L+S +I   TG  P LSTSGGTSDARFI+ YCPV+EFGLVG TMHA
Sbjct: 303 NALAFVTQPDAFTDLVSAAIEQATGRKPKLSTSGGTSDARFIRAYCPVLEFGLVGSTMHA 362

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           ++E A ++D+  L  IY + L ++F
Sbjct: 363 VDERAPVEDISALASIYADILNSYF 387


>gi|253989297|ref|YP_003040653.1| succinyl-diaminopimelate desuccinylase [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253780747|emb|CAQ83909.1| n-succinyl-diaminopimelate deacylase [Photorhabdus asymbiotica]
          Length = 375

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 157/385 (40%), Positives = 223/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT   +E   QLI+ PSV+P D G   I+++ L+ +GF+IE   F   N     N +A  
Sbjct: 1   MTCPVIELAQQLIRQPSVSPDDKGCQDIMISRLQAIGFTIERMPFGDTN-----NFWAYR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT    L FAGH DVVP GD + W +PPF  TI  G +YGRG  DMKGS+A  + A  RF
Sbjct: 56  GTGL-TLAFAGHTDVVPAGDESQWEHPPFEPTIRNGMLYGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  +  + G ++ LIT DEE  A NGT K++  +  + E+ D C++GEP+  + +GD +K
Sbjct: 115 VTSHPNHNGRLAFLITSDEEAQATNGTVKVVEALMSRNEQLDYCLIGEPSSQYRLGDMVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +T+HG QGHVAYPHL +NPI   IP L +L +  +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTANLTVHGIQGHVAYPHLADNPIHRAIPALQELVSTHWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP  +++ FN RF+    +  ++E + + L         L +T+ +  P
Sbjct: 235 NIHAGTGSHNVIPGNLQVQFNFRFSTELTDSQIRERVETIL-----KNHDLDYTIEWILP 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   +L   + ++I +  G  P LSTSGGTSD RFI      V+E G +  T+H
Sbjct: 290 GEP-FLTAKGELVDAVVQAIDHYCGYKPELSTSGGTSDGRFIARMGAQVVELGPINSTIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  S  DL+ L+ IY+  ++  
Sbjct: 349 KVNEAVSAADLQQLSRIYQRVMEQL 373


>gi|303258046|ref|ZP_07344054.1| succinyl-diaminopimelate desuccinylase [Burkholderiales bacterium
           1_1_47]
 gi|302859065|gb|EFL82148.1| succinyl-diaminopimelate desuccinylase [Burkholderiales bacterium
           1_1_47]
          Length = 381

 Score =  249 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 160/388 (41%), Positives = 224/388 (57%), Gaps = 14/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D LE   ++I C SVTP D G+  I  + L   GFS EE      N    KNL+A++
Sbjct: 1   MQQDPLELTKKIIACESVTPSDAGSLKIFADLLSQHGFSCEEI-----NRGQTKNLWAKY 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G+ AP  +FAGH+DVVPPG  + W +PPF  T  EG +YGRG  DMK S ACF AA   F
Sbjct: 56  GSGAPVFLFAGHVDVVPPG-ADGWKFPPFVPTEDEGFLYGRGAQDMKTSDACFAAAACEF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + K+  F G+I LL+T DEEG   +GT+  L  +  +    D CIVGEP+C  ++GDTIK
Sbjct: 115 VSKHPQFKGTIVLLLTSDEEGDGKDGTQYALQVLSDREVAPDFCIVGEPSCTRLLGDTIK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+G++T+ G QGHVAYP    NPI    PLL +L+   +D G   F  T+ +I+
Sbjct: 175 NGRRGSLNGKLTVRGIQGHVAYPKKVRNPIHSAAPLLAELSQTVWDEGLPPFPATSFQIS 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  + NV+P +  ++FNIR+N      +L+++I       +         + +   
Sbjct: 235 NIHAGTGAVNVVPGECVITFNIRYNPKHTAASLEKQIED-----MCRKYVWDFKIEWQES 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMH 358
            SP F +      + L+++I + TG  P  STSGGTSD RFI+ +CP V+EFG V   +H
Sbjct: 290 ASPFF-SEKPFFRNELAEAIKDVTGIKPEFSTSGGTSDGRFIRQWCPEVVEFGPVNDRIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFIT 386
            +NE    +D+  L+ IY   L+  F++
Sbjct: 349 KVNERIPTKDIACLSKIYYRILERIFLS 376


>gi|308389674|gb|ADO31994.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           alpha710]
 gi|325130601|gb|EGC53347.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           OX99.30304]
 gi|325136577|gb|EGC59178.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           M0579]
 gi|325144813|gb|EGC67103.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           M01-240013]
 gi|325201780|gb|ADY97234.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           M01-240149]
 gi|325208468|gb|ADZ03920.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           NZ-05/33]
          Length = 381

 Score =  249 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 167/391 (42%), Positives = 224/391 (57%), Gaps = 14/391 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    LE   +LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R
Sbjct: 1   MTETQSLELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGD-----TKNIWLR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+AP + FAGH DVVP G    W  PPF     +G++YGRG  DMK SIACF+ A  R
Sbjct: 56  RGTKAPVVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACER 115

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ ++  + GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD I
Sbjct: 116 FVAEHPDHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMI 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I
Sbjct: 176 KNGRRGSLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNKYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S 
Sbjct: 236 SNINGGTGATNVIPGELSVKFNFRFSTESTEAGLKQRVHAILDK-----HGVQYDLQWSC 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTM 357
              P FLTH  KLT +   +I    G    LST+GGTSD RFIK     +IE G    T+
Sbjct: 291 SGQP-FLTHAGKLTDVARAAIAEICGVETELSTTGGTSDGRFIKAIAKELIELGPSNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFITPS 388
           H +NEN  L D+  L+ +YE  L       +
Sbjct: 350 HQINENVRLNDIPKLSAVYEGILARLLAGNA 380


>gi|331000679|ref|ZP_08324331.1| succinyl-diaminopimelate desuccinylase [Parasutterella
           excrementihominis YIT 11859]
 gi|329570832|gb|EGG52547.1| succinyl-diaminopimelate desuccinylase [Parasutterella
           excrementihominis YIT 11859]
          Length = 384

 Score =  249 bits (635), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 160/388 (41%), Positives = 224/388 (57%), Gaps = 14/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D LE   ++I C SVTP D G+  I  + L   GFS EE      N    KNL+A++
Sbjct: 4   MQQDPLELTKKIIACESVTPSDAGSLKIFADLLSQHGFSCEEI-----NRGQTKNLWAKY 58

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G+ AP  +FAGH+DVVPPG  + W +PPF  T  EG +YGRG  DMK S ACF AA   F
Sbjct: 59  GSGAPVFLFAGHVDVVPPG-ADGWKFPPFVPTEDEGFLYGRGAQDMKTSDACFAAAACEF 117

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + K+  F G+I LL+T DEEG   +GT+  L  +  +    D CIVGEP+C  ++GDTIK
Sbjct: 118 VSKHPQFKGTIVLLLTSDEEGDGKDGTQYALQVLSDREVAPDFCIVGEPSCTRLLGDTIK 177

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+G++T+ G QGHVAYP    NPI    PLL +L+   +D G   F  T+ +I+
Sbjct: 178 NGRRGSLNGKLTVRGIQGHVAYPKKVRNPIHSAAPLLAELSQTVWDEGLPPFPATSFQIS 237

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  + NV+P +  ++FNIR+N      +L+++I       +         + +   
Sbjct: 238 NIHAGTGAVNVVPGECVITFNIRYNPKHTAASLEKQIED-----MCRKYVWDFKIEWQES 292

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMH 358
            SP F +      + L+++I + TG  P  STSGGTSD RFI+ +CP V+EFG V   +H
Sbjct: 293 ASPFF-SEKPFFRNELAEAIKDVTGIKPEFSTSGGTSDGRFIRQWCPEVVEFGPVNDRIH 351

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFIT 386
            +NE    +D+  L+ IY   L+  F++
Sbjct: 352 KVNERIPTKDIACLSKIYYRILERIFLS 379


>gi|308050148|ref|YP_003913714.1| succinyldiaminopimelate desuccinylase [Ferrimonas balearica DSM
           9799]
 gi|307632338|gb|ADN76640.1| succinyldiaminopimelate desuccinylase [Ferrimonas balearica DSM
           9799]
          Length = 377

 Score =  249 bits (635), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 158/382 (41%), Positives = 216/382 (56%), Gaps = 13/382 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L     LI  PSVTP+D G   ++   L+ LGF+IE   F+        NL+AR G+E 
Sbjct: 6   VLTLAKDLIARPSVTPEDAGCQAMMAAHLERLGFTIESMVFED-----TTNLWARRGSEG 60

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P   FAGH DVVPPGD + W  PPF  T+ +G ++GRG  DMKGS+A  + AV RF+ ++
Sbjct: 61  PVFCFAGHTDVVPPGDLSQWHTPPFEPTVIDGILHGRGAADMKGSLAAMLVAVERFVTEH 120

Query: 125 K-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
             + GSI+ LIT DEEGP INGT +++  +E + EK   CIVGEP+  H +GD IK GRR
Sbjct: 121 PDHQGSIAFLITSDEEGPFINGTTRVIDTLEARNEKITWCIVGEPSSTHKLGDIIKNGRR 180

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL+ E+T+ G QGHVAYPHL +NP+    P L +L  + +D GN  F PT+ +I  I  
Sbjct: 181 GSLTAEVTVKGIQGHVAYPHLADNPVHKAAPALAELAAMEWDKGNAFFPPTSFQIANIHA 240

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NV+P  + + FN R++     + L+  + +       +   L + + ++    P 
Sbjct: 241 GTGAPNVVPGALNVQFNFRYSTEVTAQDLESRVHNIF-----DRYGLDYDIKWTYNGQP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
           FLT    L      +I   TG     STSGGTSD RFI      VIE G    T+H +NE
Sbjct: 295 FLTGGGALLDATCAAIREVTGYDTEPSTSGGTSDGRFIAPTGAQVIELGPCNATIHKINE 354

Query: 363 NASLQDLEDLTCIYENFLQNWF 384
             S++DLE L   YE  L+   
Sbjct: 355 CVSVRDLELLAECYEKVLEKLL 376


>gi|163733186|ref|ZP_02140630.1| succinyl-diaminopimelate desuccinylase [Roseobacter litoralis Och
           149]
 gi|161393721|gb|EDQ18046.1| succinyl-diaminopimelate desuccinylase [Roseobacter litoralis Och
           149]
          Length = 381

 Score =  249 bits (635), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 165/388 (42%), Positives = 231/388 (59%), Gaps = 10/388 (2%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT  D +     L++C SVTP D GA  IL + L   GF     D        ++NL+AR
Sbjct: 1   MTAVDPVRLTADLVRCASVTPADEGALDILHDVLSDAGFDCAWAD-----RGGIRNLFAR 55

Query: 60  FGTEA--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAV 117
           +G++       F GH DVVP G+ + W+ PPF A + +G +YGRG  DMK  +A F AA 
Sbjct: 56  WGSKGHPKTFGFNGHTDVVPIGNADDWSMPPFGAEVKDGIMYGRGTTDMKSGVAAFAAAA 115

Query: 118 ARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDT 177
             F+      G+I L ITGDEEG AI+GT  +L+++  + E+  AC+VGEPTC   +G+ 
Sbjct: 116 LDFVRDTPPDGAIVLAITGDEEGDAIDGTTALLAYMAAQDEQMSACLVGEPTCPDRMGEM 175

Query: 178 IKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNME 237
           IKIGRRGS++  IT+ GKQGH AYPH   NP+  L+ L+ +L +   D G   F P+ + 
Sbjct: 176 IKIGRRGSMTAWITVTGKQGHAAYPHRACNPLPALMRLMDRLASHKLDEGTEFFDPSTLA 235

Query: 238 ITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFS 297
           I T+D GNP+ NVIPA    + NIRFND  +  +L E I++ L K        +      
Sbjct: 236 IVTVDTGNPATNVIPASCSGTVNIRFNDAHSGASLTEWIKTELSKIEAEFGVQTGLRIKI 295

Query: 298 SPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTM 357
           S     FLT    L++L+SK++   TG  P+LST+GGTSDARF+KD+CPV+EFGLVG++M
Sbjct: 296 SG--ESFLTPPGPLSALVSKAVKAQTGIEPVLSTTGGTSDARFVKDHCPVVEFGLVGQSM 353

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H ++E+     + +L  IY   L ++F 
Sbjct: 354 HQVDEHVKTDHIVELKAIYSRILTDYFA 381


>gi|254490425|ref|ZP_05103611.1| succinyl-diaminopimelate desuccinylase [Methylophaga thiooxidans
           DMS010]
 gi|224464169|gb|EEF80432.1| succinyl-diaminopimelate desuccinylase [Methylophaga thiooxydans
           DMS010]
          Length = 391

 Score =  249 bits (635), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 154/385 (40%), Positives = 224/385 (58%), Gaps = 13/385 (3%)

Query: 3   PDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT 62
            + L+   QLI+  SVTP+D G   +L + L   GF  E   F       V NL+ R G 
Sbjct: 17  SETLDLTQQLIRRDSVTPEDKGCQVLLSDRLAPFGFKAEHMCFDD-----VDNLWLRRGN 71

Query: 63  EAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIP 122
             P + FAGH DVVP G   +W++ PF+A + +G +YGRG  DMKGSIA  + A  RF+ 
Sbjct: 72  TGPVIAFAGHTDVVPTGPVENWSHAPFNADVIDGMLYGRGAADMKGSIAAMVTACERFVK 131

Query: 123 KYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
           K+  + GSI+ LIT DEEGPA+NGT K++  ++ +GE+ D C+VGEP+    +GD +K G
Sbjct: 132 KHPEHEGSIAFLITSDEEGPAVNGTVKVVETLQSRGEEIDWCLVGEPSSTDKVGDIVKNG 191

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSL+G +T+ GKQGH+AYPHL ENPI  + P L +L ++ +D GN  F PT+ +++ +
Sbjct: 192 RRGSLNGRLTVKGKQGHIAYPHLAENPIHLMSPALTELCSVEWDQGNADFPPTSFQVSNL 251

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
           + G    NVIP   ++ FN RF+     + L++ + + L     N  +L + + +     
Sbjct: 252 NAGTGVTNVIPGTAELIFNFRFSTEVTHEELQQRVEAIL-----NTHQLDYELKWELSGK 306

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHAL 360
           P       +L   +  +I+  TG    LSTSGGTSD RFI      VIE G +  T+H +
Sbjct: 307 PFRT-ASGELLEAVQNAIHEVTGYPTTLSTSGGTSDGRFIAPTGTQVIELGPLNATIHQI 365

Query: 361 NENASLQDLEDLTCIYENFLQNWFI 385
           +E  S+ DL+ L+ IYE  L    +
Sbjct: 366 DECVSVADLDTLSEIYETLLLKLLV 390


>gi|325205722|gb|ADZ01175.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           M04-240196]
          Length = 381

 Score =  249 bits (635), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 167/391 (42%), Positives = 224/391 (57%), Gaps = 14/391 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    LE   +LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R
Sbjct: 1   MTETQSLELAKELISRPSVTPDDQNCQKLLAERLHKIGFAAEELHFGD-----TKNIWLR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+AP + FAGH DVVP G    W  PPF     +G++YGRG  DMK SIACF+ A  R
Sbjct: 56  RGTKAPVVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACER 115

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ ++  + GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD I
Sbjct: 116 FVAEHPDHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMI 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I
Sbjct: 176 KNGRRGSLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNKYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S 
Sbjct: 236 SNINGGTGATNVIPGELSVKFNFRFSTESTEAGLKQRVHAILDK-----HGVQYDLQWSC 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTM 357
              P FLTH  KLT +   +I    G    LST+GGTSD RFIK     +IE G    T+
Sbjct: 291 SGQP-FLTHAGKLTDVARAAIAEICGVETELSTTGGTSDGRFIKAIAKELIELGPSNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFITPS 388
           H +NEN  L D+  L+ +YE  L       +
Sbjct: 350 HQINENVRLNDIPKLSAVYEGILARLLAGNA 380


>gi|261400708|ref|ZP_05986833.1| succinyl-diaminopimelate desuccinylase [Neisseria lactamica ATCC
           23970]
 gi|269209465|gb|EEZ75920.1| succinyl-diaminopimelate desuccinylase [Neisseria lactamica ATCC
           23970]
          Length = 381

 Score =  249 bits (635), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 167/391 (42%), Positives = 222/391 (56%), Gaps = 14/391 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    LE    LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R
Sbjct: 1   MTETQSLELAKALISRPSVTPDDQNCQKLLAERLHKIGFAAEELHFGD-----TKNIWLR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+AP + FAGH DVVP G    W  PPF     +G++YGRG  DMK  IACF+ A  R
Sbjct: 56  RGTKAPVVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTGIACFVTACER 115

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ ++  + GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD I
Sbjct: 116 FVAEHPDHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMI 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG +T+ GKQGH+AYPHL  NPI    P L +LT   +D GN  F PT+ +I
Sbjct: 176 KNGRRGSLSGNLTVKGKQGHIAYPHLAVNPIHTFAPALLELTQEVWDEGNEYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S 
Sbjct: 236 SNINGGTGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDK-----HGVQYDLQWSC 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTM 357
              P FLT   KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+
Sbjct: 291 SGQP-FLTQAGKLTDVARAAIAETCGVEAELSTTGGTSDGRFIKAIAKELIELGPSNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFITPS 388
           H +NEN  L D+  L+ +YE  L       +
Sbjct: 350 HQINENVRLDDIPKLSAVYEGILARLLAGNA 380


>gi|291044051|ref|ZP_06569767.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae DGI2]
 gi|293399236|ref|ZP_06643401.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae F62]
 gi|291012514|gb|EFE04503.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae DGI2]
 gi|291610650|gb|EFF39760.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae F62]
          Length = 411

 Score =  249 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 171/391 (43%), Positives = 226/391 (57%), Gaps = 14/391 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    LE    LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R
Sbjct: 31  MTETQSLELAKALISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGD-----TKNIWLR 85

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+AP + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK SIACF+ A  R
Sbjct: 86  RGTKAPVVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTSIACFVTACER 145

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ ++  + GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GD I
Sbjct: 146 FVAEHPDHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVDKLGDMI 205

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG +T+ GKQGH+AYPHL  NPI    P L +LT   +D GN  F PT+ +I
Sbjct: 206 KNGRRGSLSGSLTVKGKQGHIAYPHLAVNPIHTFAPALLELTQEIWDEGNEYFPPTSFQI 265

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S 
Sbjct: 266 SNINGGTGATNVIPGELNVKFNFRFSTESTETGLKQRVHAILDK-----HGVQYDLQWSC 320

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTM 357
              P FLTH  KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+
Sbjct: 321 SGQP-FLTHAGKLTDVARTAIAETCGVEAELSTTGGTSDGRFIKAIAKELIELGPSNATI 379

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFITPS 388
           H +NEN  L D+  L+ +YE  L       +
Sbjct: 380 HQINENVRLDDIPKLSAVYERILARLLAEKA 410


>gi|59801375|ref|YP_208087.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae FA
           1090]
 gi|240115450|ref|ZP_04729512.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           PID18]
 gi|240125550|ref|ZP_04738436.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           SK-92-679]
 gi|254493561|ref|ZP_05106732.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae 1291]
 gi|260440738|ref|ZP_05794554.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae DGI2]
 gi|268601127|ref|ZP_06135294.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           PID18]
 gi|268684139|ref|ZP_06151001.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           SK-92-679]
 gi|75432474|sp|Q5F812|DAPE_NEIG1 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|59718270|gb|AAW89675.1| putative succinyl-diaminopimelate desuccinylase [Neisseria
           gonorrhoeae FA 1090]
 gi|226512601|gb|EEH61946.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae 1291]
 gi|268585258|gb|EEZ49934.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           PID18]
 gi|268624423|gb|EEZ56823.1| succinyl-diaminopimelate desuccinylase [Neisseria gonorrhoeae
           SK-92-679]
          Length = 381

 Score =  249 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 171/391 (43%), Positives = 226/391 (57%), Gaps = 14/391 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    LE    LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R
Sbjct: 1   MTETQSLELAKALISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGD-----TKNIWLR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+AP + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK SIACF+ A  R
Sbjct: 56  RGTKAPVVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTSIACFVTACER 115

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ ++  + GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GD I
Sbjct: 116 FVAEHPDHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVDKLGDMI 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG +T+ GKQGH+AYPHL  NPI    P L +LT   +D GN  F PT+ +I
Sbjct: 176 KNGRRGSLSGSLTVKGKQGHIAYPHLAVNPIHTFAPALLELTQEIWDEGNEYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S 
Sbjct: 236 SNINGGTGATNVIPGELNVKFNFRFSTESTETGLKQRVHAILDK-----HGVQYDLQWSC 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTM 357
              P FLTH  KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+
Sbjct: 291 SGQP-FLTHAGKLTDVARTAIAETCGVEAELSTTGGTSDGRFIKAIAKELIELGPSNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFITPS 388
           H +NEN  L D+  L+ +YE  L       +
Sbjct: 350 HQINENVRLDDIPKLSAVYERILARLLAEKA 380


>gi|145631527|ref|ZP_01787295.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           R3021]
 gi|144982872|gb|EDJ90389.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           R3021]
          Length = 377

 Score =  249 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 156/388 (40%), Positives = 217/388 (55%), Gaps = 13/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +     LI  PS++P D G   I+   L+ LGF IE   F     +   NL+A+ 
Sbjct: 1   MREKVVSLAQDLIHRPSISPNDEGCQQIIAERLEKLGFQIEWMPF-----NDTLNLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT  P + FAGH DVVP GD N W+ PPFSA I +G +YGRG  DMKGS+A  I A   +
Sbjct: 56  GTSEPVIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEY 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G+I+LLIT DEE  A +GT +++  +  + EK   C+VGEP+    +GD +K
Sbjct: 116 VKANPNHKGTIALLITSDEEAAAKDGTIRVVETLMARNEKITYCMVGEPSSAKNLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++G + I G QGHVAYPHL ENPI    P L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITGNLYIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDKGNEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIPA++ + FN+R+     ++ +K+++      G+     L + + ++  
Sbjct: 236 NIHAGTGSNNVIPAELYIQFNLRYCTEVTDEIIKQKV-----AGMLEKHNLKYRIEWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P FLT   KL   ++ +I  T G  P   T GGTSD RFI      V+EFG +  T+H
Sbjct: 291 GKP-FLTKPGKLLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFIT 386
            +NE  S++DL     IY   L N   +
Sbjct: 350 KVNECVSVEDLGKCGEIYHKMLVNLLDS 377


>gi|254448798|ref|ZP_05062255.1| succinyl-diaminopimelate desuccinylase [gamma proteobacterium
           HTCC5015]
 gi|198261639|gb|EDY85927.1| succinyl-diaminopimelate desuccinylase [gamma proteobacterium
           HTCC5015]
          Length = 376

 Score =  249 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 155/385 (40%), Positives = 219/385 (56%), Gaps = 13/385 (3%)

Query: 3   PDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT 62
            + LE    LI+  S+TP D G   +++  L+ +GF +E   F       V N +AR G 
Sbjct: 2   SNTLELAQALIQRRSITPDDAGCQDLMIQRLEAIGFQVERLRFGD-----VDNFWARRGQ 56

Query: 63  EAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIP 122
             P   FAGH DVVP G  + WT+PPF A +A+G+++GRG  DMKGS+A  I A   F+ 
Sbjct: 57  SGPLFCFAGHTDVVPTGPESEWTHPPFEAVVADGQLHGRGAADMKGSLAAMIVACENFVA 116

Query: 123 KYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
            + +  GSI+ LIT DEEGPA NGT K++ W+E++ E  D C+VGEP+    +GD IK G
Sbjct: 117 AHPDHKGSIAFLITSDEEGPADNGTVKVMEWLEQRQEAIDYCLVGEPSSTDRVGDIIKNG 176

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSL   +T+ G QGHVAYPHL  NP+    P L +L    +D GN  F  T+ +++ I
Sbjct: 177 RRGSLGCVLTVKGIQGHVAYPHLARNPVHQAAPALAELAATQWDNGNDHFPATSFQVSNI 236

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
             G  + NVIP   ++ FN RF+   NE  L++   + L K         +T+ +     
Sbjct: 237 QAGTGATNVIPGHCEVVFNFRFSTETNEADLRQRTEAILDKHGLE-----YTIDWKLSGH 291

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHAL 360
           P FLT + +L     K+I NTTG    LST+GGTSD RFI      V+E G V  T+H +
Sbjct: 292 P-FLTAEGELVEAAQKAILNTTGKPTQLSTAGGTSDGRFIAPSGAQVVELGPVNATIHQV 350

Query: 361 NENASLQDLEDLTCIYENFLQNWFI 385
           +E+ +  +L+ L  IY + L++   
Sbjct: 351 DEHTNAAELDTLERIYTDTLKHLLA 375


>gi|302878940|ref|YP_003847504.1| succinyl-diaminopimelate desuccinylase [Gallionella
           capsiferriformans ES-2]
 gi|302581729|gb|ADL55740.1| succinyl-diaminopimelate desuccinylase [Gallionella
           capsiferriformans ES-2]
          Length = 376

 Score =  249 bits (634), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 161/386 (41%), Positives = 220/386 (56%), Gaps = 14/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT + L     LI   S+TP D G   IL+  L+ LGF+IE   F       V N +AR 
Sbjct: 1   MT-ETLALAKALIARRSLTPDDAGCQEILIERLEKLGFTIERMRF-----GNVDNFWARR 54

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G  AP ++FAGH DVVP G    W  PPF  TI +  ++GRG  DMK SIA FI A+  F
Sbjct: 55  GINAPVVVFAGHTDVVPSGPVESWFSPPFEPTIRDEMLFGRGAADMKTSIAAFITAIEAF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  +    GSI+LLIT DEEG A++GT +++  ++ +GE  D CIVGEPT N ++GD IK
Sbjct: 115 VEDHPQHDGSIALLITSDEEGVAVDGTVRVVEALQARGETLDYCIVGEPTSNKLVGDMIK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+G + + G QGH+AYPHL +NPI  + P + +L    +D GN  F PT+ +I+
Sbjct: 175 NGRRGSLNGTLVVQGVQGHIAYPHLVKNPIHMVSPAIAELATTVWDEGNEYFPPTSWQIS 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            ++ G  + NV+P  V + FN RF+    E  LK  + + L K         + + +   
Sbjct: 235 NMNGGTGATNVVPGTVDILFNFRFSTASTELELKNRVHAILDKHGVK-----YDLLWELS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMH 358
             P        L   +S++I  + G  P LSTSGGTSD RFI D C  VIEFG +  T+H
Sbjct: 290 GKPYITPKGN-LVEAISRAIEQSYGITPELSTSGGTSDGRFIADICAQVIEFGPLNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            LNE  ++ D+E L   Y+  L+N  
Sbjct: 349 KLNECVAVADIEPLKLTYQRTLENLL 374


>gi|163738124|ref|ZP_02145540.1| succinyl-diaminopimelate desuccinylase [Phaeobacter gallaeciensis
           BS107]
 gi|161388740|gb|EDQ13093.1| succinyl-diaminopimelate desuccinylase [Phaeobacter gallaeciensis
           BS107]
          Length = 385

 Score =  249 bits (634), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 158/389 (40%), Positives = 219/389 (56%), Gaps = 12/389 (3%)

Query: 1   MTPDCLE---HLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLY 57
           MT   L+       LI+C SVTP++GGA  +L   L   GF+    D        V NL 
Sbjct: 1   MTHSPLDPQQLTADLIRCASVTPEEGGALVLLDKVLSAAGFTCTRVD-----RGEVSNLI 55

Query: 58  ARFGTEA--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIA 115
           AR+G +     + F GH DVVP GD N WT  PF A   +G +YGRG  DMK  +A F+A
Sbjct: 56  ARWGDKGHPRTMGFNGHTDVVPVGDTNAWTVDPFGAEEKDGFLYGRGATDMKSGVAAFVA 115

Query: 116 AVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIG 175
           A    +      G+I L ITGDEEG AI+GT  +L  ++++GE+   C+VGEPTC   +G
Sbjct: 116 AAIDLVQTTPPDGAILLTITGDEEGDAIDGTTALLDHMDREGEQMAVCLVGEPTCPDKMG 175

Query: 176 DTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTN 235
           + IKIGRRGSLS   T+ G QGH AYPH  +NP+  ++ L+ +L +   D G   F  + 
Sbjct: 176 EMIKIGRRGSLSAWFTVTGVQGHSAYPHRAKNPLNAMVRLMDRLASHELDQGTEHFDAST 235

Query: 236 MEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVH 295
           + + TID GNP+ NVIPAQ + + NIRFND      L + +R+   +       +   V 
Sbjct: 236 LAVVTIDTGNPATNVIPAQTRSTVNIRFNDAHTGAELSDWLRAEAARA-AKDFGVDIAVE 294

Query: 296 FSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGR 355
                          L+ L+S ++   TG  P LST+GGTSDARF+K++CPV+E GLVG+
Sbjct: 295 IKVSGESFITPP-GPLSDLVSAAVETETGRKPQLSTTGGTSDARFVKNHCPVVEVGLVGK 353

Query: 356 TMHALNENASLQDLEDLTCIYENFLQNWF 384
           TMH ++E   +  +  L  IY   L+++F
Sbjct: 354 TMHQVDERVEIAQIHQLKSIYGRILRDYF 382


>gi|15677382|ref|NP_274537.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           MC58]
 gi|81784416|sp|Q9JYL2|DAPE_NEIMB RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|7226774|gb|AAF41885.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           MC58]
 gi|316986004|gb|EFV64941.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           H44/76]
 gi|325140681|gb|EGC63197.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           CU385]
 gi|325199868|gb|ADY95323.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           H44/76]
          Length = 381

 Score =  249 bits (634), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 168/391 (42%), Positives = 224/391 (57%), Gaps = 14/391 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    LE   +LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R
Sbjct: 1   MTETQSLELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGD-----TKNIWLR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+AP + FAGH DVVP G    W  PPF     +G++YGRG  DMK SIACF+ A  R
Sbjct: 56  RGTKAPVVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACER 115

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ K+  + GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD I
Sbjct: 116 FVAKHPNHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMI 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I
Sbjct: 176 KNGRRGSLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S 
Sbjct: 236 SNINGGTGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDK-----HGVQYDLQWSC 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTM 357
              P FLT   KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+
Sbjct: 291 SGQP-FLTQAGKLTDVARAAIAETCGIEAELSTTGGTSDGRFIKAIAQELIELGPSNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFITPS 388
           H +NEN  L D+  L+ +YE  L       +
Sbjct: 350 HQINENVRLNDIPKLSAVYEGILARLLAGNA 380


>gi|254426791|ref|ZP_05040498.1| succinyl-diaminopimelate desuccinylase [Alcanivorax sp. DG881]
 gi|196192960|gb|EDX87919.1| succinyl-diaminopimelate desuccinylase [Alcanivorax sp. DG881]
          Length = 386

 Score =  249 bits (634), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 146/384 (38%), Positives = 214/384 (55%), Gaps = 13/384 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L++  +LI+  SVTP+D G    ++  L+ LGF  E   F+      V+NL+AR G + 
Sbjct: 13  TLDYTKELIRRASVTPEDEGCQDWMIEKLEALGFECETLWFEE-----VRNLWARRGKQG 67

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P   FAGH DVVP GD   W Y PF+ T     +YGRG  DMKGSIA  + A+  FI  +
Sbjct: 68  PVFAFAGHTDVVPTGDVAAWKYDPFTPTEEGDLLYGRGTADMKGSIAAMMVAMEDFIAAH 127

Query: 125 K-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
             + GS++ LIT DEEGP++NGT K++  ++ + E  D C+VGEP+  + +GD IK GRR
Sbjct: 128 PDHNGSLAFLITADEEGPSVNGTVKVVEHLQARQEHMDYCLVGEPSSTNTVGDVIKNGRR 187

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL  ++T+ G QGHVAYPHL  NP+  + P L +L    +D GN  F  T+ +I+ I+ 
Sbjct: 188 GSLGAKLTVKGIQGHVAYPHLARNPVHDVAPALAELATTEWDQGNDFFPATSFQISNING 247

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NVIP   ++ FN RF+    +  L+E   +   K   +     + + ++    P 
Sbjct: 248 GTGATNVIPGTCEIIFNFRFSTELTDAILRERTEAIFDKHGLD-----YDLKWTLSGQPF 302

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
                  L      +I + T     LST+GGTSD RFI      V+E G    T+H ++E
Sbjct: 303 LTD-RGALVDAAVSAIRDVTELDTELSTAGGTSDGRFIAPTGTQVVELGPTNATIHKVDE 361

Query: 363 NASLQDLEDLTCIYENFLQNWFIT 386
           + S+ +L+ LT IY+  LQ+   +
Sbjct: 362 HTSISELDTLTQIYQRLLQHLMTS 385


>gi|294140704|ref|YP_003556682.1| succinyl-diaminopimelate desuccinylase [Shewanella violacea DSS12]
 gi|293327173|dbj|BAJ01904.1| succinyl-diaminopimelate desuccinylase [Shewanella violacea DSS12]
          Length = 376

 Score =  249 bits (634), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 156/386 (40%), Positives = 214/386 (55%), Gaps = 13/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+ D L     LI  PSVTP D G   ++ + L   GF IE   F+        N++AR 
Sbjct: 1   MSQDVLTLAQDLISRPSVTPLDEGCQQLMADRLAKAGFDIEPMVFED-----TTNMWARR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GTE P   FAGH DVVP GD N W  PPF   + +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GTEKPLFCFAGHTDVVPVGDLNRWHTPPFEPVVIDGYLHGRGAADMKGSLAAMLVATERF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + K  +  GSI+ LIT DEEGP INGT +++  +E + EK    +VGEP+  H +GD +K
Sbjct: 116 VEKNPDHKGSIAFLITSDEEGPFINGTTRVIDTLEARDEKITWSLVGEPSSTHKLGDIVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+G +T++G QGHVAYPHL +NPI   +P L +L  + +D GN  F PT+ +I 
Sbjct: 176 NGRRGSLTGNLTVNGIQGHVAYPHLADNPIHKAMPALDELAKMHWDKGNEYFPPTSFQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NVIP  +++ FN R++       L + + + L     +   L + + +   
Sbjct: 236 NINGGTGASNVIPGALEVMFNFRYSTEVTADILIQRVLNIL-----DAHGLEYDISWVYN 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT D  L     ++I   TG      T+GGTSD RFI      VIE G V  T+H
Sbjct: 291 GLP-FLTGDGPLLDATREAIKQVTGTDTDPQTTGGTSDGRFIAPTGAQVIELGPVNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            +NE   + D+E L   YE  L+   
Sbjct: 350 KVNECVKVDDIEQLALCYEVILEKLL 375


>gi|329890985|ref|ZP_08269328.1| succinyl-diaminopimelate desuccinylase [Brevundimonas diminuta ATCC
           11568]
 gi|328846286|gb|EGF95850.1| succinyl-diaminopimelate desuccinylase [Brevundimonas diminuta ATCC
           11568]
          Length = 397

 Score =  248 bits (633), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 170/381 (44%), Positives = 224/381 (58%), Gaps = 6/381 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQT----KNTSIVKNLYAR 59
           D +E    LI+ PSVTP D GA  +L   L  LGF+     F+      + + ++NLYAR
Sbjct: 10  DPVELTRDLIRIPSVTPADEGAMDVLERALTGLGFACRRMVFEGPSGVGHDARIENLYAR 69

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT +P+L FAGH DVVP GD   W+  PF     +G +YGRG VDMKG IA ++AAV+R
Sbjct: 70  RGTASPNLCFAGHTDVVPIGDLKAWSAGPFEGETRDGVLYGRGAVDMKGGIAAWVAAVSR 129

Query: 120 FIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
            + + +  GS+S LITGDEEGPA++GTK+++  +  +GE  DAC+VGEP+  H +GD IK
Sbjct: 130 VLARDEIEGSLSFLITGDEEGPALHGTKRVVQTLAAEGEVIDACVVGEPSSAHHLGDMIK 189

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           +GRRGSL+  IT+ GKQGHVAYP    NP   +  LL +L     D G   F P+N+EIT
Sbjct: 190 VGRRGSLNTWITVFGKQGHVAYPDRAANPTPVIARLLARLDAHVLDEGYPEFPPSNLEIT 249

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           TIDVGNP+ N+IPA+ K   NIRFN       L + +                  H  S 
Sbjct: 250 TIDVGNPASNIIPAEAKARLNIRFNPTHTGDGLIDWLNREAGALQAETGLRIELEHMCSG 309

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
               FLT      S +  ++    G  P  ST+GGTSDARFI+  CPV+E GLVG+TMH 
Sbjct: 310 --EAFLTEPGVFVSAVQDAVEAVLGRRPEASTTGGTSDARFIRSLCPVLELGLVGQTMHQ 367

Query: 360 LNENASLQDLEDLTCIYENFL 380
           ++E     +L  LT  YE  +
Sbjct: 368 VDERVPEAELRALTDAYERVI 388


>gi|212710863|ref|ZP_03318991.1| hypothetical protein PROVALCAL_01931 [Providencia alcalifaciens DSM
           30120]
 gi|212686560|gb|EEB46088.1| hypothetical protein PROVALCAL_01931 [Providencia alcalifaciens DSM
           30120]
          Length = 376

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 152/387 (39%), Positives = 215/387 (55%), Gaps = 13/387 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +E   QLI  PS++P D G   +L+  L  +GF++E+  F         N +A  
Sbjct: 1   MNCPVIELAQQLIARPSISPDDQGCQDLLIERLNNIGFTVEKMPFGD-----TLNFWAHR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPFS TI    +YGRG  DMKGSIA  + A  RF
Sbjct: 56  GNAGKTLAFAGHTDVVPAGDHSKWQTPPFSPTIINQHLYGRGAADMKGSIAAMVVAAERF 115

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + KY  + G ++ LIT DEE  A +GT K++  ++ + E  D C+VGEP+    +GD IK
Sbjct: 116 VEKYPTHTGRLAFLITSDEEAKATHGTVKVVETLQARHESVDYCLVGEPSSQSALGDIIK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++  +TI G QGHVAYPHL +NP+      L +L    +D GN  F  T+M+I 
Sbjct: 176 NGRRGSITAHLTILGTQGHVAYPHLADNPVHRATNFLQELVTTKWDDGNQYFPATSMQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NVIP ++K+ FN RF+    +  ++E +   L +         + + +   
Sbjct: 236 NINAGTGADNVIPGELKVQFNFRFSTELTDTIIRERVTDMLERHGLA-----YRLEWFLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT D +L S   ++I+  TG    LSTSGGTSD RFI      VIE G +  T+H
Sbjct: 291 GQP-FLTGDSELVSATVQAIHEVTGRETTLSTSGGTSDGRFIAQMGTHVIELGPLNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            ++E  S++DL+ L  IYE  ++   +
Sbjct: 350 KVDECVSIEDLQQLAVIYERIMELLLL 376


>gi|283832145|ref|ZP_06351886.1| succinyl-diaminopimelate desuccinylase [Citrobacter youngae ATCC
           29220]
 gi|291071775|gb|EFE09884.1| succinyl-diaminopimelate desuccinylase [Citrobacter youngae ATCC
           29220]
          Length = 375

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 151/385 (39%), Positives = 219/385 (56%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRAVGFTVERMDFGDTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GKGE-TLAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++  + G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   I+GD +K
Sbjct: 115 VAQHPNHQGRLAFLITSDEEASAKNGTVKVVEALMARNERLDYCLVGEPSSTEIVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P+L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K  +   L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFIQFNFRFSTELTDEMIKSRVLELLDK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTERGKLVDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|163742483|ref|ZP_02149869.1| succinyl-diaminopimelate desuccinylase [Phaeobacter gallaeciensis
           2.10]
 gi|161384068|gb|EDQ08451.1| succinyl-diaminopimelate desuccinylase [Phaeobacter gallaeciensis
           2.10]
          Length = 385

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 158/389 (40%), Positives = 219/389 (56%), Gaps = 12/389 (3%)

Query: 1   MTPDCLE---HLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLY 57
           MT   L+       LI+C SVTP++GGA  +L   L   GF+    D        V NL 
Sbjct: 1   MTHSPLDPQQLTADLIRCASVTPEEGGALVLLDKVLSAAGFTCTRVD-----RGEVSNLI 55

Query: 58  ARFGTEA--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIA 115
           AR+G +     + F GH DVVP GD N WT  PF A   +G +YGRG  DMK  +A F+A
Sbjct: 56  ARWGDKGHPRTMGFNGHTDVVPVGDTNAWTVDPFGAEEKDGFLYGRGATDMKSGVAAFVA 115

Query: 116 AVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIG 175
           A    +      G+I L ITGDEEG AI+GT  +L  ++++GE+   C+VGEPTC   +G
Sbjct: 116 AAIDLVQTTPPDGAILLTITGDEEGDAIDGTTALLDHMDREGEQMAVCLVGEPTCPDEMG 175

Query: 176 DTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTN 235
           + IKIGRRGSLS   T+ G QGH AYPH  +NP+  ++ L+ +L +   D G   F  + 
Sbjct: 176 EMIKIGRRGSLSAWFTVTGVQGHSAYPHRAKNPLNAMVRLMDRLASHELDQGTEHFDAST 235

Query: 236 MEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVH 295
           + + TID GNP+ NVIPAQ + + NIRFND      L + +R+   +       +   V 
Sbjct: 236 LAVVTIDTGNPATNVIPAQTRSTVNIRFNDAHTGAELSDWLRAEAARA-AKDFGVDIAVE 294

Query: 296 FSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGR 355
                          L+ L+S ++   TG  P LST+GGTSDARF+K++CPV+E GLVG+
Sbjct: 295 IKVSGESFITPP-GPLSDLVSAAVETETGRKPQLSTTGGTSDARFVKNHCPVVEVGLVGK 353

Query: 356 TMHALNENASLQDLEDLTCIYENFLQNWF 384
           TMH ++E   +  +  L  IY   L+++F
Sbjct: 354 TMHQVDERVEIAQIHQLKSIYGRILRDYF 382


>gi|163744976|ref|ZP_02152336.1| succinyl-diaminopimelate desuccinylase [Oceanibulbus indolifex
           HEL-45]
 gi|161381794|gb|EDQ06203.1| succinyl-diaminopimelate desuccinylase [Oceanibulbus indolifex
           HEL-45]
          Length = 381

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 155/383 (40%), Positives = 221/383 (57%), Gaps = 9/383 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D ++   +L++C SVTP + GA  +L   L   GF     D        V NL+ R+G++
Sbjct: 5   DPVDLTAKLVRCASVTPVNDGALEVLEEVLGAAGFDCTRVD-----RGGVCNLFVRWGSK 59

Query: 64  A--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
                  F GH DVVP GD   W+ PPF A I +G +YGRG  DMK  +A F+AA   F+
Sbjct: 60  GNGKSFGFNGHTDVVPIGDEADWSMPPFGAEIKDGIMYGRGTTDMKSGVAAFVAAAVDFV 119

Query: 122 PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
                 GSI L ITGDEEG A++GT  +L ++ + GE+ D C+VGEPTC   +GD IKIG
Sbjct: 120 KDTPPDGSIVLAITGDEEGDALDGTTALLDYMAENGERMDVCLVGEPTCPERMGDMIKIG 179

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGS++    + GKQGH AYPH   NP+  ++ L+ +L +   D G+  F  + + + T+
Sbjct: 180 RRGSMNAHFKVTGKQGHAAYPHRANNPLPAMMRLMDRLASHELDQGSDHFDASTLAVVTV 239

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
           D GN + NVIPAQ   + NIRFND  +   L E +R    K   +   L   V  +    
Sbjct: 240 DTGNKATNVIPAQCLGAVNIRFNDHHSGAALSELLRGEADKI-ASEFSLQVDVDITISGE 298

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALN 361
                    L+ L++ ++   TG  P LST+GGTSDARF+K +CPV+EFGLVG++MH ++
Sbjct: 299 SFITPP-GALSDLVAGAVEAETGVKPELSTTGGTSDARFVKAHCPVVEFGLVGQSMHQVD 357

Query: 362 ENASLQDLEDLTCIYENFLQNWF 384
           E+  ++ +E L  IY   L+++F
Sbjct: 358 EHVRIEHIEQLKSIYARVLRDYF 380


>gi|295691227|ref|YP_003594920.1| succinyl-diaminopimelate desuccinylase [Caulobacter segnis ATCC
           21756]
 gi|295433130|gb|ADG12302.1| succinyl-diaminopimelate desuccinylase [Caulobacter segnis ATCC
           21756]
          Length = 386

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 171/383 (44%), Positives = 225/383 (58%), Gaps = 10/383 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +E    LI+ PSVTP D GA   L   L+ LGF+     F       ++NLYAR GT 
Sbjct: 12  DPVELAQALIRRPSVTPADAGAMDTLQRQLEALGFACRRMTFGE-----IENLYARRGTA 66

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            P+L FAGH DVVP GD   WT  PF A I +G ++GRG VDMK +IA F   VA     
Sbjct: 67  RPNLCFAGHTDVVPVGDDAAWTAGPFEAEIKDGILFGRGAVDMKSAIAAF---VAAVANV 123

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
             + GSIS LITGDEEG A +GT K++  +  +GE  D CIVGEPT  +++GD +KIGRR
Sbjct: 124 PDHAGSISFLITGDEEGVAEDGTVKVVEALAAEGEIIDHCIVGEPTSANVLGDMVKIGRR 183

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++  I + GKQGHVAYPH   NPI  ++ +L +L +   D G T F P+N+E+TT+DV
Sbjct: 184 GSINAWIAVDGKQGHVAYPHRAANPIPVMVDILSRLQSRVLDEGYTGFQPSNLEVTTVDV 243

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GN + NVIPA  K   NIRFN     K L   I     +  +        +   S     
Sbjct: 244 GNTATNVIPASAKARVNIRFNPAHKGKDLAAWIERECREAAEGFSGRVEALCKISG--EA 301

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           FLT     T ++  ++ + TG +P LST+GGTSDARFI+  CPV+EFGLVG TMH ++E 
Sbjct: 302 FLTEPGAFTDVIVAAVGDATGRVPELSTTGGTSDARFIRALCPVVEFGLVGSTMHQVDER 361

Query: 364 ASLQDLEDLTCIYENFLQNWFIT 386
             ++++  L   YE  +  +F  
Sbjct: 362 VPVEEVRQLAGAYEALINRYFAA 384


>gi|261392225|emb|CAX49740.1| succinyl-diaminopimelate desuccinylase (SDAP) [Neisseria
           meningitidis 8013]
          Length = 381

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 168/391 (42%), Positives = 225/391 (57%), Gaps = 14/391 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    LE   +LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R
Sbjct: 1   MTETQSLELAKELISRPSVTPDDQNCQQLLAERLHKIGFAAEELHFGD-----TKNIWLR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+ P + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK SIACF+ A  R
Sbjct: 56  RGTKVPVVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTSIACFVTACER 115

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ ++  + GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GD I
Sbjct: 116 FVAEHPDHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVGKLGDMI 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I
Sbjct: 176 KNGRRGSLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S 
Sbjct: 236 SNINGGTGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDK-----HGVQYDLQWSC 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTM 357
              P FLTH  KLT +   +I    G    LST+GGTSD RFIK     +IE G    T+
Sbjct: 291 SGQP-FLTHAGKLTDVARAAIAEICGVETELSTTGGTSDGRFIKAIAKELIELGPSNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFITPS 388
           H +NEN  L D+  L+ +YE  L       +
Sbjct: 350 HQINENVRLNDIPKLSAVYEGILARLLAGNA 380


>gi|157961812|ref|YP_001501846.1| succinyl-diaminopimelate desuccinylase [Shewanella pealeana ATCC
           700345]
 gi|238055220|sp|A8H424|DAPE_SHEPA RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|157846812|gb|ABV87311.1| succinyl-diaminopimelate desuccinylase [Shewanella pealeana ATCC
           700345]
          Length = 381

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 153/385 (39%), Positives = 206/385 (53%), Gaps = 13/385 (3%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
               L     LI  PSVTP D G   ++   L   GF IE   F         N++AR G
Sbjct: 6   ESAVLSLAKDLISRPSVTPLDEGCQSLMAERLSQAGFEIESMVFDD-----TTNMWARRG 60

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
           T++P   FAGH DVVP GD N W  PPF   + +  ++GRG  DMKGS+A  + A  RF+
Sbjct: 61  TQSPVFCFAGHTDVVPVGDLNRWHTPPFEPVVIDDYLHGRGAADMKGSLAAMLVATERFV 120

Query: 122 PKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
            K+  + GSI+ LIT DEEGP INGT +++  +E + EK    +VGEP+  H +GD +K 
Sbjct: 121 NKHPDHQGSIAFLITSDEEGPFINGTTRVIDTLEARNEKITWSLVGEPSSTHKLGDIVKN 180

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGSL+G +T+ G QGHVAYPHL +NPI    P L +L  + +D GN  F PT+ +I  
Sbjct: 181 GRRGSLTGNLTVKGIQGHVAYPHLADNPIHKAAPALDELARMKWDNGNEFFPPTSFQIAN 240

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV 300
           I+ G  + NVIP  +++ FN R++     + L E + + L     +   L + + +    
Sbjct: 241 INGGTGASNVIPGALEVMFNFRYSTEVTAEILIERVLNIL-----DAHGLDYDISWVYNG 295

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHA 359
            P        L      +I   TG      TSGGTSD RFI      VIE G V  T+H 
Sbjct: 296 LPFLTGE-GPLLEATKAAIKKVTGTDTDPQTSGGTSDGRFIAPTGAQVIEVGPVNATIHK 354

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           +NE   + DLE LT  YE  L+N  
Sbjct: 355 VNECVKVSDLELLTDCYEAILENLL 379


>gi|317492755|ref|ZP_07951180.1| succinyl-diaminopimelate desuccinylase [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316919278|gb|EFV40612.1| succinyl-diaminopimelate desuccinylase [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 376

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 151/385 (39%), Positives = 221/385 (57%), Gaps = 13/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT   LE   QLIKC SV+P+D G   +L+  L+ +GF+IE+  F         N +A  
Sbjct: 1   MTCPVLELTQQLIKCRSVSPEDAGCQELLIERLQTIGFTIEDMTFGDTR-----NFWAYR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   P L FAGH DVVP GD + WT PP+  T+ +G IYGRG  DMKGS+A  + A  RF
Sbjct: 56  GGNGPTLAFAGHTDVVPSGDESKWTNPPYEPTLRDGMIYGRGAADMKGSLAAMVVAAERF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           I    +  G ++ LIT DEE  A+NGT K++  +  + EK + C+VGEP+    +GD +K
Sbjct: 116 IEANPHHQGRLAFLITSDEEASAVNGTVKVVEKLIARQEKVEYCLVGEPSSTEKVGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++  + I G QGHVAYPHL +NPI    P++++L N  +D GN  F PT+M+I 
Sbjct: 176 NGRRGSMTANLYIQGVQGHVAYPHLADNPIHKAAPMINELVNEVWDEGNEFFPPTSMQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+      ++K  +++ L     +  +L++++ ++  
Sbjct: 236 NIAAGTGSNNVIPGELYIQFNFRFSTESTVDSIKTRVKALL-----DRYQLTYSLEWNVS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT    L   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 291 GLP-FLTARGHLVDAVVNAIQHYGEITPQLLTTGGTSDGRFIAQMGTQVVELGPVNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            ++E     DL+ L+ +Y+  ++  
Sbjct: 350 KVDECVHAADLQMLSRMYQRIMEQL 374


>gi|149200888|ref|ZP_01877863.1| succinyl-diaminopimelate desuccinylase [Roseovarius sp. TM1035]
 gi|149145221|gb|EDM33247.1| succinyl-diaminopimelate desuccinylase [Roseovarius sp. TM1035]
          Length = 383

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 161/383 (42%), Positives = 221/383 (57%), Gaps = 9/383 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D  +    LI+C SVTP++GGA  +L   L   GFS    D        V NL+AR+G +
Sbjct: 7   DPAQLTADLIRCASVTPEEGGALRLLEQVLTDAGFSCVRVD-----RGEVPNLFARWGPK 61

Query: 64  A--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
                  F GH DVVP GD   W+ PPF     +G I+GRG  DMK  +A F AA   F+
Sbjct: 62  GAARSFGFNGHTDVVPVGDLAAWSVPPFGGVEKDGMIWGRGATDMKSGVAAFAAAAVDFV 121

Query: 122 PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
                 G++ L ITGDEEG A++GT  +L W+   GE   AC+VGEPTC   +G+ IKIG
Sbjct: 122 RDTPPDGAVILAITGDEEGDAVDGTVALLDWMTAHGEAMTACLVGEPTCPERMGEMIKIG 181

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSLS   T+ G QGH AYPH   NP+  +  L+ +L +   DTG   F P+ + + TI
Sbjct: 182 RRGSLSAWFTLTGVQGHSAYPHRARNPLPAMARLMDRLASHQLDTGTAHFDPSTLAVVTI 241

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
           D GNP+ NVIPAQ + + NIRFND  +   L + +++ L +   +           S   
Sbjct: 242 DTGNPATNVIPAQCRATVNIRFNDAHHSTDLIKWMQAELDRVCGDFEITGEMRVKVSG-- 299

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALN 361
             FLT    L+ L+++++    G +P LST+GGTSDARF+KD+CPV+EFGLVG+TMH ++
Sbjct: 300 ESFLTPPGPLSDLVARAVAAEAGVVPTLSTTGGTSDARFVKDHCPVVEFGLVGQTMHQVD 359

Query: 362 ENASLQDLEDLTCIYENFLQNWF 384
           E   +  +  L  IY   L+++F
Sbjct: 360 ERVEVAQIHQLKAIYGRVLRDYF 382


>gi|331006453|ref|ZP_08329756.1| N-succinyl-L,L-diaminopimelate desuccinylase [gamma proteobacterium
           IMCC1989]
 gi|330419753|gb|EGG94116.1| N-succinyl-L,L-diaminopimelate desuccinylase [gamma proteobacterium
           IMCC1989]
          Length = 390

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 154/382 (40%), Positives = 213/382 (55%), Gaps = 9/382 (2%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L+    LI+ PSVTP D G   +++  L+ +GF  +   F       +KNL+A  G   
Sbjct: 15  TLQLACDLIERPSVTPDDAGCQPLMIKRLEAIGFHCQTLIFDEGGVP-IKNLWAVRGDSG 73

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P   FAGH DVVP G  + W  PPFS TI +G +YGRG  DMKGS+A  + A   F+   
Sbjct: 74  PIFCFAGHTDVVPTGPESEWKIPPFSPTIKDGMLYGRGAADMKGSLASMVVACEDFVAAN 133

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
            N  G I+ LIT DEEGPAI+GT K++  ++++G   D C+VGEP+    +GDTIK GRR
Sbjct: 134 PNHSGRIAFLITADEEGPAIDGTVKVVKHLQEQGTHIDWCLVGEPSSTSKVGDTIKNGRR 193

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL   ++I+GKQGHVAYPHL +NPI  + P L +L N  +D GN  F  T+ +++  + 
Sbjct: 194 GSLGAWLSINGKQGHVAYPHLADNPIHRIAPALAELANENWDNGNDFFPATSFQVSNFNS 253

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NVIP +V +  N RF+     + L++   + L K   +     + V +     P 
Sbjct: 254 GTGATNVIPGKVDIICNFRFSTEVTAEELQQRTEAILQKHELD-----YVVDWRLSGLP- 307

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
           FLT +  L      +I  TTG    LST+GGTSD RFI      V+E G V  T+H ++E
Sbjct: 308 FLTAEGDLVDAAVTAIKKTTGIDTELSTAGGTSDGRFIAPTGSQVVELGPVNATIHQVDE 367

Query: 363 NASLQDLEDLTCIYENFLQNWF 384
                DLE LT IY   ++   
Sbjct: 368 CILASDLETLTTIYTGIMEELL 389


>gi|99082836|ref|YP_614990.1| succinyl-diaminopimelate desuccinylase [Ruegeria sp. TM1040]
 gi|123378559|sp|Q1GC88|DAPE1_SILST RecName: Full=Succinyl-diaminopimelate desuccinylase 1; Short=SDAP
           desuccinylase 1; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase 1
 gi|99039116|gb|ABF65728.1| succinyldiaminopimelate desuccinylase [Ruegeria sp. TM1040]
          Length = 381

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 165/385 (42%), Positives = 227/385 (58%), Gaps = 9/385 (2%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           T D ++    L++CPSVTP +GGA  +L   L   GFS    D        V NL+AR+G
Sbjct: 3   TTDPVQLTADLVRCPSVTPTEGGALVLLERLLTDAGFSCTRVD-----RGEVCNLFARWG 57

Query: 62  TEA--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            +A      F GH DVVP GD   WT+ PF A I EG +YGRG  DMK  +A F AA   
Sbjct: 58  DKAHARTFGFNGHTDVVPIGDEAAWTHDPFGAEIVEGVMYGRGTTDMKSGVAAFAAAAID 117

Query: 120 FIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           F+      G++ L ITGDEEG A++GT  +L +++  GEK   C+VGEPTC + +G+ IK
Sbjct: 118 FVQDTPPDGAVVLTITGDEEGDAVDGTTALLDYMDAAGEKMSVCLVGEPTCPNHMGEMIK 177

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGS++   T+ G QGH AYPH   NP+ GL  L+ +L +   D G+  F  + + I 
Sbjct: 178 IGRRGSMTAWFTVTGVQGHSAYPHRANNPMNGLARLMDRLGSHQLDEGSEHFDASTLAIV 237

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           TID GNP+ NVIPAQ + + NIRFNDL +  +L + ++    K  +            S 
Sbjct: 238 TIDTGNPATNVIPAQGRAAVNIRFNDLHSGASLTDWLQGEADKVAKEFGLEVDMKVQISG 297

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
               F+T    L+ L+S+++   T   P LST+GGTSDARF+K +CPV+EFGLVG+TMH 
Sbjct: 298 --ESFITPPGDLSDLVSRAVQTETNQAPELSTTGGTSDARFVKSHCPVVEFGLVGKTMHQ 355

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           ++EN  +  +  L  IY   L+++F
Sbjct: 356 VDENVDVAHIHQLKSIYSRILKDYF 380


>gi|269960641|ref|ZP_06175013.1| succinyl-diaminopimelate desuccinylase [Vibrio harveyi 1DA3]
 gi|269834718|gb|EEZ88805.1| succinyl-diaminopimelate desuccinylase [Vibrio harveyi 1DA3]
          Length = 378

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 155/388 (39%), Positives = 216/388 (55%), Gaps = 14/388 (3%)

Query: 1   MTPD-CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    L     LI   SVTP+D G   +++  LK LGF IE   F+        N +AR
Sbjct: 1   MTDSPVLALAKDLISRQSVTPEDAGCQEVMIERLKALGFEIEVMVFED-----TTNFWAR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GTEAP   FAGH DVVP G    W  PPF  TI +G ++GRG  DMKGS+AC + AV R
Sbjct: 56  RGTEAPLFAFAGHTDVVPAGKLEQWDTPPFEPTIIDGYLHGRGAADMKGSLACMVVAVER 115

Query: 120 FIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           FI +  +  GSI  LIT DEEGP INGT +++  + ++GE  D CIVGEP+   ++GD +
Sbjct: 116 FIAENPDHKGSIGFLITSDEEGPFINGTVRVVETLMERGENIDMCIVGEPSSTEVVGDVV 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGS++G++T+ G QGHVAYPHL  NP+   +  +H+L    +D GN  F PT+ +I
Sbjct: 176 KNGRRGSITGDLTVKGTQGHVAYPHLANNPVHQSLMAIHELATTEWDQGNDYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
             +  G  + NVIP +  + FN+RF+   + + + + I   L K   +     + + ++ 
Sbjct: 236 PNVSAGTGASNVIPGEFNVQFNLRFSTELSNEVIVQRITETLDKHELD-----YDLKWTF 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTM 357
              P        L   +  ++       P L T+GGTSD RFI      V+E G V  T+
Sbjct: 291 NGDPFLTD-TGALLDAVVAAVDEVNSTKPALLTTGGTSDGRFIARMGGQVVELGPVNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H +NE   + DLE LT +YEN L++   
Sbjct: 350 HKVNECVKVDDLEKLTDMYENTLKHLLA 377


>gi|27365262|ref|NP_760790.1| succinyl-diaminopimelate desuccinylase [Vibrio vulnificus CMCP6]
 gi|320155646|ref|YP_004188025.1| N-succinyl-L,L-diaminopimelate desuccinylase [Vibrio vulnificus
           MO6-24/O]
 gi|81448456|sp|Q8DBA6|DAPE_VIBVU RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|27361409|gb|AAO10317.1| succinyl-diaminopimelate desuccinylase [Vibrio vulnificus CMCP6]
 gi|319930958|gb|ADV85822.1| N-succinyl-L,L-diaminopimelate desuccinylase [Vibrio vulnificus
           MO6-24/O]
          Length = 377

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 152/388 (39%), Positives = 213/388 (54%), Gaps = 14/388 (3%)

Query: 1   MTPD-CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    L     LI   SVTP+D G   +++  L+ LGF+IE   F+        N +AR
Sbjct: 1   MTDSPVLALTKDLISRQSVTPEDAGCQDVMIARLEALGFTIERMVFED-----TTNFWAR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+AP   FAGH DVVP G   HW  PPF  T  EG +YGRG  DMKGS+A  I A  R
Sbjct: 56  RGTQAPLFAFAGHTDVVPAGKLEHWHTPPFEPTEKEGYLYGRGAADMKGSLAAMIVATER 115

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           FI ++  + GSI  LIT DEEGP INGT +++  +  + E  D CIVGEP+   ++GD +
Sbjct: 116 FIAEHPDHQGSIGFLITSDEEGPFINGTVRVVETLMARDENIDMCIVGEPSSTEVVGDVV 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGS++G++T+ G QGHVAYPHL +NP+   +  +H L    +D GN  F PT+ +I
Sbjct: 176 KNGRRGSITGDLTVKGTQGHVAYPHLADNPVHKSLLAIHALATTEWDKGNEYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
             +  G  + NVIP +  + FN+RF+     + + E +   L +   N     + + ++ 
Sbjct: 236 PNVQAGTGASNVIPGEFHVQFNLRFSTELCNERIVERVTQTLDQHDLN-----YDLKWTY 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTM 357
              P        L   +  ++ +     P L T+GGTSD RFI      V+E G V  T+
Sbjct: 291 NGDPFLTD-TGALLDAVVDAVDSVNQTKPALLTTGGTSDGRFIARMGGQVVELGPVNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H +NE   + DLE LT +Y+  L+N   
Sbjct: 350 HKVNECVKIDDLEKLTDMYQKTLENLLA 377


>gi|88658597|ref|YP_506972.1| succinyl-diaminopimelate desuccinylase [Ehrlichia chaffeensis str.
           Arkansas]
 gi|123493886|sp|Q2GHW1|DAPE_EHRCR RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|88600054|gb|ABD45523.1| succinyl-diaminopimelate desuccinylase [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 381

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 176/385 (45%), Positives = 230/385 (59%), Gaps = 9/385 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D +    +LI  PS+TP D GA   L NTL   GF+     F       V NLYA+ 
Sbjct: 1   MAIDPVILSQELISFPSITPTDNGAIDFLSNTLSQYGFTCNVLTFGNDEV-QVCNLYAQL 59

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   P+L FAGH DVVP GD   W + PFS  I +  +YGRG VDMK +I  FIAAV+R 
Sbjct: 60  GNGHPNLCFAGHTDVVPTGDLEKWKFDPFSGHIEDNILYGRGAVDMKSAICAFIAAVSR- 118

Query: 121 IPKYKNFGSISLLITGDEEGPAI-NGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           I   +  G+ISL+I+GDEEG     GT  +L W+    +K D C+VGEPT    +GDTIK
Sbjct: 119 IDFNQVNGAISLMISGDEEGNHFKYGTPAILKWLTDNNKKIDYCLVGEPTSKSSVGDTIK 178

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGS++ +I  +G QGHVAYPHL +NPI  +I +LH++ N   D GN  F P+N EIT
Sbjct: 179 IGRRGSINFKIVCNGVQGHVAYPHLAQNPINDMINILHKINNTVLDEGNEYFQPSNCEIT 238

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           ++DVGN + NVIP  V    NIR+N++   ++L   I +   +  Q      + +  S  
Sbjct: 239 SVDVGNTANNVIPGTVTAHLNIRYNNIHTSESLFNIINNICAETTQK-----YQIFTSLS 293

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
             P       K + +LS +I  TTG   ++STSGGTSDARFIKD+CPVIE GL   T H 
Sbjct: 294 GDPFINYP-DKYSDMLSAAIKKTTGETAVISTSGGTSDARFIKDFCPVIELGLKNDTAHK 352

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           +NEN S+ D+  L  IYE F++ +F
Sbjct: 353 INENTSVDDINKLANIYEEFIKQFF 377


>gi|296313502|ref|ZP_06863443.1| succinyl-diaminopimelate desuccinylase [Neisseria polysaccharea
           ATCC 43768]
 gi|296839965|gb|EFH23903.1| succinyl-diaminopimelate desuccinylase [Neisseria polysaccharea
           ATCC 43768]
          Length = 381

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 166/391 (42%), Positives = 222/391 (56%), Gaps = 14/391 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    LE    LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R
Sbjct: 1   MTETQSLELAKALISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGD-----TKNIWLR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+AP + FAGH DVVP G    W  PPF     +G++YGRG  DMK  IACF+ A  R
Sbjct: 56  RGTKAPVVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTGIACFVTACER 115

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ ++  + GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD I
Sbjct: 116 FVAEHPDHQGSIALLITSDEEGDALDGTTKVVDVLKARSELIDYCIVGEPTAVDKLGDMI 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I
Sbjct: 176 KNGRRGSLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S 
Sbjct: 236 SNINGGTGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDK-----HGVQYDLQWSC 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTM 357
              P FLT   KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+
Sbjct: 291 SGQP-FLTQAGKLTDVARAAIAETCGVETELSTTGGTSDGRFIKAIAKELIELGPSNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFITPS 388
           H +NEN  L D+  L+ +YE  L       +
Sbjct: 350 HQINENVRLDDIPKLSAVYEGILARLLAEKA 380


>gi|241759228|ref|ZP_04757334.1| succinyl-diaminopimelate desuccinylase [Neisseria flavescens SK114]
 gi|241320364|gb|EER56661.1| succinyl-diaminopimelate desuccinylase [Neisseria flavescens SK114]
          Length = 377

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 166/387 (42%), Positives = 224/387 (57%), Gaps = 14/387 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    LE   +LI  PSVTP D     +L   L+ +GF++EE  F        KN++ R
Sbjct: 1   MTETQSLELAKELISRPSVTPDDQNCQQLLAERLQKIGFAVEELHFGD-----TKNVWLR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            G +AP   FAGH DVVP G    W   PF  T  EG++YGRG  DMK SIACF+ A  R
Sbjct: 56  RGAQAPVFCFAGHTDVVPAGPVRKWDSSPFEPTEREGRLYGRGAADMKTSIACFVTACER 115

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F  +   + GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GD +
Sbjct: 116 FAAENPDHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVDKLGDML 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I
Sbjct: 176 KNGRRGSLSGNLTVKGKQGHIAYPHLAINPVHTFSPALLELTQEVWDEGNEYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP ++ + FN RF+    E+ LK+ + + L K       + + + +S 
Sbjct: 236 SNINGGTGATNVIPGELNVKFNFRFSTQSTEEGLKQRVHAILDK-----HGVQYDLQWSC 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTM 357
              P FLT   KLT +  ++I    G    LST+GGTSD RFIK     +IE G    T+
Sbjct: 291 SGQP-FLTQAGKLTDVAREAIAEICGVEAELSTTGGTSDGRFIKAIAKELIELGPSNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWF 384
           H +NEN  L D+  L+ +YE  L+   
Sbjct: 350 HQINENVRLDDIPKLSAVYEGMLKRLL 376


>gi|30248139|ref|NP_840209.1| succinyl-diaminopimelate desuccinylase [Nitrosomonas europaea ATCC
           19718]
 gi|81584893|sp|Q82XY4|DAPE_NITEU RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|30180024|emb|CAD84019.1| Peptidase family M20/M25/M40 [Nitrosomonas europaea ATCC 19718]
          Length = 376

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 158/387 (40%), Positives = 220/387 (56%), Gaps = 13/387 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   L     LI   S+TP D G   ++++ L  LGF  +   F       V+NL+ R 
Sbjct: 1   MSNSTLTLAQMLIARRSLTPDDDGCQKMIMHRLAGLGFKSDSMTFGE-----VENLWTRK 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G++AP + FAGH DVVP G    W   PF+  + +G +YGRG  DMK S+A F+ A+  F
Sbjct: 56  GSDAPLVCFAGHTDVVPTGPVTQWDSDPFTPVVRDGFLYGRGAADMKTSLAAFVTAIEEF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           I  + +  GSI+LLIT DEEGPA++GT K++  ++ +GE  D CIVGEPTC + +GDTIK
Sbjct: 116 IELHPDHKGSIALLITSDEEGPAVDGTVKVVEALQTRGEMIDYCIVGEPTCTNQLGDTIK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSLSG +T+ G QGH+AYPHL  NPI    P + +L    +D GN  F  T   I+
Sbjct: 176 NGRRGSLSGNLTVRGIQGHIAYPHLARNPIHTAAPAIAELAQTVWDNGNEYFPATTWHIS 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  + NVIP ++ + FN RF+      +LK  +   L +   +     + + +   
Sbjct: 236 NIHGGTGATNVIPGEINLLFNFRFSTASTVDSLKARVHEILDRHGLD-----YELIWELS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMH 358
             P +LT    L   +S +I   TG  P LST+GGTSD RFI D C  V+EFG    T+H
Sbjct: 291 GKP-YLTPRGTLADAVSAAIREVTGIEPELSTTGGTSDGRFIADICQQVVEFGPRNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            +NE+  + D+E L  IY   L+N  +
Sbjct: 350 KINESVEVADVERLARIYRLTLENLLL 376


>gi|68171518|ref|ZP_00544899.1| Proteobacterial succinyl-diaminopimelate desuccinylase [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|67999065|gb|EAM85735.1| Proteobacterial succinyl-diaminopimelate desuccinylase [Ehrlichia
           chaffeensis str. Sapulpa]
          Length = 381

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 175/385 (45%), Positives = 229/385 (59%), Gaps = 9/385 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D +    +LI  PS+TP D GA   L NTL   GF+     F       V NLYA+ 
Sbjct: 1   MAIDPVILSQELISFPSITPTDNGAIDFLSNTLSQYGFTCNVLTFGNDEV-QVCNLYAQL 59

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   P+L FAGH DVVP GD   W + PFS  I +  +YGRG VDMK +I  FIAAV+R 
Sbjct: 60  GNGHPNLCFAGHTDVVPTGDLEKWKFDPFSGHIEDNILYGRGAVDMKSAICAFIAAVSR- 118

Query: 121 IPKYKNFGSISLLITGDEEGPAI-NGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           I   +  G+ISL+I+GDEEG     GT  +L W+    +K D C+VGEPT    +GDTIK
Sbjct: 119 IDFNQVNGAISLMISGDEEGNHFKYGTPAILKWLTDNNKKIDYCLVGEPTSKSSVGDTIK 178

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGS++ +I  +G QGHVAYPHL +NPI  +I +LH++ N   D GN  F P+N EIT
Sbjct: 179 IGRRGSINFKIVCNGVQGHVAYPHLAQNPINDMINILHKINNTVLDEGNEYFQPSNCEIT 238

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           ++DVGN + NVIP  V    NIR+N++   ++L   I +   +  Q      + +     
Sbjct: 239 SVDVGNTANNVIPGTVTAHLNIRYNNIHTSESLFNIINNICAETTQK-----YQIFTLLS 293

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
             P       K + +LS +I  TTG   ++STSGGTSDARFIKD+CPVIE GL   T H 
Sbjct: 294 GDPFINYP-DKYSDMLSAAIKKTTGETAVISTSGGTSDARFIKDFCPVIELGLKNDTAHK 352

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           +NEN S+ D+  L  IYE F++ +F
Sbjct: 353 INENTSVDDINKLANIYEEFIKQFF 377


>gi|170726539|ref|YP_001760565.1| succinyl-diaminopimelate desuccinylase [Shewanella woodyi ATCC
           51908]
 gi|238055226|sp|B1KDS3|DAPE_SHEWM RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|169811886|gb|ACA86470.1| succinyl-diaminopimelate desuccinylase [Shewanella woodyi ATCC
           51908]
          Length = 376

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 158/386 (40%), Positives = 215/386 (55%), Gaps = 13/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+ + L     LI  PSVTP D G   ++   L   GF IE   F+        N++AR 
Sbjct: 1   MSQEVLTLAQDLISRPSVTPLDEGCQTLMAERLAAQGFEIESMVFED-----TTNMWARR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G E P   FAGH DVVP GD N W  PPF   + +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GKEGPLFCFAGHTDVVPVGDLNRWHTPPFDPVVIDGYLHGRGAADMKGSLAAMVVATERF 115

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + K+  + GSI+ LIT DEEGP INGT +++  +E + EK    +VGEP+  H +GD +K
Sbjct: 116 VEKHPDHNGSIAFLITSDEEGPFINGTTRVIDTLEARNEKITWSLVGEPSSTHKLGDIVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+G +TI+G QGHVAYPHL +NPI    P L +L  + +D GN  F PT+ +I 
Sbjct: 176 NGRRGSLTGNLTINGIQGHVAYPHLADNPIHKAAPALDELARMKWDNGNEFFPPTSFQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NVIP  +++ FN R++     + L + + + L     +   L + + +   
Sbjct: 236 NINGGTGASNVIPGALEVMFNFRYSTEVTAEILIQRVLNIL-----DAHGLDYDISWIFN 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT D  L     ++I   TG+     TSGGTSD RFI      VIE G V  T+H
Sbjct: 291 GLP-FLTGDGPLLDATREAIKQVTGSDTDPQTSGGTSDGRFIAPTGAHVIELGPVNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            +NE   + DLE LT  YE  L+   
Sbjct: 350 KVNECVKVSDLELLTQCYEVILEKLL 375


>gi|315179438|gb|ADT86352.1| succinyl-diaminopimelate desuccinylase [Vibrio furnissii NCTC
           11218]
          Length = 378

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 153/388 (39%), Positives = 216/388 (55%), Gaps = 14/388 (3%)

Query: 1   MTPD-CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    L     LI   SVTP D G   +++  L+ LGF IE   F+        N +AR
Sbjct: 1   MTDSPVLALAKDLISRQSVTPVDAGCQDLMIERLQALGFEIEMMVFED-----TTNFWAR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+AP   FAGH DVVP G    W  PPF  T+ +  ++GRG  DMKGS+AC + AV R
Sbjct: 56  RGTQAPLFAFAGHTDVVPAGPLTQWHTPPFEPTVIDDHLHGRGAADMKGSLACMVVAVER 115

Query: 120 FIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           FI +Y N  GSI+ LIT DEEGP INGT +++  +  + E  D C+VGEP+    +GD +
Sbjct: 116 FIAEYPNHTGSIAFLITSDEEGPFINGTTRVVDTLMARNEIIDMCVVGEPSSTRAVGDVV 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGS++G++T+ G QGHVAYPHL  NP+   +P L +L +  +D GN  F PT+ +I
Sbjct: 176 KNGRRGSITGDLTVKGVQGHVAYPHLANNPVHQALPALAELASTTWDEGNEYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
             +  G  + NVIP +  + FN RF+    ++ +K  + S L     +   L + + ++ 
Sbjct: 236 PNLQAGTGASNVIPGEFNVQFNFRFSTELTDEDIKRRVHSTL-----DAHGLEYDLKWTL 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTM 357
              P        L   + K++       P L T+GGTSD RFI      V+E G V  T+
Sbjct: 291 SGHPFLTD-TGALLDAVVKAVGEVNHQEPQLLTTGGTSDGRFIAQMGAQVVELGPVNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H +NE  ++ DLE LT +Y+  L+N  +
Sbjct: 350 HKVNECVNIADLEKLTDMYQKTLENLLV 377


>gi|296535608|ref|ZP_06897788.1| succinyl-diaminopimelate desuccinylase [Roseomonas cervicalis ATCC
           49957]
 gi|296264063|gb|EFH10508.1| succinyl-diaminopimelate desuccinylase [Roseomonas cervicalis ATCC
           49957]
          Length = 376

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 168/384 (43%), Positives = 226/384 (58%), Gaps = 10/384 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D L  L  LI+CPSVTP +GGA  +L   L+ LGF+     F       V+NL+AR G+ 
Sbjct: 2   DPLPLLQDLIRCPSVTPAEGGALGVLEAALRPLGFTCTRLVFGPPGQ-EVENLFARRGSG 60

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
           APHL FAGH DVVPPGD   W+  PF A + +G + GRG  DMKG IA ++AA+A     
Sbjct: 61  APHLCFAGHTDVVPPGDPALWSTDPFGAELRDGLVMGRGATDMKGGIAAWVAAIASLPAD 120

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               GS+SLLITGDEEGPA +GT K+L W+ + G   D C+VGEPT   ++GDTIKIGRR
Sbjct: 121 LP--GSLSLLITGDEEGPAEHGTVKVLEWMAEHGHTPDLCVVGEPTSKAVLGDTIKIGRR 178

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL+  IT+ G QGH AYP   +NP+  L+ +LH+LT    D+G+  F P+ +++T+ DV
Sbjct: 179 GSLNAAITVQGVQGHAAYPQRADNPVHRLVRVLHRLTAQPLDSGSEWFEPSTLQVTSFDV 238

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GNP+ NVIP   +   NIRFNDL +  +L   + + L           +T+  S      
Sbjct: 239 GNPATNVIPGTARAQLNIRFNDLHSSASLTAMLHAALRAEEAR-----YTLETSCSGESF 293

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
                    + L +++    G  P L T GGTSDARFI  +CPV E G VG TMH  +E 
Sbjct: 294 LTQP-GPFVAALRRAVAEAAGVEPRLDTGGGTSDARFITRHCPVAELGAVGATMHKADEC 352

Query: 364 ASLQDLEDLTCIYENFLQNWFITP 387
             +++L  L+ +Y   ++    TP
Sbjct: 353 TPVEELRALSRLYAAVIRQLL-TP 375


>gi|119774783|ref|YP_927523.1| succinyl-diaminopimelate desuccinylase [Shewanella amazonensis
           SB2B]
 gi|238055218|sp|A1S647|DAPE_SHEAM RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|119767283|gb|ABL99853.1| succinyldiaminopimelate desuccinylase [Shewanella amazonensis SB2B]
          Length = 382

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 156/384 (40%), Positives = 214/384 (55%), Gaps = 13/384 (3%)

Query: 3   PDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT 62
            D +E   +LI  PSVTP D G   ++   L  +GF+IE   F+        NL+AR GT
Sbjct: 8   SDVIELTRELISRPSVTPLDEGCQDLMAKRLAAIGFTIEPMVFED-----TTNLWARRGT 62

Query: 63  EAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIP 122
           E P   FAGH DVVP GD N W  PPF   + +G I+GRG  DMKGS+A  + A  RF+ 
Sbjct: 63  EGPVFCFAGHTDVVPVGDLNRWHTPPFDPVVIDGYIHGRGAADMKGSLAAMVVAAERFVA 122

Query: 123 KYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
           ++  + GSI+ LIT DEEGP INGT +++  +E + EK    +VGEP+  H++GD +K G
Sbjct: 123 EHPDHQGSIAFLITSDEEGPFINGTVRVVETLEARHEKITWALVGEPSSTHLLGDVVKNG 182

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSL+G +T+ G QGHVAYPHL +NPI    P L +L+ I +D GN  F PT+ +I  I
Sbjct: 183 RRGSLTGNLTVKGIQGHVAYPHLADNPIHRAAPALAELSRIEWDKGNEFFPPTSFQIANI 242

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
           + G  + NVIP ++K+ FN R++     +TL   +   L     +   L + + +     
Sbjct: 243 NGGTGASNVIPGELKVMFNFRYSTEVTAETLIARVLGIL-----DAHGLDYDIDWVFNGL 297

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHAL 360
           P        L     ++I+  TG      T+GGTSD RFI      VIE G V  T+H +
Sbjct: 298 PFLTGE-GPLLDATREAIFEVTGTHTDPQTTGGTSDGRFIAPTGAQVIELGPVNATIHKV 356

Query: 361 NENASLQDLEDLTCIYENFLQNWF 384
           NE     DLE LT  Y+  L+   
Sbjct: 357 NECVKASDLELLTGCYQRILEKLL 380


>gi|238055329|sp|Q7MIL6|DAPE_VIBVY RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 377

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 152/388 (39%), Positives = 213/388 (54%), Gaps = 14/388 (3%)

Query: 1   MTPD-CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    L     LI   SVTP+D G   +++  L+ LGF+IE   F+        N +AR
Sbjct: 1   MTDSPVLALTKDLISRQSVTPEDAGCQDVMIARLEALGFTIERMVFED-----TTNFWAR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+AP   FAGH DVVP G   HW  PPF  T  EG +YGRG  DMKGS+A  I A  R
Sbjct: 56  RGTQAPLFAFAGHTDVVPAGKLEHWHTPPFEPTEKEGYLYGRGAADMKGSLAAMIVATER 115

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           FI ++  + GSI  LIT DEEGP INGT +++  +  + E  D CIVGEP+   ++GD +
Sbjct: 116 FIAEHPDHQGSIGFLITSDEEGPFINGTVRVVETLMARDENIDMCIVGEPSSTEVVGDVV 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGS++G++T+ G QGHVAYPHL +NP+   +  +H L    +D GN  F PT+ +I
Sbjct: 176 KNGRRGSITGDLTVIGTQGHVAYPHLADNPVHKSLLAIHALATTEWDKGNEYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
             +  G  + NVIP +  + FN+RF+     + + E +   L +   N     + + ++ 
Sbjct: 236 PNVQAGTGASNVIPGEFHVQFNLRFSTELCNERIVERVTQTLDQHDLN-----YDLKWTY 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTM 357
              P        L   +  ++ +     P L T+GGTSD RFI      V+E G V  T+
Sbjct: 291 NGDPFLTD-TGALLDAVVDAVDSVNQTKPALLTTGGTSDGRFIARMGGQVVELGPVNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H +NE   + DLE LT +Y+  L+N   
Sbjct: 350 HKVNECVKIDDLEKLTDMYQKTLENLLA 377


>gi|237732457|ref|ZP_04562938.1| succinyl-diaminopimelate desuccinylase [Citrobacter sp. 30_2]
 gi|226907996|gb|EEH93914.1| succinyl-diaminopimelate desuccinylase [Citrobacter sp. 30_2]
          Length = 375

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 151/385 (39%), Positives = 220/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRAVGFTVERMDFGDTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GKGE-TLAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++  + G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   I+GD +K
Sbjct: 115 VAQHPNHQGRLAFLITSDEEASAKNGTVKVVEALMARNERLDYCLVGEPSSTEIVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P+L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K  + + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFIQFNFRFSTELTDEMIKARVHALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTERGKLVDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|52424729|ref|YP_087866.1| succinyl-diaminopimelate desuccinylase [Mannheimia
           succiniciproducens MBEL55E]
 gi|81387390|sp|Q65US9|DAPE_MANSM RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|52306781|gb|AAU37281.1| ArgE protein [Mannheimia succiniciproducens MBEL55E]
          Length = 377

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 154/386 (39%), Positives = 218/386 (56%), Gaps = 13/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +     LI+ PS++P D G   ++   L  LGF+IE   F     +   NL+A+ 
Sbjct: 1   MKNTIINLAQDLIRRPSISPDDQGCQQVIAERLTKLGFNIEWMSF-----NDTINLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT +P + FAGH DVVP GD N W YPPFSA I +  +YGRG  DMKGS+A  I A   +
Sbjct: 56  GTTSPVVAFAGHTDVVPTGDENQWNYPPFSAQIVDDMLYGRGAADMKGSLAAMIVAAEEY 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G+I+LLIT DEE  A +GT K++  +  +GE  D C+VGEP+    +GD +K
Sbjct: 116 VKANPNHAGTIALLITSDEEAAAKDGTVKVVESLMARGENIDYCLVGEPSSAKQLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++G++ I G QGHVAYPHL ENP+      L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITGDLYIQGIQGHVAYPHLAENPVHKATKFLTELTTYEWDNGNEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN+R+     ++ +K ++   L K       L++ + ++  
Sbjct: 236 NIHAGTGSNNVIPGELYVQFNLRYCTEVTDEFIKNKVAEMLQK-----HDLTYRIDWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P FLT   KL + + +S+ +  G  P L T GGTSD RFI      V+E G +  T+H
Sbjct: 291 GKP-FLTKPGKLLNAVVESLESVAGIKPKLDTGGGTSDGRFIALMGAEVVELGPLNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            +NE  S +DL  L  +Y   L N  
Sbjct: 350 KVNECVSCRDLATLGEVYRQMLVNLL 375


>gi|88798114|ref|ZP_01113701.1| succinyl-diaminopimelate desuccinylase [Reinekea sp. MED297]
 gi|88779311|gb|EAR10499.1| succinyl-diaminopimelate desuccinylase [Reinekea sp. MED297]
          Length = 378

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 152/387 (39%), Positives = 212/387 (54%), Gaps = 13/387 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  + L     LIK PSVTP D G   ++ + LK  GF IE    +      V NL+A  
Sbjct: 1   MRSETLTLACDLIKRPSVTPDDQGCQTLMADRLKACGFQIEAMRIED-----VDNLWAVH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G E P L+FAGH DVVP GD + WTYPPF  T  +G +YGRG  DMKGS+A  I A  RF
Sbjct: 56  GQEGPLLVFAGHTDVVPTGDSSAWTYPPFEPTEQDGMLYGRGAADMKGSLAAMIVATERF 115

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  Y  + G +  LIT DEEG A +GT  ++  +  +GE+ D  +VGEP+    +GD IK
Sbjct: 116 VRDYPDHQGRLGYLITSDEEGDAYHGTVAVMERLTARGERIDWAVVGEPSSTDQVGDVIK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS+ G +TI GKQGHVAYPHL +NP+  + P +  L+   +D GN  F  T+ +++
Sbjct: 176 NGRRGSMLGYLTIKGKQGHVAYPHLAKNPVHLVAPAIADLSTEVWDEGNDFFPATSFQVS 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NVIP   ++ F+ RF+     + L++  R+ L     +     + + F   
Sbjct: 236 NINSGTGASNVIPGTAEIMFSFRFSTEVTAEELQQRARTIL-----DRHGFDYELRFEVK 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P        L     +++   TG  P LST+GGTSD RFI      V+E G V RT+H
Sbjct: 291 GQPFLTD-RGALVQAAVQAVTEVTGQAPELSTAGGTSDGRFIAPTGAQVVELGPVNRTIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            ++E  +  DL+ LT +Y   + N   
Sbjct: 350 QIDECVASADLDTLTEMYYGIMVNLLA 376


>gi|333001604|gb|EGK21172.1| succinyl-diaminopimelate desuccinylase [Shigella flexneri VA-6]
          Length = 375

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 152/385 (39%), Positives = 221/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDFADTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIIEQL 373


>gi|153834127|ref|ZP_01986794.1| succinyl-diaminopimelate desuccinylase [Vibrio harveyi HY01]
 gi|148869497|gb|EDL68495.1| succinyl-diaminopimelate desuccinylase [Vibrio harveyi HY01]
          Length = 378

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 154/388 (39%), Positives = 215/388 (55%), Gaps = 14/388 (3%)

Query: 1   MTPD-CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    L     LI   SVTP+D G   +++  LK LGF IE   F+        N +AR
Sbjct: 1   MTDSPVLALAKDLISRQSVTPEDAGCQDVMIERLKALGFEIEVMVFED-----TTNFWAR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GTEAP   FAGH DVVP G    W   PF  TI +G ++GRG  DMKGS+AC + AV R
Sbjct: 56  RGTEAPLFAFAGHTDVVPAGKLEQWDTHPFEPTIIDGYLHGRGAADMKGSLACMVVAVER 115

Query: 120 FIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           FI +  +  GSI  LIT DEEGP INGT +++  + ++GE  D CIVGEP+   ++GD +
Sbjct: 116 FIAENPDHKGSIGFLITSDEEGPFINGTVRVVETLMERGENIDMCIVGEPSSTEVVGDVV 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGS++G++T+ G QGHVAYPHL  NP+   +  +H+L    +D GN  F PT+ +I
Sbjct: 176 KNGRRGSITGDLTVKGTQGHVAYPHLANNPVHQSLMAIHELATTEWDQGNDYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
             +  G  + NVIP +  + FN+RF+   + + + + I   L K   +     + + ++ 
Sbjct: 236 PNVSAGTGASNVIPGEFNVQFNLRFSTELSNEVIVQRITETLDKHDLD-----YDLKWTF 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTM 357
              P        L   +  ++       P L T+GGTSD RFI      V+E G V  T+
Sbjct: 291 NGDPFLTD-TGALLDAVVAAVDEVNSTKPALLTTGGTSDGRFIARMGGQVVELGPVNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H +NE   + DLE LT +YEN L++   
Sbjct: 350 HKVNECVKVDDLEKLTDMYENTLKHLLA 377


>gi|167624234|ref|YP_001674528.1| succinyl-diaminopimelate desuccinylase [Shewanella halifaxensis
           HAW-EB4]
 gi|238055219|sp|B0TVI4|DAPE_SHEHH RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|167354256|gb|ABZ76869.1| succinyl-diaminopimelate desuccinylase [Shewanella halifaxensis
           HAW-EB4]
          Length = 381

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 157/382 (41%), Positives = 212/382 (55%), Gaps = 13/382 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L     LI   SVTP D G   ++ + L   GF+IE   F+        N++AR GT++
Sbjct: 9   VLSLAKDLISRQSVTPLDEGCQQLMADRLADAGFNIESMVFED-----TTNMWARRGTQS 63

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P   FAGH DVVP GD N W  PPF   + +  ++GRG  DMKGS+A  + A  RFI K+
Sbjct: 64  PVFCFAGHTDVVPVGDLNRWHTPPFEPVVIDDYLHGRGAADMKGSLAAMLVATERFIKKF 123

Query: 125 K-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
             + GSI+ LIT DEEGP INGT +++  +E + EK    +VGEP+  H +GD +K GRR
Sbjct: 124 PDHQGSIAFLITSDEEGPFINGTTRVIDTLEARNEKITWSLVGEPSSTHKLGDIVKNGRR 183

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL+G +T+ G QGHVAYPHL +NPI    P L +L  + +D GN  F PT+ +I  I+ 
Sbjct: 184 GSLTGNLTVKGVQGHVAYPHLADNPIHKAAPALDELARMKWDNGNEFFPPTSFQIANING 243

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NVIP  +++ FN R++     + L E + + L     +   L + + +     P 
Sbjct: 244 GTGASNVIPGALEVMFNFRYSTEVTAEILIERVLNIL-----DAHGLEYDIDWVFNGLP- 297

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
           FLT D  L      +I   TG      TSGGTSD RFI      VIE G V  T+H +NE
Sbjct: 298 FLTGDGPLLEATKAAIKKVTGTNTDPQTSGGTSDGRFIAPTGAQVIELGPVNATIHKVNE 357

Query: 363 NASLQDLEDLTCIYENFLQNWF 384
              + DLE LT  YE  L+N  
Sbjct: 358 CVKVSDLELLTDCYEAILENLL 379


>gi|114569000|ref|YP_755680.1| succinyl-diaminopimelate desuccinylase [Maricaulis maris MCS10]
 gi|122316776|sp|Q0ASJ5|DAPE_MARMM RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|114339462|gb|ABI64742.1| succinyldiaminopimelate desuccinylase [Maricaulis maris MCS10]
          Length = 390

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 180/381 (47%), Positives = 233/381 (61%), Gaps = 7/381 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           + L     LI+ PSVTP D GA  ++   L+ LGF+     F       V NLYAR GT 
Sbjct: 12  NPLPLAQALIRRPSVTPIDAGALDVMQAALEQLGFTCRRYPFGE-----VDNLYARRGTA 66

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
           +P  +FAGH DVVPPGD + W  PPF A   +G ++GRG  DMKG+IA  +A+V RF+  
Sbjct: 67  SPCFLFAGHTDVVPPGDDDAWRKPPFGAEAEDGVLWGRGAADMKGAIAAMVASVQRFLDT 126

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
            +  GSI+ LITGDEEGPAI+GTK +L  +  +GE +D C+VGEPT  +++GDTIK GRR
Sbjct: 127 GEPKGSIAFLITGDEEGPAIHGTKAVLEALADEGETFDHCLVGEPTNPNVLGDTIKSGRR 186

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL+  +T+ G+QGHVAYP   ENPI  L+ LL +L     D G   F P+N+E+T++DV
Sbjct: 187 GSLNCTLTVTGRQGHVAYPERAENPIPALLDLLGRLLARKLDDGVPPFQPSNLEVTSVDV 246

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GNP+ NVIPA     FNIRFN   N   L + IRS + K   +           +     
Sbjct: 247 GNPTTNVIPAAATARFNIRFNIAHNGDALSDWIRSEVAKIDLDFDGRIEADIHVTG--EA 304

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           FLT     T+LL   +   TG  P L+T GGTSDARFI+ Y PV EFGLVG TMH ++E 
Sbjct: 305 FLTPAGPFTTLLQDCVEAETGRRPALTTGGGTSDARFIQLYAPVAEFGLVGATMHQVDER 364

Query: 364 ASLQDLEDLTCIYENFLQNWF 384
             + D+E LT IY   L+ +F
Sbjct: 365 VPVSDIETLTAIYTRILKGYF 385


>gi|254262184|emb|CAZ90512.1| Succinyl-diaminopimelate desuccinylase dapE [Enterobacter
           turicensis]
          Length = 392

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 153/385 (39%), Positives = 220/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF         N +A  
Sbjct: 18  MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLRAIGFTVEPMDFGDTQ-----NFWAWR 72

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVPPGD N W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 73  GQGE-TLAFAGHTDVVPPGDANRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 131

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+ + ++GD +K
Sbjct: 132 VAQHPNHKGRLAFLITSDEEASAQNGTVKVVEALMARNERLDYCLVGEPSSSEVVGDVVK 191

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P+L +L NI +D GN  F  T+M+I 
Sbjct: 192 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMLDELVNIEWDEGNAFFPATSMQIA 251

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP  + + FN RF+    +  +K  + + L K      +L +T+ +   
Sbjct: 252 NIQAGTGSNNVIPGDLHVQFNFRFSTELTDAAIKARVEALLQK-----HQLRYTLDWWLS 306

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 307 GQP-FLTARGKLVDAVVNAVAHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 365

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 366 KINECVNAADLQLLARMYQRIMEQL 390


>gi|260767730|ref|ZP_05876665.1| N-succinyl-L,L-diaminopimelate desuccinylase [Vibrio furnissii CIP
           102972]
 gi|260617239|gb|EEX42423.1| N-succinyl-L,L-diaminopimelate desuccinylase [Vibrio furnissii CIP
           102972]
          Length = 378

 Score =  247 bits (630), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 153/388 (39%), Positives = 216/388 (55%), Gaps = 14/388 (3%)

Query: 1   MTPD-CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    L     LI   SVTP D G   +++  L+ LGF IE   F+        N +AR
Sbjct: 1   MTDSPVLALAKDLISRQSVTPVDAGCQDLMIERLQALGFEIEMMVFED-----TTNFWAR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+AP   FAGH DVVP G    W  PPF  T+ +  ++GRG  DMKGS+AC + AV R
Sbjct: 56  RGTQAPLFAFAGHTDVVPAGPLTQWHTPPFEPTVIDDHLHGRGAADMKGSLACMVVAVER 115

Query: 120 FIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           FI +Y N  GSI+ LIT DEEGP INGT +++  +  + E  D C+VGEP+    +GD +
Sbjct: 116 FIAEYPNHTGSIAFLITSDEEGPFINGTTRVVDTLMARNEIIDMCVVGEPSSTRAVGDVV 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGS++G++T+ G QGHVAYPHL  NP+   +P L +L +  +D GN  F PT+ +I
Sbjct: 176 KNGRRGSITGDLTVKGVQGHVAYPHLANNPVHQALPALAELASTTWDEGNEYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
             +  G  + NVIP +  + FN RF+    ++ +K  + S L     +   L + + ++ 
Sbjct: 236 PNLQAGTGASNVIPGEFHVQFNFRFSTELTDEDIKRRVHSTL-----DAHGLEYDLKWTL 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTM 357
              P        L   + K++       P L T+GGTSD RFI      V+E G V  T+
Sbjct: 291 SGHPFLTD-TGALLDAVVKAVGEVNHQEPQLLTTGGTSDGRFIAQMGAQVVELGPVNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H +NE  ++ DLE LT +Y+  L+N  +
Sbjct: 350 HKVNECVNIADLEKLTDMYQKTLENLLV 377


>gi|319410760|emb|CBY91144.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis WUE
           2594]
          Length = 398

 Score =  247 bits (630), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 166/385 (43%), Positives = 222/385 (57%), Gaps = 13/385 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE    LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R GT+ P
Sbjct: 24  LELAKALISRPSVTPDDQNCQKLLAERLHKIGFAAEELHFGD-----TKNIWLRRGTKVP 78

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK SIACF+ A  RF+ ++ 
Sbjct: 79  VVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTSIACFVTACERFVAEHP 138

Query: 126 -NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
            + GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GD IK GRRG
Sbjct: 139 DHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVDKLGDMIKNGRRG 198

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 199 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 258

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
             + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S    P F
Sbjct: 259 TGATNVIPGELSVKFNFRFSTESTEAGLKQRVHAILDK-----HGVQYDLQWSCSGQP-F 312

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNEN 363
           LTH  KLT +   +I    G    LST+GGTSD RFIK     +IE G    T+H +NEN
Sbjct: 313 LTHAGKLTDVARAAIAEICGVETELSTTGGTSDGRFIKAITKELIELGPSNATIHQINEN 372

Query: 364 ASLQDLEDLTCIYENFLQNWFITPS 388
             L D+  L+ +YE  L       +
Sbjct: 373 VRLNDIPKLSAVYEGILARLLAGNA 397


>gi|110833998|ref|YP_692857.1| succinyl-diaminopimelate desuccinylase [Alcanivorax borkumensis
           SK2]
 gi|123050550|sp|Q0VQG3|DAPE_ALCBS RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|110647109|emb|CAL16585.1| succinyl-diaminopimelate desuccinylase [Alcanivorax borkumensis
           SK2]
          Length = 377

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 151/384 (39%), Positives = 219/384 (57%), Gaps = 13/384 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L++  +LI+  SVTP+D G    ++  L++LGF  E   F+      V+NL+AR GT+ 
Sbjct: 4   TLDYTKELIRRASVTPEDQGCQAWIIEKLEVLGFKCETLWFEE-----VRNLWARRGTQG 58

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P   FAGH DVVP GD   W Y PF+ T     +YGRG  DMKGSIA  I A+  FI  +
Sbjct: 59  PVFAFAGHTDVVPTGDVTAWKYDPFTPTEEGDLLYGRGAADMKGSIAAMIVAMEDFIAAH 118

Query: 125 K-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
             + GS++ LIT DEEGP++NGT K++  ++ + E  D C+VGEP+  + +GD IK GRR
Sbjct: 119 PDHNGSLAFLITADEEGPSVNGTVKVVEHLQARQEHIDYCLVGEPSSTNTVGDVIKNGRR 178

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL  ++T+ G QGHVAYPHL  NPI  + P L +L+   +D GN  F  T+ +I+ I+ 
Sbjct: 179 GSLGAKLTVKGIQGHVAYPHLARNPIHDVAPALAELSATEWDQGNDFFPATSFQISNING 238

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NVIP   ++ FN RF+    +  L+E + + L K   +     + + ++    P 
Sbjct: 239 GTGATNVIPGTCEIIFNFRFSTELTDAILRERVEAILDKHGLD-----YDLQWTLSGQPF 293

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
                  L      +I + T     LST+GGTSD RFI      V+E G    T+H ++E
Sbjct: 294 LTD-RGALVDAAVGAIRDVTELDTELSTAGGTSDGRFIAPTGTQVVELGPTNATIHKVDE 352

Query: 363 NASLQDLEDLTCIYENFLQNWFIT 386
           + S+ +L+ LT IY+  LQ+   T
Sbjct: 353 HTSISELDTLTQIYQRLLQHLMTT 376


>gi|325204507|gb|ADY99960.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           M01-240355]
          Length = 381

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 166/391 (42%), Positives = 223/391 (57%), Gaps = 14/391 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    LE   +LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R
Sbjct: 1   MTETQSLELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGD-----TKNIWLR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+AP + FAGH DVVP G    W  PPF     +G++YGRG  DMK SIACF+ A  R
Sbjct: 56  RGTKAPVVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACER 115

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ ++  + GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD I
Sbjct: 116 FVAEHPDHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMI 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I
Sbjct: 176 KNGRRGSLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S 
Sbjct: 236 SNINGGTGATNVIPGELSVKFNFRFSTESTEAGLKQRVHAILDK-----HGVQYDLQWSC 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTM 357
              P FLT   KLT +   +I    G    LST+GGTSD RFIK     +IE G    T+
Sbjct: 291 SGQP-FLTQAGKLTDVARAAIAEICGIEAELSTTGGTSDGRFIKAIAKELIELGPSNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFITPS 388
           H +NEN  L D+  L+ +YE  L       +
Sbjct: 350 HQINENVRLDDIPKLSAVYEGILACLLAGNA 380


>gi|156975452|ref|YP_001446359.1| succinyl-diaminopimelate desuccinylase [Vibrio harveyi ATCC
           BAA-1116]
 gi|238055241|sp|A7MY37|DAPE_VIBHB RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|156527046|gb|ABU72132.1| hypothetical protein VIBHAR_03183 [Vibrio harveyi ATCC BAA-1116]
          Length = 378

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 154/388 (39%), Positives = 214/388 (55%), Gaps = 14/388 (3%)

Query: 1   MTPD-CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    L     LI   SVTP+D G   +++  LK LGF IE   F+        N +AR
Sbjct: 1   MTDSPVLALAKDLISRQSVTPEDAGCQDVMIERLKALGFEIEVMVFED-----TTNFWAR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GTEAP   FAGH DVVP G    W   PF  TI +G ++GRG  DMKGS+AC + AV R
Sbjct: 56  RGTEAPLFAFAGHTDVVPAGKLEQWDTHPFEPTIIDGYLHGRGAADMKGSLACMVVAVER 115

Query: 120 FIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           FI +  +  GSI  LIT DEEGP INGT +++  +  +GE  D CIVGEP+   ++GD +
Sbjct: 116 FIAENPDHKGSIGFLITSDEEGPFINGTVRVVETLMDRGENIDMCIVGEPSSTEVVGDVV 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGS++G++T+ G QGHVAYPHL  NP+   +  +H+L    +D GN  F PT+ +I
Sbjct: 176 KNGRRGSITGDLTVKGTQGHVAYPHLANNPVHQSLMAIHELATTEWDQGNDYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
             +  G  + NVIP +  + FN+RF+   + + + + I   L K   +     + + ++ 
Sbjct: 236 PNVSAGTGASNVIPGEFNVQFNLRFSTELSNEVIVQRITETLDKHELD-----YDLKWTF 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTM 357
              P        L   +  ++       P L T+GGTSD RFI      V+E G V  T+
Sbjct: 291 NGDPFLTD-TGALLDAVVAAVDEVNSTKPALLTTGGTSDGRFIARMGGQVVELGPVNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H +NE   + DLE LT +YEN L++   
Sbjct: 350 HKVNECVKVDDLEKLTDMYENTLKHLLA 377


>gi|332288791|ref|YP_004419643.1| succinyl-diaminopimelate desuccinylase [Gallibacterium anatis
           UMN179]
 gi|330431687|gb|AEC16746.1| succinyl-diaminopimelate desuccinylase [Gallibacterium anatis
           UMN179]
          Length = 377

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 146/386 (37%), Positives = 212/386 (54%), Gaps = 13/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +     LI+ PS++P+D G   ++ + L  LGF+IE   F         NL+A  
Sbjct: 1   MKQQVITLAQDLIRRPSISPKDEGCQQVIADRLSKLGFNIEWMPFGD-----TLNLWATH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G  AP ++FAGH DVVP GD   W YPPFSA I    +YGRG  DMKGS+A  + A  +F
Sbjct: 56  GDSAPTIVFAGHTDVVPTGDEKQWQYPPFSAEIVGDLLYGRGAADMKGSLASMVVAAEQF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++    G I+ LIT DEE  A +GT K++  +  +GE+ D C+VGEP+    +GD +K
Sbjct: 116 VSQHPQHKGRIAFLITSDEEAAAKDGTVKVVQALMARGEQVDYCLVGEPSSTAKLGDIVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++G + I G QGHVAYPHL +NPI      +  L  I +D GN  F PT+++I 
Sbjct: 176 NGRRGSITGNLYIQGVQGHVAYPHLADNPIHKAAGFIQDLVKIKWDNGNDFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN+RFN   +++ +K+ + + L +   +     + + +   
Sbjct: 236 NIHAGTGSNNVIPGELYLQFNLRFNTETSDEKIKQRVENLLKQHQLD-----YRIEWWLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P FLT   KL   +  ++       P L TSGGTSD RFI      V+E G + +T+H
Sbjct: 291 GQP-FLTAKGKLVDAVVHALQKVAAITPTLETSGGTSDGRFIALMGAEVVELGPLNKTIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E  S +DL  L   +   L    
Sbjct: 350 RIDECVSCEDLAKLAVTHLEILNTLL 375


>gi|269138462|ref|YP_003295162.1| succinyl-diaminopimelate desuccinylase [Edwardsiella tarda EIB202]
 gi|267984122|gb|ACY83951.1| succinyl-diaminopimelate desuccinylase [Edwardsiella tarda EIB202]
 gi|304558488|gb|ADM41152.1| N-succinyl-L,L-diaminopimelate desuccinylase [Edwardsiella tarda
           FL6-60]
          Length = 377

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 150/381 (39%), Positives = 224/381 (58%), Gaps = 13/381 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L    QLI+CPS++P D G   IL+  L+ L F IEE            NL+A  G + 
Sbjct: 6   VLTLAQQLIRCPSISPNDAGCQDILLARLRALDFHIEEMPHGDTR-----NLWAWRGGDG 60

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P L FAGH DVVPPGD   W +PPF+ T+ +G +YGRG  DMKGS+A  + A  RF+   
Sbjct: 61  PVLAFAGHTDVVPPGDERQWRHPPFTPTLQDGMLYGRGAADMKGSLAAMVVAAERFVSAR 120

Query: 125 K-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
             + G ++ LIT DEE  A+NGT +++  +  +GE+ D C+VGEP+    +GD +K GRR
Sbjct: 121 PDHRGRLAFLITSDEEASAVNGTVRVVETLMARGERLDYCLVGEPSSEQRLGDVVKNGRR 180

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++ ++T+HG QGHVAYPHL +NP+    P+L +L  I +D GN  F PT+++I  I  
Sbjct: 181 GSITADLTVHGTQGHVAYPHLADNPVHRAAPMLAELVAIAWDNGNDFFPPTSLQIANIAA 240

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  S NVIP  + + FN+RF+   + +++++ + + L     +   L +T+++S    P 
Sbjct: 241 GTGSNNVIPGDMYVQFNLRFSTESSVESIQQRVTALL-----DRHGLRYTLNWSLSGLP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
           FLT   +L   +  ++    G  P L T+GGTSD RFI      V+E G +  T+H +NE
Sbjct: 295 FLTPGGELVDAVVNAVACYGGQTPRLLTTGGTSDGRFIARMGAQVVELGPLNATIHKVNE 354

Query: 363 NASLQDLEDLTCIYENFLQNW 383
             S  DL+ L+ +Y+  ++  
Sbjct: 355 CVSAADLQSLSRMYQRIMEQL 375


>gi|253998642|ref|YP_003050705.1| succinyl-diaminopimelate desuccinylase [Methylovorus sp. SIP3-4]
 gi|253985321|gb|ACT50178.1| succinyl-diaminopimelate desuccinylase [Methylovorus sp. SIP3-4]
          Length = 375

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 159/382 (41%), Positives = 223/382 (58%), Gaps = 13/382 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L+    LI   SVTP D G   +L++ L+ LGF IE   F       V N +AR GT +
Sbjct: 4   TLDLAQDLIARRSVTPDDLGCQELLISRLEPLGFKIERMRFGD-----VDNFFARRGTAS 58

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P L+FAGH DVVP G  + W  PPF  TI +G +YGRG  DMK S+A FI ++  F+ ++
Sbjct: 59  PLLVFAGHTDVVPTGPVDQWHTPPFEPTIKDGMLYGRGAADMKTSLAAFITSIEEFVAEH 118

Query: 125 K-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
             + GSI LLIT DEEG A +GT K++  ++ +GE  D CIVGEPT + ++GD IK GRR
Sbjct: 119 PDHQGSIGLLITSDEEGIATHGTVKVVEALKARGELIDYCIVGEPTSSKVVGDMIKNGRR 178

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSLSG++ + G QGH+AYPHL +NPI  + P + +L +  +D+GN  F PT+ +I+ ++ 
Sbjct: 179 GSLSGKLVVKGVQGHIAYPHLVKNPIHLVAPAIKELADTVWDSGNEYFPPTSWQISNMNG 238

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NV+P +V + FN RF+     + L+E + + L K         + + +     P 
Sbjct: 239 GTGATNVVPGEVTILFNFRFSTASTAEGLRERVHAILDKHALE-----YDLQWELSGKP- 292

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLT    L   +S +I    G  P LSTSGGTSD RFI D    V+EFG +  T+H LNE
Sbjct: 293 FLTPKGTLVEAISAAIETAFGVTPELSTSGGTSDGRFIADIASQVVEFGPLNATIHKLNE 352

Query: 363 NASLQDLEDLTCIYENFLQNWF 384
              + D+E L   Y   ++   
Sbjct: 353 CVGVADIEPLKDAYRLTMETLL 374


>gi|313668084|ref|YP_004048368.1| succinyl-diaminopimelate desuccinylase [Neisseria lactamica ST-640]
 gi|313005546|emb|CBN86982.1| succinyl-diaminopimelate desuccinylase [Neisseria lactamica 020-06]
          Length = 398

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 166/391 (42%), Positives = 223/391 (57%), Gaps = 14/391 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    LE    LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R
Sbjct: 18  MTETQSLELAKALISRPSVTPDDQNCQKLLAERLHKIGFAAEELHFGD-----TKNIWLR 72

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+AP + FAGH DVVP G    W  PPF     +G++YGRG  DMK  IACF+ A  R
Sbjct: 73  RGTKAPVVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTGIACFVTACER 132

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ ++  + GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD I
Sbjct: 133 FVAEHPDHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMI 192

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG++T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I
Sbjct: 193 KNGRRGSLSGKLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQI 252

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S 
Sbjct: 253 SNINGGTGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDK-----HGVQYDLQWSC 307

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTM 357
              P FLT   KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+
Sbjct: 308 SGQP-FLTQAGKLTDVARAAIAETCGIEAELSTTGGTSDGRFIKAIAKELIELGPSNATI 366

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFITPS 388
           H +NEN  L D+  L+ +YE  L       +
Sbjct: 367 HQINENVRLNDIPKLSAVYEGILARLLAEKA 397


>gi|146312608|ref|YP_001177682.1| succinyl-diaminopimelate desuccinylase [Enterobacter sp. 638]
 gi|238064784|sp|A4WD51|DAPE_ENT38 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|145319484|gb|ABP61631.1| succinyldiaminopimelate desuccinylase [Enterobacter sp. 638]
          Length = 375

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 149/385 (38%), Positives = 221/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRAIGFTVERMDFGDTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVPAGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNFGS-ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  + ++ LIT DEE  A NGT +++  + ++ E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHKNRLAFLITSDEEASAKNGTVRVVETLMERHERLDYCLVGEPSSTEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P+L++L NI +D GN  F PT+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMLNELVNIEWDKGNEFFPPTSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            +  G  S NVIP    + FN RF+    ++ +K  + + L K      +L ++V +   
Sbjct: 235 NLQAGTGSNNVIPGDFSVQFNFRFSTELTDEMIKSRVVALLEK-----YELRYSVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTQRGKLVDAVVNAIAHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|82777849|ref|YP_404198.1| succinyl-diaminopimelate desuccinylase [Shigella dysenteriae Sd197]
 gi|309784800|ref|ZP_07679433.1| succinyl-diaminopimelate desuccinylase [Shigella dysenteriae 1617]
 gi|123561955|sp|Q32D98|DAPE_SHIDS RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|81241997|gb|ABB62707.1| N-succinyl-diaminopimelate deacylase [Shigella dysenteriae Sd197]
 gi|308927170|gb|EFP72644.1| succinyl-diaminopimelate desuccinylase [Shigella dysenteriae 1617]
          Length = 375

 Score =  247 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 150/385 (38%), Positives = 219/385 (56%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDFADTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D  N  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQSNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NV P ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVTPGELFVQFNFRFSTELTDEMIKAQVLALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|218705970|ref|YP_002413489.1| succinyl-diaminopimelate desuccinylase [Escherichia coli UMN026]
 gi|293405907|ref|ZP_06649899.1| succinyl-diaminopimelate desuccinylase [Escherichia coli FVEC1412]
 gi|298381655|ref|ZP_06991254.1| succinyl-diaminopimelate desuccinylase [Escherichia coli FVEC1302]
 gi|300897653|ref|ZP_07116055.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 198-1]
 gi|301024672|ref|ZP_07188318.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 69-1]
 gi|331664028|ref|ZP_08364938.1| succinyl-diaminopimelate desuccinylase [Escherichia coli TA143]
 gi|331673929|ref|ZP_08374692.1| succinyl-diaminopimelate desuccinylase [Escherichia coli TA280]
 gi|238064744|sp|B7N653|DAPE_ECOLU RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|218433067|emb|CAR13962.1| N-succinyl-diaminopimelate deacylase [Escherichia coli UMN026]
 gi|291428115|gb|EFF01142.1| succinyl-diaminopimelate desuccinylase [Escherichia coli FVEC1412]
 gi|298279097|gb|EFI20611.1| succinyl-diaminopimelate desuccinylase [Escherichia coli FVEC1302]
 gi|300358602|gb|EFJ74472.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 198-1]
 gi|300396453|gb|EFJ79991.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 69-1]
 gi|331059827|gb|EGI31804.1| succinyl-diaminopimelate desuccinylase [Escherichia coli TA143]
 gi|331069202|gb|EGI40594.1| succinyl-diaminopimelate desuccinylase [Escherichia coli TA280]
          Length = 375

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 152/385 (39%), Positives = 221/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDFADTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHAGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEK-----HQLRYTVEWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|254468430|ref|ZP_05081836.1| succinyl-diaminopimelate desuccinylase [beta proteobacterium KB13]
 gi|207087240|gb|EDZ64523.1| succinyl-diaminopimelate desuccinylase [beta proteobacterium KB13]
          Length = 376

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 152/387 (39%), Positives = 217/387 (56%), Gaps = 15/387 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT   L+   +LI+  S+TP D G   I+ + LK L F  +  D     ++ V NLYA+ 
Sbjct: 1   MTK-TLDIAKRLIEIDSITPNDNGCIDIIKSELKNLNFEYQSID-----SNGVSNLYAKR 54

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   P ++FAGH+DVVP G  + W   PF+ T  +G +YGRG  DMK SIA FI A+  F
Sbjct: 55  GESNPSVIFAGHVDVVPTGPLDKWHSDPFTPTEKDGLLYGRGSADMKSSIAAFIVAINEF 114

Query: 121 -IPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
                 + GSI L IT DEEG A +GTKK++       +  D CIVGEPT     GDTIK
Sbjct: 115 TAEYPDHKGSIGLFITSDEEGVATDGTKKIVEHFIHNNQDIDYCIVGEPTSAEKFGDTIK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSLS  + + G QGH+AYPHL +NPI     ++ +L  I +D GN  F  T+ +++
Sbjct: 175 NGRRGSLSATLIVKGVQGHIAYPHLIDNPIHRSASIIDELKKISWDNGNEYFPKTSWQVS 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NV+P  V + FN R +       LK E+   + K         + +++  P
Sbjct: 235 NINAGTGATNVVPGDVTIKFNFRHSTECTPDQLKNEVEMVVKKHADE-----YELNWEIP 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMH 358
             P +LT    LT +L+ +I + TG  P +ST+GGTSD RFI   C  V+EFG +  ++H
Sbjct: 290 SEP-YLTEKGILTDVLTSAISDVTGVTPEVSTTGGTSDGRFIAKICKQVVEFGPINASIH 348

Query: 359 ALNENASLQDLEDLTCIYEN-FLQNWF 384
            +NE+ ++ D+E L  IY+   ++   
Sbjct: 349 KINEHVNIDDIEKLKEIYKLSLIKILC 375


>gi|293415734|ref|ZP_06658377.1| succinyl-diaminopimelate desuccinylase [Escherichia coli B185]
 gi|291433382|gb|EFF06361.1| succinyl-diaminopimelate desuccinylase [Escherichia coli B185]
          Length = 375

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 153/385 (39%), Positives = 222/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDFADTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGASDMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++T+K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDETIKAQVLALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|331684122|ref|ZP_08384718.1| succinyl-diaminopimelate desuccinylase [Escherichia coli H299]
 gi|331079074|gb|EGI50276.1| succinyl-diaminopimelate desuccinylase [Escherichia coli H299]
          Length = 375

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 152/385 (39%), Positives = 221/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDFADTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVASERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|333002256|gb|EGK21820.1| succinyl-diaminopimelate desuccinylase [Shigella flexneri K-272]
 gi|333016078|gb|EGK35410.1| succinyl-diaminopimelate desuccinylase [Shigella flexneri K-227]
          Length = 375

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 150/385 (38%), Positives = 219/385 (56%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDFADTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P   T   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQPFLTT-RGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|15602887|ref|NP_245959.1| succinyl-diaminopimelate desuccinylase [Pasteurella multocida
           subsp. multocida str. Pm70]
 gi|81636850|sp|Q9CM22|DAPE_PASMU RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|12721354|gb|AAK03106.1| DapE [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 378

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 148/386 (38%), Positives = 215/386 (55%), Gaps = 13/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +E   +LI+ PS++P D G   I+   L+ LGF IE   F     +   NL+A+ 
Sbjct: 1   MKNSIIELARELIRRPSISPDDQGCQQIIAERLERLGFQIEWLPF-----NDTLNLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G+ +P + FAGH DVVP GD   W YPPFSA + +  +YGRG  DMKGS+A  + A   +
Sbjct: 56  GSGSPVIAFAGHTDVVPVGDTTQWQYPPFSAQLVDNVLYGRGAADMKGSLAAMVVAAEHY 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +       G+++LLIT DEE  A +GT +++  +  +GE  D CIVGEP+     GD +K
Sbjct: 116 VKANPEHSGTVALLITSDEEAAAKDGTVRVVETLMARGEPIDYCIVGEPSSAQQFGDIVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++  + I G QGHVAYPHL +NP+   +  L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITANLYIQGIQGHVAYPHLAQNPVHKALGFLTELTTYQWDNGNDFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN+R+     +  +K+++   L K   N     + + +   
Sbjct: 236 NIQAGTGSNNVIPGELYVQFNLRYCTEVTDDIIKKKVAEMLAKHQLN-----YRIEWHLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P FLT   KL   L   +   T N P L T GGTSDARFI      V+EFG + +T+H
Sbjct: 291 GKP-FLTAKGKLVDTLLDVVEKITQNRPHLDTGGGTSDARFIALMGAEVVEFGPLNKTIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E  ++ DL     +Y++ L N  
Sbjct: 350 KVDECVNVDDLAKCGEVYQHVLCNML 375


>gi|163801827|ref|ZP_02195724.1| succinyl-diaminopimelate desuccinylase [Vibrio sp. AND4]
 gi|159174335|gb|EDP59139.1| succinyl-diaminopimelate desuccinylase [Vibrio sp. AND4]
          Length = 378

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 155/388 (39%), Positives = 213/388 (54%), Gaps = 14/388 (3%)

Query: 1   MTPD-CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    L     LI   SVTP+D G   +++  LK LGF IE   F+        N +AR
Sbjct: 1   MTDSPVLALAKDLISRQSVTPEDAGCQDVMIERLKALGFEIEVMVFED-----TTNFWAR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            G EAP   FAGH DVVP G    W  PPF  TI +G ++GRG  DMKGS+AC + AV R
Sbjct: 56  RGDEAPLFAFAGHTDVVPAGKREQWDTPPFEPTIIDGYLHGRGAADMKGSLACMVVAVER 115

Query: 120 FIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           FI +  +  GSI  LIT DEEGP INGT +++  +  +GE  D CIVGEP+    +GD +
Sbjct: 116 FIAENPDHKGSIGFLITSDEEGPFINGTVRVVETLMARGENIDMCIVGEPSSTKEVGDVV 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGS++G++T+ G QGHVAYPHL  NPI   +  +H+LT   +D GN  F PT+ +I
Sbjct: 176 KNGRRGSITGDLTVKGTQGHVAYPHLANNPINQSLVAIHELTTTEWDQGNDYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
             +  G  + NVIP +  + FN+RF+     + + + I   L K   +     + + ++ 
Sbjct: 236 PNVSAGTGASNVIPGEFNVQFNLRFSTELTSEIIVQRITETLDKHELD-----YDLKWTF 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTM 357
              P        L   +  ++       P L T+GGTSD RFI      V+E G V  T+
Sbjct: 291 NGDPFLTD-TGALLDAVVLAVDEVNSTKPALLTTGGTSDGRFIARMGGQVVELGPVNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H +NE   + DLE LT +Y+N L++   
Sbjct: 350 HKVNECVKVDDLEKLTDMYKNTLKHLLA 377


>gi|114562940|ref|YP_750453.1| succinyl-diaminopimelate desuccinylase [Shewanella frigidimarina
           NCIMB 400]
 gi|122299929|sp|Q083F0|DAPE_SHEFN RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|114334233|gb|ABI71615.1| succinyldiaminopimelate desuccinylase [Shewanella frigidimarina
           NCIMB 400]
          Length = 377

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 159/386 (41%), Positives = 217/386 (56%), Gaps = 13/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D +E    LI  PSVTP D G   ++ N L  +GF+IE   F+        N++AR 
Sbjct: 1   MNNDVVELAKDLISRPSVTPLDEGCQTLMANRLAAVGFNIEPMVFED-----TTNMWARR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   P   FAGH DVVP GD N W  PPF  TI +  ++GRG  DMKGS+A  I A  RF
Sbjct: 56  GNCDPVFCFAGHTDVVPTGDLNRWHTPPFEPTIIDNYLHGRGAADMKGSLAAMIIATERF 115

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + K+  + GSI+ LIT DEEGP INGT +++  +E + EK    +VGEP+  H +GD +K
Sbjct: 116 VAKHPDHNGSIAYLITSDEEGPFINGTTRVIDTLEARNEKMTWALVGEPSSTHKLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+G +T++G QGHVAYPHL +NPI   +P L +L  + +D GN  F PT+ +I 
Sbjct: 176 NGRRGSLTGNLTVNGIQGHVAYPHLADNPIHKAVPALTELAQMHWDNGNEFFPPTSFQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NVIP ++ + FN R++     + L   + S L     +   L + +++   
Sbjct: 236 NINGGTGASNVIPGELTVMFNFRYSTEVTAEELILRVVSIL-----DAHGLDYDINWIFN 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT D  L     ++I   TG      TSGGTSD RFI      V+E G V  T+H
Sbjct: 291 GLP-FLTGDGPLLDATREAIREVTGYETDPQTSGGTSDGRFIAPTGAQVLELGPVNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            +NE  ++ DLE L   YE  L+   
Sbjct: 350 KVNECVNVADLEILANCYERILEKLL 375


>gi|255067950|ref|ZP_05319805.1| succinyl-diaminopimelate desuccinylase [Neisseria sicca ATCC 29256]
 gi|255047832|gb|EET43296.1| succinyl-diaminopimelate desuccinylase [Neisseria sicca ATCC 29256]
          Length = 411

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 168/391 (42%), Positives = 224/391 (57%), Gaps = 14/391 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    LE    LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R
Sbjct: 31  MTETQSLELAKALISRPSVTPDDRDCQKLLAERLHKIGFAAEEFHFGD-----TKNIWLR 85

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+ P + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK SIACF+ A  R
Sbjct: 86  RGTQVPVVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTSIACFVTACER 145

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ ++  + GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD I
Sbjct: 146 FVAEHPDHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMI 205

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I
Sbjct: 206 KNGRRGSLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQI 265

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S 
Sbjct: 266 SNINGGTGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDK-----HGVQYDLQWSC 320

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTM 357
              P FLTH  KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+
Sbjct: 321 SGQP-FLTHAGKLTDVARAAISETCGVETELSTTGGTSDGRFIKAIAKELIELGPSNATI 379

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFITPS 388
           H +NEN  L D+  L+ +YE  L       +
Sbjct: 380 HQINENVRLDDIPKLSAVYEGILARLLAEKA 410


>gi|117617486|ref|YP_856016.1| succinyl-diaminopimelate desuccinylase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|238055200|sp|A0KIB5|DAPE_AERHH RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|117558893|gb|ABK35841.1| succinyl-diaminopimelate desuccinylase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 375

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 152/385 (39%), Positives = 212/385 (55%), Gaps = 13/385 (3%)

Query: 3   PDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT 62
            D +     LI+ PSVTP D G   ++   L  LGF IE   F+        NL+AR G+
Sbjct: 2   SDVIALAKDLIRRPSVTPLDEGCQTLMAERLAKLGFVIEPMVFED-----TTNLWARRGS 56

Query: 63  EAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIP 122
           E P   FAGH DVVP G  + W  PPF  TI +G +YGRG  DMKGS+A  + AV RF+ 
Sbjct: 57  EGPLFCFAGHTDVVPAGPLDKWHTPPFEPTIQDGVLYGRGAADMKGSLAAMVVAVERFVA 116

Query: 123 KYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
           ++ +  GSI+ LIT DEEGP INGT +++  +E + EK   CIVGEP+   ++GD +K G
Sbjct: 117 EHPDHSGSIAFLITSDEEGPFINGTTRVIDTLEARHEKITWCIVGEPSSTTVVGDVVKNG 176

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGS++G++ + G QGHVAYPHL +NPI    P L +L    +D GN  F PT+ +I  I
Sbjct: 177 RRGSITGDLLVRGVQGHVAYPHLADNPIHKAAPALAELAATVWDEGNAYFPPTSFQIANI 236

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
             G  + NVIP ++ + FN RF+    +  ++E + + L +   +     + + ++    
Sbjct: 237 SAGTGASNVIPGELHVQFNFRFSTELTDLDIRERVEALLDRHGLD-----YQLDWTLSGQ 291

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHAL 360
           P       KL +    +I    G  P L T+GGTSD RFI      VIE G V  T+H +
Sbjct: 292 PFLTD-TGKLLAAAVSAIEAVNGQQPALLTTGGTSDGRFIAPTGAEVIELGPVNATIHKV 350

Query: 361 NENASLQDLEDLTCIYENFLQNWFI 385
           NE     DL+ L  +Y+  L     
Sbjct: 351 NECVKADDLDLLADMYQGVLARLLA 375


>gi|325142715|gb|EGC65094.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           961-5945]
          Length = 381

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 167/391 (42%), Positives = 224/391 (57%), Gaps = 14/391 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    LE   +LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R
Sbjct: 1   MTETQSLELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGD-----TKNIWLR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+AP + FAGH DVVP G    W  PPF     +G++YGRG  DMK SIACF+ A  R
Sbjct: 56  RGTKAPVVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACER 115

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ ++  + GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD I
Sbjct: 116 FVAEHPDHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMI 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I
Sbjct: 176 KNGRRGSLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S 
Sbjct: 236 SNINGGTGATNVIPGELSVKFNFRFSTESTEAGLKQRVHAILDK-----HGVQYDLQWSC 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTM 357
              P FLT   KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+
Sbjct: 291 SGQP-FLTQAGKLTDVARAAIAETCGIEAELSTTGGTSDGRFIKAIAKELIELGPSNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFITPS 388
           H +NEN  L D+  L+ +YE  L       +
Sbjct: 350 HQINENVRLDDIPKLSAVYEGILACLLAGNA 380


>gi|238055324|sp|A8IMH3|DAPE_AZOC5 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 376

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 180/380 (47%), Positives = 237/380 (62%), Gaps = 8/380 (2%)

Query: 7   EHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPH 66
                LI+ PSVTP  G A  ++ + LK  G+ +E   F T     V NLYAR GT +P+
Sbjct: 2   AFAKALIQAPSVTPDAGQALDVVADALKAAGYHVERLVFSTAGVP-VDNLYARIGTASPN 60

Query: 67  LMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKN 126
           L FAGH+DVVPPGD   W + PFS  + +G +YGRG VDMKG++A F    A        
Sbjct: 61  LCFAGHVDVVPPGDAASWRHGPFSGAVEDGVLYGRGAVDMKGAVAAF--LAAALAYGAPA 118

Query: 127 FGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSL 186
            GS+S LITGDEEGP+I+GT K++ W+  KGE  D CIVGEPT  + +GD +KIGRRGSL
Sbjct: 119 QGSLSFLITGDEEGPSIDGTAKVVDWLAAKGEVIDHCIVGEPTNPNALGDMVKIGRRGSL 178

Query: 187 SGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNP 246
           SG IT+ G+QGHVAYPHL +NP+  L+ LL  LT    D G+  F P+N+E+ ++DVGN 
Sbjct: 179 SGLITVEGRQGHVAYPHLADNPVPRLVRLLTALTAAPLDNGSAHFPPSNLEVISVDVGNT 238

Query: 247 SKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLT 306
           + NVIP      FN+R+NDL++ ++L  EI  RL    +      + + F    S  FLT
Sbjct: 239 AYNVIPGAATAKFNVRYNDLYSLESLMAEIARRLDTAGE-----PYVLTFRDGASESFLT 293

Query: 307 HDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENASL 366
                   +  ++ + TG  P +ST+GGTSDARFIK  CPV+EFGLVG+TMH +NE   +
Sbjct: 294 APGPFVETVLDAVADVTGQRPQMSTTGGTSDARFIKSLCPVVEFGLVGQTMHMVNEATPV 353

Query: 367 QDLEDLTCIYENFLQNWFIT 386
            DL  LT IYE  +  +F T
Sbjct: 354 ADLTALTAIYERLIARYFAT 373


>gi|325128595|gb|EGC51465.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           N1568]
          Length = 381

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 164/385 (42%), Positives = 221/385 (57%), Gaps = 13/385 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE   +LI  PSVTP D     +L   L  +GF+ E   F        KN++ R GT+AP
Sbjct: 7   LELAKELIARPSVTPDDQNCQKLLAERLHKIGFAAEALHFGD-----TKNIWLRRGTKAP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK  IACF+ A  RF+ ++ 
Sbjct: 62  VVCFAGHTDVVPTGPIEKWDSPPFEPTERDGRLYGRGAADMKTGIACFVTACERFVAEHP 121

Query: 126 -NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
            + GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GD IK GRRG
Sbjct: 122 DHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVDKLGDMIKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 182 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNKYFPPTSFQISNINGG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
             + NVI  ++ + FN RF+    E  LK+ + + L K       + + + +S    P F
Sbjct: 242 TGATNVIQGELNVKFNFRFSTESTEAGLKQRVHAILDK-----HGVQYDLQWSCSGQP-F 295

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNEN 363
           LT   KLT +   +I    G    LST+GGTSD RFIK     +IE GL   T+H +NEN
Sbjct: 296 LTQAGKLTDVARAAIAAICGVEAELSTTGGTSDGRFIKAIAKELIELGLSNATIHQINEN 355

Query: 364 ASLQDLEDLTCIYENFLQNWFITPS 388
             L D+  L+ +YE  L       +
Sbjct: 356 VRLNDIPKLSAVYEGILARLLAGNA 380


>gi|329119159|ref|ZP_08247849.1| succinyl-diaminopimelate desuccinylase [Neisseria bacilliformis
           ATCC BAA-1200]
 gi|327464718|gb|EGF11013.1| succinyl-diaminopimelate desuccinylase [Neisseria bacilliformis
           ATCC BAA-1200]
          Length = 377

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 160/387 (41%), Positives = 221/387 (57%), Gaps = 13/387 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT   L    +LI  PSVTP D G   ++   L  LGF+ EE +F        KNL+ R 
Sbjct: 1   MTHPALALAKELIARPSVTPDDQGCQRLIAERLAPLGFTAEEMNFGD-----TKNLWLRR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT  P L FAGH DVVPPG    WT PPF     +G++YGRG  DMK SIA F+AA   F
Sbjct: 56  GTSGPLLCFAGHTDVVPPGPAEQWTSPPFEPAERDGRLYGRGAADMKSSIAAFVAACEAF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ +  GSI+LLIT DEEG A +GT +++  ++ +GE  D CIVGEPT    +GDT+K
Sbjct: 116 VAEHPHHKGSIALLITSDEEGDARDGTVRVVETLKARGETIDYCIVGEPTAVSELGDTVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSLSG +T++GKQGH+AYPHL +NP+      L +L    +D GN  F PT  +I+
Sbjct: 176 NGRRGSLSGHLTVYGKQGHIAYPHLADNPVHRAAAALAELAAEQWDAGNEYFPPTGFQIS 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  + NVIP ++ + FN R++   +   LK  + + L     +  +L + + ++  
Sbjct: 236 NIAAGTGATNVIPGELSVKFNFRYSTESDADGLKRRVHAIL-----DRHRLPYRIDWTLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMH 358
             P FLT   +LT     +     G    LST+GGTSD RFIKD    +IE G V  T+H
Sbjct: 291 GLP-FLTEAGRLTECAQAATEKVCGIKAALSTTGGTSDGRFIKDIARELIELGPVNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            ++E+ +  D+  L  IY+  L +   
Sbjct: 350 QIDEHIAAADIPRLARIYQTMLADLLA 376


>gi|223041617|ref|ZP_03611816.1| succinyl-diaminopimelate desuccinylase [Actinobacillus minor 202]
 gi|223017592|gb|EEF16004.1| succinyl-diaminopimelate desuccinylase [Actinobacillus minor 202]
          Length = 377

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 142/381 (37%), Positives = 206/381 (54%), Gaps = 13/381 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +     LI+  S++P D G   ++   L+ +GF +E   F         NL+A  
Sbjct: 1   MKNQIISLAQALIQRKSISPNDEGCQQLIAERLQAVGFKLEWLPFGD-----TLNLWATH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   P L FAGH DVVP GD + WTYPPFSA I +  +YGRG  DMKGS+A  + A   F
Sbjct: 56  GEGEPCLAFAGHTDVVPEGDESQWTYPPFSAEIVDDMLYGRGAADMKGSLAAMVIACETF 115

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +     + G I+LLIT DEE  A +GT K++  + ++ E    C+VGEP+    +GD +K
Sbjct: 116 VKNNPNHQGKIALLITSDEEAAAKDGTVKVVETLMQRQEPIHYCVVGEPSSTKQLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++  + I G QGHVAYPHL ENP+   +P L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITANLYIEGIQGHVAYPHLAENPVHTALPFLSELTAYQWDNGNEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN+R+    N++ +K ++   L K         H + ++  
Sbjct: 236 NIKAGTGSNNVIPGELYVQFNLRYCTEVNDEIIKAKVAEMLQKHGLK-----HRIEWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P    +  KL     +++   T   P L T GGTSD RFI      V+EFG + +T+H
Sbjct: 291 GKPFLAGN-GKLVQATIQAVEKVTQITPKLDTGGGTSDGRFIALMGAEVVEFGPINQTIH 349

Query: 359 ALNENASLQDLEDLTCIYENF 379
            +NE  ++ DL+    +Y   
Sbjct: 350 KVNECVNVNDLDKCGEVYYQI 370


>gi|332978021|gb|EGK14763.1| succinyl-diaminopimelate desuccinylase [Psychrobacter sp.
           1501(2011)]
          Length = 448

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 160/386 (41%), Positives = 220/386 (56%), Gaps = 13/386 (3%)

Query: 11  QLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTK---------NTSIVKNLYARFG 61
            L++  SVTP+D     +LV  LK L F+ E   F  K         N + VKNL+AR G
Sbjct: 64  DLMRRDSVTPEDKHCQDVLVERLKPLDFNFEFMYFGDKETTAPDFDKNNAEVKNLWARRG 123

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACF-IAAVARF 120
           T  P + FAGH DVVP G+ ++W  PPF  T+ +G ++GRG  DMK  IA F +AA    
Sbjct: 124 TADPVVCFAGHTDVVPTGNVDNWKIPPFEPTVKDGFLWGRGAADMKTGIAAFTVAAENFV 183

Query: 121 IPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
                + GSI++LIT DEEGP+INGT K++  +E + EK   C+VGEP+    +GD IK 
Sbjct: 184 KKHPNHNGSIAMLITSDEEGPSINGTVKVVEALEARNEKITYCLVGEPSSTDTLGDIIKN 243

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGSL G +T+ GKQGHVAYPHL  NPI  L+P L + T   +D GN  F  T+M+I+ 
Sbjct: 244 GRRGSLGGILTVTGKQGHVAYPHLAVNPIHALLPALAEFTRTQWDNGNDFFPATSMQISN 303

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV 300
           I+ G  + NVIP  V++ FN RF+    EK L+ +    L +   +  + ++ + +    
Sbjct: 304 INGGTGANNVIPETVEVVFNFRFSTETTEKELRAKTHEILDRHFADT-EATYDIDWKLSG 362

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHA 359
            P FLT + KL      +I   TG    LSTSGGTSD RFI      V+E G+   T+H 
Sbjct: 363 HP-FLTAEGKLVDACKVAIKEVTGIDTTLSTSGGTSDGRFIAPTGAQVVELGVRNATIHQ 421

Query: 360 LNENASLQDLEDLTCIYENFLQNWFI 385
           ++E   + D+  L  IYE  L+   +
Sbjct: 422 VDERVEIDDIGKLAQIYERMLEELLL 447


>gi|114332195|ref|YP_748417.1| succinyl-diaminopimelate desuccinylase [Nitrosomonas eutropha C91]
 gi|122313129|sp|Q0ADY0|DAPE_NITEC RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|114309209|gb|ABI60452.1| succinyldiaminopimelate desuccinylase [Nitrosomonas eutropha C91]
          Length = 378

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 163/387 (42%), Positives = 217/387 (56%), Gaps = 13/387 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    L     LI   S+TP D G   ILV+ L  LGF+ E  +F       V+NL+ R 
Sbjct: 1   MPNSTLTLAQMLIARRSLTPDDDGCQKILVHRLAGLGFNSEAMNFGE-----VENLWTRK 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G + P + F GH DVVP G    W   PF+ T+ +G +YGRG  DMK SIA F+ A+  F
Sbjct: 56  GIDGPLVCFVGHTDVVPTGPVAQWDSDPFTPTVRDGFLYGRGAADMKSSIAAFVTAIEEF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  + +  GSI+LLIT DEEGPA+ GT K++  ++ +GE  D CIVGEPTC   +GDTIK
Sbjct: 116 VELHPDHKGSIALLITSDEEGPAVEGTVKVVETLQARGEVIDYCIVGEPTCTDRLGDTIK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSLSG +T+ G QGH+AYPHL  NPI    P + +L    +D GN  F  T   I+
Sbjct: 176 NGRRGSLSGNLTVKGIQGHIAYPHLARNPIHTAAPAIAELAQTVWDDGNEYFPATTWHIS 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  + NVIP +V + FN RF+     ++LK  +   L +         + + +   
Sbjct: 236 NIRGGTGATNVIPGEVNLLFNFRFSTASTVESLKTRVHEILDRHGLE-----YELVWELS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMH 358
             P +LT    L   LS +I   TG  P LSTSGGTSD RFI D C  V+EFG    T+H
Sbjct: 291 GKP-YLTPKGILADALSAAIREVTGVEPELSTSGGTSDGRFIADICSQVVEFGPRNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            +NE+  + D+E L+ IY   L+   +
Sbjct: 350 KINESVEVADIERLSRIYRLTLEKLLL 376


>gi|187733531|ref|YP_001881263.1| succinyl-diaminopimelate desuccinylase [Shigella boydii CDC
           3083-94]
 gi|238055227|sp|B2TXP7|DAPE_SHIB3 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|187430523|gb|ACD09797.1| succinyl-diaminopimelate desuccinylase [Shigella boydii CDC
           3083-94]
          Length = 375

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 152/385 (39%), Positives = 221/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDFADTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNTADLQLLARMYQRIMEQL 373


>gi|16130397|ref|NP_416967.1| N-succinyl-diaminopimelate deacylase [Escherichia coli str. K-12
           substr. MG1655]
 gi|24113800|ref|NP_708310.1| succinyl-diaminopimelate desuccinylase [Shigella flexneri 2a str.
           301]
 gi|30063851|ref|NP_838022.1| succinyl-diaminopimelate desuccinylase [Shigella flexneri 2a str.
           2457T]
 gi|82544919|ref|YP_408866.1| succinyl-diaminopimelate desuccinylase [Shigella boydii Sb227]
 gi|89109277|ref|AP_003057.1| N-succinyl-diaminopimelate deacylase [Escherichia coli str. K-12
           substr. W3110]
 gi|157158473|ref|YP_001463794.1| succinyl-diaminopimelate desuccinylase [Escherichia coli E24377A]
 gi|157161932|ref|YP_001459250.1| succinyl-diaminopimelate desuccinylase [Escherichia coli HS]
 gi|170019244|ref|YP_001724198.1| succinyl-diaminopimelate desuccinylase [Escherichia coli ATCC 8739]
 gi|170082081|ref|YP_001731401.1| N-succinyl-diaminopimelate deacylase [Escherichia coli str. K-12
           substr. DH10B]
 gi|170683901|ref|YP_001744654.1| succinyl-diaminopimelate desuccinylase [Escherichia coli SMS-3-5]
 gi|188495224|ref|ZP_03002494.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 53638]
 gi|193064746|ref|ZP_03045824.1| succinyl-diaminopimelate desuccinylase [Escherichia coli E22]
 gi|194427309|ref|ZP_03059859.1| succinyl-diaminopimelate desuccinylase [Escherichia coli B171]
 gi|194437583|ref|ZP_03069679.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 101-1]
 gi|215487775|ref|YP_002330206.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O127:H6
           str. E2348/69]
 gi|218554995|ref|YP_002387908.1| succinyl-diaminopimelate desuccinylase [Escherichia coli IAI1]
 gi|218690598|ref|YP_002398810.1| succinyl-diaminopimelate desuccinylase [Escherichia coli ED1a]
 gi|218696098|ref|YP_002403765.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 55989]
 gi|238901636|ref|YP_002927432.1| N-succinyl-diaminopimelate deacylase [Escherichia coli BW2952]
 gi|253772637|ref|YP_003035468.1| succinyl-diaminopimelate desuccinylase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254162446|ref|YP_003045554.1| succinyl-diaminopimelate desuccinylase [Escherichia coli B str.
           REL606]
 gi|256017387|ref|ZP_05431252.1| succinyl-diaminopimelate desuccinylase [Shigella sp. D9]
 gi|256021843|ref|ZP_05435708.1| succinyl-diaminopimelate desuccinylase [Escherichia sp. 4_1_40B]
 gi|260845103|ref|YP_003222881.1| N-succinyl-diaminopimelate deacylase [Escherichia coli O103:H2 str.
           12009]
 gi|260869159|ref|YP_003235561.1| N-succinyl-diaminopimelate deacylase [Escherichia coli O111:H- str.
           11128]
 gi|293410866|ref|ZP_06654442.1| succinyl-diaminopimelate desuccinylase [Escherichia coli B354]
 gi|297516547|ref|ZP_06934933.1| succinyl-diaminopimelate desuccinylase [Escherichia coli OP50]
 gi|300903477|ref|ZP_07121402.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 84-1]
 gi|300921400|ref|ZP_07137761.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 115-1]
 gi|300930094|ref|ZP_07145519.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 187-1]
 gi|300940288|ref|ZP_07154884.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 21-1]
 gi|300951832|ref|ZP_07165643.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 116-1]
 gi|300957179|ref|ZP_07169414.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 175-1]
 gi|301023822|ref|ZP_07187557.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 196-1]
 gi|301302819|ref|ZP_07208947.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 124-1]
 gi|301644461|ref|ZP_07244458.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 146-1]
 gi|306814451|ref|ZP_07448613.1| succinyl-diaminopimelate desuccinylase [Escherichia coli NC101]
 gi|307139105|ref|ZP_07498461.1| succinyl-diaminopimelate desuccinylase [Escherichia coli H736]
 gi|312967760|ref|ZP_07781975.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 2362-75]
 gi|312973294|ref|ZP_07787466.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 1827-70]
 gi|331643088|ref|ZP_08344223.1| succinyl-diaminopimelate desuccinylase [Escherichia coli H736]
 gi|331669208|ref|ZP_08370056.1| succinyl-diaminopimelate desuccinylase [Escherichia coli TA271]
 gi|331678453|ref|ZP_08379128.1| succinyl-diaminopimelate desuccinylase [Escherichia coli H591]
 gi|332278385|ref|ZP_08390798.1| N-succinyl-diaminopimelate deacylase [Shigella sp. D9]
 gi|83305672|sp|P0AED7|DAPE_ECOLI RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|83305673|sp|P0AED8|DAPE_SHIFL RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|123559033|sp|Q31Y20|DAPE_SHIBS RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064733|sp|A7ZPR5|DAPE_ECO24 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064734|sp|B7UGM1|DAPE_ECO27 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064736|sp|B7LCK7|DAPE_ECO55 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064739|sp|B7M7H2|DAPE_ECO8A RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064740|sp|B1XAE3|DAPE_ECODH RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064741|sp|A8A2W3|DAPE_ECOHS RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064743|sp|B1IWI8|DAPE_ECOLC RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064746|sp|B1LNC1|DAPE_ECOSM RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|259595044|sp|C4ZX46|DAPE_ECOBW RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|41234|emb|CAA40665.1| succinyldiaminopimelate desuccinylase [Escherichia coli K-12]
 gi|253061|gb|AAB22798.1| N-succinyl-L-diaminopimelic acid desuccinylase [Escherichia coli]
 gi|1788816|gb|AAC75525.1| N-succinyl-diaminopimelate deacylase [Escherichia coli str. K-12
           substr. MG1655]
 gi|1799895|dbj|BAA16346.1| N-succinyl-diaminopimelate deacylase [Escherichia coli str. K12
           substr. W3110]
 gi|24052884|gb|AAN44017.1| N-succinyl-diaminopimelate deacylase [Shigella flexneri 2a str.
           301]
 gi|30042106|gb|AAP17832.1| N-succinyl-diaminopimelate deacylase [Shigella flexneri 2a str.
           2457T]
 gi|81246330|gb|ABB67038.1| N-succinyl-diaminopimelate deacylase [Shigella boydii Sb227]
 gi|157067612|gb|ABV06867.1| succinyl-diaminopimelate desuccinylase [Escherichia coli HS]
 gi|157080503|gb|ABV20211.1| succinyl-diaminopimelate desuccinylase [Escherichia coli E24377A]
 gi|169754172|gb|ACA76871.1| succinyl-diaminopimelate desuccinylase [Escherichia coli ATCC 8739]
 gi|169889916|gb|ACB03623.1| N-succinyl-diaminopimelate deacylase [Escherichia coli str. K-12
           substr. DH10B]
 gi|170521619|gb|ACB19797.1| succinyl-diaminopimelate desuccinylase [Escherichia coli SMS-3-5]
 gi|188490423|gb|EDU65526.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 53638]
 gi|192927629|gb|EDV82245.1| succinyl-diaminopimelate desuccinylase [Escherichia coli E22]
 gi|194414630|gb|EDX30902.1| succinyl-diaminopimelate desuccinylase [Escherichia coli B171]
 gi|194423389|gb|EDX39380.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 101-1]
 gi|215265847|emb|CAS10256.1| N-succinyl-diaminopimelate deacylase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218352830|emb|CAU98618.1| N-succinyl-diaminopimelate deacylase [Escherichia coli 55989]
 gi|218361763|emb|CAQ99360.1| N-succinyl-diaminopimelate deacylase [Escherichia coli IAI1]
 gi|218428162|emb|CAR09077.2| N-succinyl-diaminopimelate deacylase [Escherichia coli ED1a]
 gi|238861918|gb|ACR63916.1| N-succinyl-diaminopimelate deacylase [Escherichia coli BW2952]
 gi|242378071|emb|CAQ32842.1| N-succinyl-L-diaminopimelate desuccinylase subunit, subunit of
           N-succinyl-L-diaminopimelate desuccinylase [Escherichia
           coli BL21(DE3)]
 gi|253323681|gb|ACT28283.1| succinyl-diaminopimelate desuccinylase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253974347|gb|ACT40018.1| succinyl-diaminopimelate desuccinylase [Escherichia coli B str.
           REL606]
 gi|253978514|gb|ACT44184.1| succinyl-diaminopimelate desuccinylase [Escherichia coli BL21(DE3)]
 gi|257760250|dbj|BAI31747.1| N-succinyl-diaminopimelate deacylase [Escherichia coli O103:H2 str.
           12009]
 gi|257765515|dbj|BAI37010.1| N-succinyl-diaminopimelate deacylase [Escherichia coli O111:H- str.
           11128]
 gi|260448450|gb|ACX38872.1| succinyl-diaminopimelate desuccinylase [Escherichia coli DH1]
 gi|281601875|gb|ADA74859.1| putative Acetylornithine deacetylase/Succinyl-diaminopimelate
           desuccinylase-like deacylase [Shigella flexneri 2002017]
 gi|284922418|emb|CBG35505.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 042]
 gi|291471334|gb|EFF13818.1| succinyl-diaminopimelate desuccinylase [Escherichia coli B354]
 gi|299880695|gb|EFI88906.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 196-1]
 gi|300316023|gb|EFJ65807.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 175-1]
 gi|300404509|gb|EFJ88047.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 84-1]
 gi|300411712|gb|EFJ95022.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 115-1]
 gi|300448928|gb|EFK12548.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 116-1]
 gi|300454852|gb|EFK18345.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 21-1]
 gi|300461984|gb|EFK25477.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 187-1]
 gi|300841754|gb|EFK69514.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 124-1]
 gi|301077206|gb|EFK92012.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 146-1]
 gi|305851845|gb|EFM52297.1| succinyl-diaminopimelate desuccinylase [Escherichia coli NC101]
 gi|309702751|emb|CBJ02080.1| succinyl-diaminopimelate desuccinylase [Escherichia coli ETEC
           H10407]
 gi|310331889|gb|EFP99124.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 1827-70]
 gi|312287957|gb|EFR15862.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 2362-75]
 gi|313650927|gb|EFS15327.1| succinyl-diaminopimelate desuccinylase [Shigella flexneri 2a str.
           2457T]
 gi|315137094|dbj|BAJ44253.1| succinyl-diaminopimelate desuccinylase [Escherichia coli DH1]
 gi|315256483|gb|EFU36451.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 85-1]
 gi|315300443|gb|EFU59673.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 16-3]
 gi|315615714|gb|EFU96346.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 3431]
 gi|320176283|gb|EFW51344.1| N-succinyl-L,L-diaminopimelate desuccinylase [Shigella dysenteriae
           CDC 74-1112]
 gi|320180455|gb|EFW55386.1| N-succinyl-L,L-diaminopimelate desuccinylase [Shigella boydii ATCC
           9905]
 gi|320185164|gb|EFW59944.1| N-succinyl-L,L-diaminopimelate desuccinylase [Shigella flexneri CDC
           796-83]
 gi|320200030|gb|EFW74619.1| N-succinyl-L,L-diaminopimelate desuccinylase [Escherichia coli
           EC4100B]
 gi|323159320|gb|EFZ45305.1| succinyl-diaminopimelate desuccinylase [Escherichia coli E128010]
 gi|323170270|gb|EFZ55923.1| succinyl-diaminopimelate desuccinylase [Escherichia coli LT-68]
 gi|323177411|gb|EFZ62999.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 1180]
 gi|323936363|gb|EGB32653.1| succinyl-diaminopimelate desuccinylase [Escherichia coli E1520]
 gi|323941273|gb|EGB37458.1| succinyl-diaminopimelate desuccinylase [Escherichia coli E482]
 gi|323944688|gb|EGB40755.1| succinyl-diaminopimelate desuccinylase [Escherichia coli H120]
 gi|323961264|gb|EGB56876.1| succinyl-diaminopimelate desuccinylase [Escherichia coli H489]
 gi|323971009|gb|EGB66258.1| succinyl-diaminopimelate desuccinylase [Escherichia coli TA007]
 gi|324118187|gb|EGC12084.1| succinyl-diaminopimelate desuccinylase [Escherichia coli E1167]
 gi|331039886|gb|EGI12106.1| succinyl-diaminopimelate desuccinylase [Escherichia coli H736]
 gi|331064402|gb|EGI36313.1| succinyl-diaminopimelate desuccinylase [Escherichia coli TA271]
 gi|331074913|gb|EGI46233.1| succinyl-diaminopimelate desuccinylase [Escherichia coli H591]
 gi|332087912|gb|EGI93037.1| succinyl-diaminopimelate desuccinylase [Shigella boydii 5216-82]
 gi|332093033|gb|EGI98099.1| succinyl-diaminopimelate desuccinylase [Shigella boydii 3594-74]
 gi|332100737|gb|EGJ04083.1| N-succinyl-diaminopimelate deacylase [Shigella sp. D9]
 gi|332755112|gb|EGJ85477.1| succinyl-diaminopimelate desuccinylase [Shigella flexneri 4343-70]
 gi|332755511|gb|EGJ85875.1| succinyl-diaminopimelate desuccinylase [Shigella flexneri K-671]
 gi|332756499|gb|EGJ86850.1| succinyl-diaminopimelate desuccinylase [Shigella flexneri 2747-71]
 gi|332766277|gb|EGJ96487.1| succinyl-diaminopimelate desuccinylase [Shigella flexneri 2930-71]
 gi|333002003|gb|EGK21569.1| succinyl-diaminopimelate desuccinylase [Shigella flexneri K-218]
 gi|333016372|gb|EGK35703.1| succinyl-diaminopimelate desuccinylase [Shigella flexneri K-304]
          Length = 375

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 152/385 (39%), Positives = 221/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDFADTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|74312997|ref|YP_311416.1| succinyl-diaminopimelate desuccinylase [Shigella sonnei Ss046]
 gi|123616553|sp|Q3YZ81|DAPE_SHISS RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|73856474|gb|AAZ89181.1| N-succinyl-diaminopimelate deacylase [Shigella sonnei Ss046]
 gi|323169091|gb|EFZ54768.1| succinyl-diaminopimelate desuccinylase [Shigella sonnei 53G]
          Length = 375

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 152/385 (39%), Positives = 222/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L++ L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIDRLQAIGFTVERMDFADTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|325198651|gb|ADY94107.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           G2136]
          Length = 381

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 166/385 (43%), Positives = 223/385 (57%), Gaps = 13/385 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE   +LI  PSVTP D     +L   L  +GF+ EE  F        KN++ R GT+ P
Sbjct: 7   LELAKELIARPSVTPDDQNCQKLLAERLHKIGFAAEELHFGD-----TKNIWLRRGTKVP 61

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK SIACF+ A  RF+ ++ 
Sbjct: 62  VVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTSIACFVTACERFVAEHP 121

Query: 126 -NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
            + GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GD IK GRRG
Sbjct: 122 DHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVGKLGDMIKNGRRG 181

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 182 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 241

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
             + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S    P F
Sbjct: 242 TGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDK-----HGVQYDLQWSCSGQP-F 295

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNEN 363
           LTH  KLT +   +I    G    LST+GGTSD RFIK     +IE G    T+H +NEN
Sbjct: 296 LTHAGKLTDVARAAIAEICGVETELSTTGGTSDGRFIKAIAKELIELGSSNATIHQINEN 355

Query: 364 ASLQDLEDLTCIYENFLQNWFITPS 388
             L D+  L+ +YE  L       +
Sbjct: 356 VRLDDIPKLSAVYEGILARLLAGNA 380


>gi|191167646|ref|ZP_03029456.1| succinyl-diaminopimelate desuccinylase [Escherichia coli B7A]
 gi|209919944|ref|YP_002294028.1| succinyl-diaminopimelate desuccinylase [Escherichia coli SE11]
 gi|300817771|ref|ZP_07097986.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 107-1]
 gi|300922173|ref|ZP_07138310.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 182-1]
 gi|301328990|ref|ZP_07222017.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 78-1]
 gi|307312538|ref|ZP_07592171.1| succinyl-diaminopimelate desuccinylase [Escherichia coli W]
 gi|309794490|ref|ZP_07688913.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 145-7]
 gi|238064745|sp|B6I539|DAPE_ECOSE RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|190902326|gb|EDV62065.1| succinyl-diaminopimelate desuccinylase [Escherichia coli B7A]
 gi|209913203|dbj|BAG78277.1| succinyl-diaminopimelate desuccinylase [Escherichia coli SE11]
 gi|300421488|gb|EFK04799.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 182-1]
 gi|300529759|gb|EFK50821.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 107-1]
 gi|300844624|gb|EFK72384.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 78-1]
 gi|306907461|gb|EFN37965.1| succinyl-diaminopimelate desuccinylase [Escherichia coli W]
 gi|308121946|gb|EFO59208.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 145-7]
 gi|315061787|gb|ADT76114.1| N-succinyl-diaminopimelate deacylase [Escherichia coli W]
 gi|323184475|gb|EFZ69850.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 1357]
 gi|323377632|gb|ADX49900.1| succinyl-diaminopimelate desuccinylase [Escherichia coli KO11]
 gi|324020143|gb|EGB89362.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 117-3]
 gi|332344290|gb|AEE57624.1| succinyl-diaminopimelate desuccinylase DapE [Escherichia coli
           UMNK88]
          Length = 375

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 152/385 (39%), Positives = 221/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDFADTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMSRNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|193068374|ref|ZP_03049337.1| succinyl-diaminopimelate desuccinylase [Escherichia coli E110019]
 gi|192958326|gb|EDV88766.1| succinyl-diaminopimelate desuccinylase [Escherichia coli E110019]
          Length = 375

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 152/385 (39%), Positives = 221/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDFADTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALIARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|218700929|ref|YP_002408558.1| succinyl-diaminopimelate desuccinylase [Escherichia coli IAI39]
 gi|238064738|sp|B7NQK9|DAPE_ECO7I RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|218370915|emb|CAR18734.1| N-succinyl-diaminopimelate deacylase [Escherichia coli IAI39]
          Length = 375

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 152/385 (39%), Positives = 221/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDFADTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHAGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|300820869|ref|ZP_07101019.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 119-7]
 gi|300526622|gb|EFK47691.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 119-7]
          Length = 375

 Score =  246 bits (627), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 152/385 (39%), Positives = 222/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDFADTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV++   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEK-----HQLRYTVNWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|324112962|gb|EGC06938.1| succinyl-diaminopimelate desuccinylase [Escherichia fergusonii
           B253]
          Length = 375

 Score =  246 bits (627), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 152/385 (39%), Positives = 221/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIKRLQAIGFTVERMDFADTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|149189123|ref|ZP_01867411.1| succinyl-diaminopimelate desuccinylase [Vibrio shilonii AK1]
 gi|148837086|gb|EDL54035.1| succinyl-diaminopimelate desuccinylase [Vibrio shilonii AK1]
          Length = 378

 Score =  245 bits (626), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 154/387 (39%), Positives = 215/387 (55%), Gaps = 14/387 (3%)

Query: 1   MTPD-CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    L     LI   SVTP+D     +++  L+ LGF IE   F+        N +AR
Sbjct: 1   MTDSPVLALAKDLISRESVTPEDADCQKVMIERLEKLGFEIEVMVFED-----TTNFWAR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            G+EAP   FAGH DVVP G    W  PPF  TI +G ++GRG  DMKGS+AC I AV R
Sbjct: 56  KGSEAPLFAFAGHTDVVPAGPKEQWHTPPFEPTIIDGHLHGRGAADMKGSLACMIVAVER 115

Query: 120 FIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           FI +  N  GSI+ LIT DEEGP INGT +++  + ++ E  D CIVGEP+    +GD +
Sbjct: 116 FIEQNPNHTGSIAFLITSDEEGPFINGTTRVVDTLMERNELIDMCIVGEPSSTLAVGDVV 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGS++G++ + G QGHVAYPHL  NP+   +P L +L    +D GN  F PT+ +I
Sbjct: 176 KNGRRGSITGDLKVKGIQGHVAYPHLANNPVHQALPALAELAATKWDEGNDFFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
             +  G  + NVIP +  + FN RF+    ++ +K+ + S L     ++  L + + ++ 
Sbjct: 236 PNLHSGTGATNVIPGEFDVQFNFRFSTELTDEDIKQRVHSTL-----DLHGLDYELKWTL 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTM 357
              P       +L   +  ++       P L T+GGTSD RFI      V+E G V  T+
Sbjct: 291 SGHPFLTD-RGELLDAVVDAVEEVNHKKPELLTTGGTSDGRFIARMGTQVVELGPVNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWF 384
           H +NE  ++ DLE LT +YE  L N  
Sbjct: 350 HKVNECVNIADLEKLTDMYEKTLFNLL 376


>gi|26248841|ref|NP_754881.1| succinyl-diaminopimelate desuccinylase [Escherichia coli CFT073]
 gi|91211803|ref|YP_541789.1| succinyl-diaminopimelate desuccinylase [Escherichia coli UTI89]
 gi|117624668|ref|YP_853581.1| succinyl-diaminopimelate desuccinylase [Escherichia coli APEC O1]
 gi|218559407|ref|YP_002392320.1| succinyl-diaminopimelate desuccinylase [Escherichia coli S88]
 gi|227887510|ref|ZP_04005315.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 83972]
 gi|237704988|ref|ZP_04535469.1| succinyl-diaminopimelate desuccinylase [Escherichia sp. 3_2_53FAA]
 gi|300981764|ref|ZP_07175728.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 45-1]
 gi|301046357|ref|ZP_07193519.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 185-1]
 gi|81475315|sp|Q8FF82|DAPE_ECOL6 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|122422938|sp|Q1R8Q6|DAPE_ECOUT RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064735|sp|B7MHW4|DAPE_ECO45 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064742|sp|A1ADX7|DAPE_ECOK1 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|26109247|gb|AAN81449.1|AE016764_131 Succinyl-diaminopimelate desuccinylase [Escherichia coli CFT073]
 gi|91073377|gb|ABE08258.1| succinyl-diaminopimelate desuccinylase [Escherichia coli UTI89]
 gi|115513792|gb|ABJ01867.1| succinyl-diaminopimelate desuccinylase [Escherichia coli APEC O1]
 gi|218366176|emb|CAR03922.1| N-succinyl-diaminopimelate deacylase [Escherichia coli S88]
 gi|226901354|gb|EEH87613.1| succinyl-diaminopimelate desuccinylase [Escherichia sp. 3_2_53FAA]
 gi|227835860|gb|EEJ46326.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 83972]
 gi|294492438|gb|ADE91194.1| succinyl-diaminopimelate desuccinylase [Escherichia coli IHE3034]
 gi|300301674|gb|EFJ58059.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 185-1]
 gi|300408949|gb|EFJ92487.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 45-1]
 gi|307554503|gb|ADN47278.1| N-succinyl-diaminopimelate deacylase [Escherichia coli ABU 83972]
 gi|307625965|gb|ADN70269.1| succinyl-diaminopimelate desuccinylase [Escherichia coli UM146]
 gi|315288109|gb|EFU47509.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 110-3]
 gi|315292409|gb|EFU51761.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 153-1]
 gi|320196313|gb|EFW70937.1| N-succinyl-L,L-diaminopimelate desuccinylase [Escherichia coli
           WV_060327]
 gi|323188225|gb|EFZ73518.1| succinyl-diaminopimelate desuccinylase [Escherichia coli RN587/1]
 gi|323949496|gb|EGB45384.1| succinyl-diaminopimelate desuccinylase [Escherichia coli H252]
 gi|323955720|gb|EGB51478.1| succinyl-diaminopimelate desuccinylase [Escherichia coli H263]
 gi|324009164|gb|EGB78383.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 57-2]
          Length = 375

 Score =  245 bits (626), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 151/385 (39%), Positives = 221/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDFADTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P +++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFINELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|110642645|ref|YP_670375.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 536]
 gi|191172942|ref|ZP_03034477.1| succinyl-diaminopimelate desuccinylase [Escherichia coli F11]
 gi|300997927|ref|ZP_07181893.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 200-1]
 gi|123343760|sp|Q0TF05|DAPE_ECOL5 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|110344237|gb|ABG70474.1| succinyl-diaminopimelate desuccinylase [Escherichia coli 536]
 gi|190906806|gb|EDV66410.1| succinyl-diaminopimelate desuccinylase [Escherichia coli F11]
 gi|300304098|gb|EFJ58618.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 200-1]
 gi|324011183|gb|EGB80402.1| succinyl-diaminopimelate desuccinylase [Escherichia coli MS 60-1]
          Length = 375

 Score =  245 bits (626), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 152/385 (39%), Positives = 222/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDFADTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P +++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFINELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +KE++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKEQVLALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|225075372|ref|ZP_03718571.1| hypothetical protein NEIFLAOT_00377 [Neisseria flavescens
           NRL30031/H210]
 gi|224953292|gb|EEG34501.1| hypothetical protein NEIFLAOT_00377 [Neisseria flavescens
           NRL30031/H210]
          Length = 377

 Score =  245 bits (626), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 168/387 (43%), Positives = 224/387 (57%), Gaps = 14/387 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    LE    LI  PSVTP D     +L   L  +GF  EE  F        KN++ R
Sbjct: 1   MTETQSLELSKALISRPSVTPDDRDCQKLLAERLHKIGFVAEELHFGD-----TKNIWLR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+AP + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK  IACF+ A  R
Sbjct: 56  RGTKAPVVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTGIACFVTACER 115

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ ++  + GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD I
Sbjct: 116 FVAEHPDHQGSIALLITSDEEGDALDGTTKVVDVLKARSELIDYCIVGEPTAVDKLGDMI 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I
Sbjct: 176 KNGRRGSLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S 
Sbjct: 236 SNINGGTGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDK-----HGVQYDLQWSC 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTM 357
              P FLTH  KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+
Sbjct: 291 SGQP-FLTHAGKLTDVARAAIAETCGVETELSTTGGTSDGRFIKAIAKELIELGPSNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWF 384
           H +NEN  L+D+  L+ +YE  L+   
Sbjct: 350 HQINENVRLEDIPKLSAVYEGMLKRLL 376


>gi|283786095|ref|YP_003365960.1| succinyl-diaminopimelate desuccinylase [Citrobacter rodentium
           ICC168]
 gi|282949549|emb|CBG89165.1| succinyl-diaminopimelate desuccinylase [Citrobacter rodentium
           ICC168]
          Length = 375

 Score =  245 bits (626), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 149/385 (38%), Positives = 221/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRAIGFTVERMDFADTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVPAGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ +  G ++ LIT DEE  A +GT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPDHKGRLAFLITSDEEASAKDGTVKVVEALMARNERLDYCLVGEPSSTEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P+L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMLNELVGIEWDQGNAFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K+ + + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEIIKQRVHALLEK-----HQLRYTVEWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|218548095|ref|YP_002381886.1| succinyl-diaminopimelate desuccinylase [Escherichia fergusonii ATCC
           35469]
 gi|238064787|sp|B7LKH0|DAPE_ESCF3 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|218355636|emb|CAQ88248.1| N-succinyl-diaminopimelate deacylase [Escherichia fergusonii ATCC
           35469]
          Length = 375

 Score =  245 bits (626), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 152/385 (39%), Positives = 221/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIKRLQAIGFTVERMDFADTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVDALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|117923364|ref|YP_863981.1| succinyl-diaminopimelate desuccinylase [Magnetococcus sp. MC-1]
 gi|117607120|gb|ABK42575.1| succinyldiaminopimelate desuccinylase [Magnetococcus sp. MC-1]
          Length = 387

 Score =  245 bits (626), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 165/389 (42%), Positives = 235/389 (60%), Gaps = 18/389 (4%)

Query: 2   TPDCLE---HLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYA 58
           +P+ ++       LI+ PSVTP D G   +L+  L+ LGF++    F       V+N YA
Sbjct: 5   SPEMVDPVALARALIQAPSVTPMDHGCQDLLIRHLEDLGFTVHRLRF-----GHVENFYA 59

Query: 59  RFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
           R G++  +  FAGH DVV  GD + W+  PF+AT+ EG I GRG VDMKG +AC +AA A
Sbjct: 60  RLGSKGRNFTFAGHTDVVGAGDTSRWSSDPFAATLEEGYITGRGAVDMKGGLACMVAATA 119

Query: 119 RFIPKYKNF---GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIG 175
           RF+    +F    S+S LITGDEEG A++GT K+L W+E + EK D C+VGEPT    +G
Sbjct: 120 RFLAARPHFAQQHSLSFLITGDEEGDALDGTLKVLQWLESQQEKMDYCLVGEPTSAAQLG 179

Query: 176 DTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTN 235
           D IK GRRGS++G +TI G QGHVAYPHL +NPI    P+L  ++++ FD G+  F PT+
Sbjct: 180 DCIKNGRRGSVNGRLTIRGVQGHVAYPHLVDNPIHRAAPVLAAISSMTFDQGDRFFQPTS 239

Query: 236 MEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVH 295
           ++ T +  G  + NV+P ++   FNIRF+ +   ++L+  IR  L     +  ++ + + 
Sbjct: 240 LQFTAVQSGGSATNVVPGELTAGFNIRFSAMHTPESLEARIRQVL-----DGAEVDYDLQ 294

Query: 296 FSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVG 354
             +   P F+T    L   +  ++   TG  P LST GGTSDARFI  +C   +EFGLVG
Sbjct: 295 MMTSGLP-FITEGGPLVEAVKATVAQVTGLEPQLSTGGGTSDARFISRHCVQTVEFGLVG 353

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNW 383
            TMH ++E   + DLE LT +Y   L+  
Sbjct: 354 STMHKVDERVPVADLEVLTEVYRRLLERL 382


>gi|331648128|ref|ZP_08349218.1| succinyl-diaminopimelate desuccinylase [Escherichia coli M605]
 gi|331658621|ref|ZP_08359565.1| succinyl-diaminopimelate desuccinylase [Escherichia coli TA206]
 gi|222034191|emb|CAP76932.1| Succinyl-diaminopimelate desuccinylase [Escherichia coli LF82]
 gi|281179534|dbj|BAI55864.1| succinyl-diaminopimelate desuccinylase [Escherichia coli SE15]
 gi|312947056|gb|ADR27883.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O83:H1
           str. NRG 857C]
 gi|330912253|gb|EGH40763.1| N-succinyl-L,L-diaminopimelate desuccinylase [Escherichia coli
           AA86]
 gi|331042988|gb|EGI15128.1| succinyl-diaminopimelate desuccinylase [Escherichia coli M605]
 gi|331054286|gb|EGI26313.1| succinyl-diaminopimelate desuccinylase [Escherichia coli TA206]
          Length = 375

 Score =  245 bits (626), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 151/385 (39%), Positives = 221/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDFADTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P +++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFINELVAIEWDQGNDFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|212635492|ref|YP_002312017.1| succinyl-diaminopimelate desuccinylase [Shewanella piezotolerans
           WP3]
 gi|238055222|sp|B8CMP0|DAPE_SHEPW RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|212556976|gb|ACJ29430.1| Proteobacterial succinyl-diaminopimelate desuccinylase [Shewanella
           piezotolerans WP3]
          Length = 381

 Score =  245 bits (626), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 157/382 (41%), Positives = 216/382 (56%), Gaps = 13/382 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L     LI  PSVTP D G   ++ + LK  GF+IE+  F+        N++AR GT++
Sbjct: 9   VLALAKDLISRPSVTPLDEGCQTLMADRLKDAGFNIEDMVFED-----TTNMWARKGTQS 63

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P   FAGH DVVP GD N W  PPF   + +  ++GRG  DMKGS+A  + A  RF+ K+
Sbjct: 64  PVFCFAGHTDVVPVGDLNRWHTPPFEPVVIDDYLHGRGAADMKGSLAAMVVATERFVKKH 123

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
            +  GSI+ LIT DEEGP INGT +++  +E + EK    +VGEP+  H +GD +K GRR
Sbjct: 124 PDHKGSIAFLITSDEEGPFINGTTRVIDTLEARNEKITWSLVGEPSSTHKLGDIVKNGRR 183

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL+G +T+ G QGHVAYPHL +NPI    P L +L  + +D GN  F PT+ +I  I+ 
Sbjct: 184 GSLTGNLTVKGMQGHVAYPHLADNPIHKASPALDELARMKWDNGNEFFPPTSFQIANING 243

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NVIP  +++ FN R++     + L E + + L     +   L + +++     P 
Sbjct: 244 GTGASNVIPGTLEVMFNFRYSTEVTAEILIERVLNIL-----DAHGLDYDINWIFNGLP- 297

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
           FLT D  L      +I   TG      TSGGTSD RFI      V+E G V  T+H +NE
Sbjct: 298 FLTGDGPLLDATRDAIKKVTGLDTDPQTSGGTSDGRFIAPTGAHVLELGPVNATIHKVNE 357

Query: 363 NASLQDLEDLTCIYENFLQNWF 384
              + DLE LT  YE  L+N  
Sbjct: 358 CVKVSDLEQLTLCYEAILENLL 379


>gi|170719109|ref|YP_001784259.1| succinyl-diaminopimelate desuccinylase [Haemophilus somnus 2336]
 gi|238064750|sp|B0UT10|DAPE_HAES2 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|168827238|gb|ACA32609.1| succinyl-diaminopimelate desuccinylase [Haemophilus somnus 2336]
          Length = 377

 Score =  245 bits (626), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 149/386 (38%), Positives = 215/386 (55%), Gaps = 14/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  + +     LI+ PS++P D G   ++   L+ +GF +E   F         NL+A  
Sbjct: 1   MKNNIITLTQSLIQRPSISPDDQGCQQLIAERLQAVGFKLEWLPFGD-----TLNLWATH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     + FAGH DVVP G+ + WTYPPF A I E  +YGRG  DMKG++A  + A   F
Sbjct: 56  GE-GKCIAFAGHTDVVPIGNESQWTYPPFEARIVENMLYGRGAADMKGALAAMVIAAETF 114

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +     + G I+LLIT DEE  A NGT K++  + K+ EK D C+VGEP+     GD IK
Sbjct: 115 VKHLPNHQGKIALLITSDEEAAATNGTVKVVETLIKRNEKIDYCVVGEPSSATQFGDIIK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++G + I G QGHVAYPHL +NP+   +  L +LT+  +D GN  F PT+++I 
Sbjct: 175 NGRRGSITGNLYIQGVQGHVAYPHLADNPVHNALKFLDELTHYQWDKGNEFFPPTSLQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN+R+     ++ +K ++   L K      KL++ + ++  
Sbjct: 235 NIHAGTGSNNVIPGELYVQFNLRYCTEVTDEIIKTKVAEMLEK-----HKLTYRIDWNLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P  LT   KL +   +++   T   P L T GGTSDARFI      V+EFG + +T+H
Sbjct: 290 GKPF-LTPQGKLVNATIEAVKKFTQIRPHLDTGGGTSDARFIATMGAEVVEFGPLNQTIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            +NE  ++ DL     IY   L+  F
Sbjct: 349 KVNECVNIDDLAKCGEIYYYILEKLF 374


>gi|194432072|ref|ZP_03064361.1| succinyl-diaminopimelate desuccinylase [Shigella dysenteriae 1012]
 gi|194419601|gb|EDX35681.1| succinyl-diaminopimelate desuccinylase [Shigella dysenteriae 1012]
 gi|332089688|gb|EGI94789.1| succinyl-diaminopimelate desuccinylase [Shigella dysenteriae
           155-74]
          Length = 375

 Score =  245 bits (626), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 152/385 (39%), Positives = 220/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+  GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAFGFTVERMDFADTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|254477341|ref|ZP_05090727.1| succinyl-diaminopimelate desuccinylase [Ruegeria sp. R11]
 gi|214031584|gb|EEB72419.1| succinyl-diaminopimelate desuccinylase [Ruegeria sp. R11]
          Length = 389

 Score =  245 bits (626), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 156/382 (40%), Positives = 213/382 (55%), Gaps = 9/382 (2%)

Query: 7   EHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA-- 64
           +    LI+C SVTP++GGA  +L   L   GF     D        V NL AR+G +A  
Sbjct: 14  QLTADLIRCASVTPEEGGALVLLEKLLSEAGFECSRAD-----RGEVSNLIARWGDKAHP 68

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
             + F GH DVVP GD   WT  PF A   +G +YGRG  DMK  +A F+AA   ++   
Sbjct: 69  KTMGFNGHTDVVPIGDAAAWTVDPFGAEEKDGFMYGRGATDMKSGVAAFVAAAVDYVRTT 128

Query: 125 KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
              G++ + ITGDEEG AI+GT  +L  +  +GE+   C+VGEPTC + +G+ IKIGRRG
Sbjct: 129 PPEGAVLITITGDEEGDAIDGTTAILDQMAAEGERMSVCLVGEPTCPNEMGEMIKIGRRG 188

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLS   T+ G QGH AYPH   NP+  +  L+ +L +   D G   F  + + + TID G
Sbjct: 189 SLSAWFTVTGVQGHSAYPHRANNPLNAMARLMDRLASHELDQGTEHFDASTLAVVTIDTG 248

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
           NP+ NVIPAQ + + NIRFND      L   +R+   K  +            S     F
Sbjct: 249 NPATNVIPAQARSTVNIRFNDAHTGADLSAWLRAEADKVAEAFGVTIDMTVKISG--ESF 306

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENA 364
           +T    L+ L+  ++   TG +P LST+GGTSDARFIK +CPV+E GLVG+TMH ++E  
Sbjct: 307 ITPPGALSDLVGAAVKAETGRMPELSTTGGTSDARFIKSHCPVVEIGLVGKTMHQVDERV 366

Query: 365 SLQDLEDLTCIYENFLQNWFIT 386
            +  +  L  IY   L ++F  
Sbjct: 367 DIDQIHQLKAIYSRILNDYFTA 388


>gi|313200715|ref|YP_004039373.1| succinyl-diaminopimelate desuccinylase [Methylovorus sp. MP688]
 gi|312440031|gb|ADQ84137.1| succinyl-diaminopimelate desuccinylase [Methylovorus sp. MP688]
          Length = 375

 Score =  245 bits (625), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 158/382 (41%), Positives = 224/382 (58%), Gaps = 13/382 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L+    LI   SVTP+D G   +L++ L+ LGF IE   F       V N +AR GT +
Sbjct: 4   TLDLAQDLIARRSVTPEDLGCQELLISRLEPLGFKIERMRFGD-----VDNFFARRGTAS 58

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P L+FAGH DVVP G  + W  PPF  TI +G +YGRG  DMK S+A FI ++  F+ ++
Sbjct: 59  PLLVFAGHTDVVPTGPVDQWHTPPFEPTIKDGMLYGRGAADMKTSLAAFITSIEEFVARH 118

Query: 125 K-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
             + GSI LLIT DEEG A +GT K++  ++ +GE  D CIVGEPT + ++GD IK GRR
Sbjct: 119 PDHQGSIGLLITSDEEGIATHGTVKVVEALKARGELIDYCIVGEPTSSKVVGDMIKNGRR 178

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSLSG++ + G QGH+AYPHL +NPI  + P + +L +  +D+GN  F PT+ +I+ ++ 
Sbjct: 179 GSLSGKLVVKGVQGHIAYPHLVKNPIHLVAPAIKELADTVWDSGNEYFPPTSWQISNMNG 238

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NV+P +V + FN RF+     + L+E + + L K         + + +     P 
Sbjct: 239 GTGATNVVPGEVTIQFNFRFSTASTAEGLREGVHAILDKHALE-----YDLQWELSGKP- 292

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
           FLT    L   +S +I    G  P LSTSGGTSD RFI D    ++EFG +  T+H LNE
Sbjct: 293 FLTPKGTLVEAISAAIETAFGVTPELSTSGGTSDGRFIADIASQIVEFGPLNATIHKLNE 352

Query: 363 NASLQDLEDLTCIYENFLQNWF 384
              + D+E L   Y   ++   
Sbjct: 353 CVGVADIEPLKDAYRLTMETLL 374


>gi|238064832|sp|A0L3N2|DAPE_MAGSM RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 380

 Score =  245 bits (625), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 165/384 (42%), Positives = 232/384 (60%), Gaps = 15/384 (3%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +     LI+ PSVTP D G   +L+  L+ LGF++    F       V+N YAR G++
Sbjct: 3   DPVALARALIQAPSVTPMDHGCQDLLIRHLEDLGFTVHRLRF-----GHVENFYARLGSK 57

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
             +  FAGH DVV  GD + W+  PF+AT+ EG I GRG VDMKG +AC +AA ARF+  
Sbjct: 58  GRNFTFAGHTDVVGAGDTSRWSSDPFAATLEEGYITGRGAVDMKGGLACMVAATARFLAA 117

Query: 124 YKNF---GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
             +F    S+S LITGDEEG A++GT K+L W+E + EK D C+VGEPT    +GD IK 
Sbjct: 118 RPHFAQQHSLSFLITGDEEGDALDGTLKVLQWLESQQEKMDYCLVGEPTSAAQLGDCIKN 177

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGS++G +TI G QGHVAYPHL +NPI    P+L  ++++ FD G+  F PT+++ T 
Sbjct: 178 GRRGSVNGRLTIRGVQGHVAYPHLVDNPIHRAAPVLAAISSMTFDQGDRFFQPTSLQFTA 237

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV 300
           +  G  + NV+P ++   FNIRF+ +   ++L+  IR  L     +  ++ + +   +  
Sbjct: 238 VQSGGSATNVVPGELTAGFNIRFSAMHTPESLEARIRQVL-----DGAEVDYDLQMMTSG 292

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHA 359
            P F+T    L   +  ++   TG  P LST GGTSDARFI  +C   +EFGLVG TMH 
Sbjct: 293 LP-FITEGGPLVEAVKATVAQVTGLEPQLSTGGGTSDARFISRHCVQTVEFGLVGSTMHK 351

Query: 360 LNENASLQDLEDLTCIYENFLQNW 383
           ++E   + DLE LT +Y   L+  
Sbjct: 352 VDERVPVADLEVLTEVYRRLLERL 375


>gi|110677593|ref|YP_680600.1| succinyl-diaminopimelate desuccinylase [Roseobacter denitrificans
           OCh 114]
 gi|123362399|sp|Q16DM9|DAPE_ROSDO RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|109453709|gb|ABG29914.1| putative succinyl-diaminopimelate desuccinylase [Roseobacter
           denitrificans OCh 114]
          Length = 381

 Score =  245 bits (625), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 162/384 (42%), Positives = 226/384 (58%), Gaps = 9/384 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +     L++C SVTP D GA  IL + L   GF     D        ++NL+AR+G +
Sbjct: 5   DPVRLTADLVRCASVTPADEGALDILHDVLSDAGFDCAWAD-----RGGIRNLFARWGRK 59

Query: 64  A--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
                  F GH DVVP G+ + W+ PPF A + +G +YGRG  DMK  +A F AA   F+
Sbjct: 60  GHPKTFGFNGHTDVVPIGNADDWSMPPFGAEVKDGIMYGRGTTDMKSGVAAFAAAAVDFV 119

Query: 122 PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
                 G+I L ITGDEEG A +GT  +L+++  +GE+  AC+VGEPTC   +G+ IKIG
Sbjct: 120 RDTPPDGAIVLAITGDEEGDATDGTTALLAYMAAQGEQMSACLVGEPTCPDRMGEMIKIG 179

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGS++  IT  GKQGH AYPH   NP+  L+ L+ +L +   D G   F P+ + I T+
Sbjct: 180 RRGSMTAWITFIGKQGHAAYPHRACNPLPALMRLMDRLASHKLDEGTEFFDPSTLAIVTV 239

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
           D GNP+ NVIPA    + NIRFND  +  +L E I++ L +               S   
Sbjct: 240 DTGNPATNVIPASCSGTVNIRFNDAHSGASLTEWIKTELSRIEGEFGVQIDLRIKISG-- 297

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALN 361
             FLT    L++L+SK++   TG  P+LST+GGTSDARF+KD+CPV+EFGLVG++MH ++
Sbjct: 298 ESFLTPPGPLSALVSKAVKAQTGIEPVLSTTGGTSDARFVKDHCPVVEFGLVGQSMHQVD 357

Query: 362 ENASLQDLEDLTCIYENFLQNWFI 385
           E+     + +L  IY   L ++F 
Sbjct: 358 EHVKTDHIVELKAIYSRILTDYFA 381


>gi|83647924|ref|YP_436359.1| succinyl-diaminopimelate desuccinylase [Hahella chejuensis KCTC
           2396]
 gi|123531335|sp|Q2SBP0|DAPE_HAHCH RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|83635967|gb|ABC31934.1| succinyl-diaminopimelate desuccinylase [Hahella chejuensis KCTC
           2396]
          Length = 383

 Score =  245 bits (625), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 159/394 (40%), Positives = 228/394 (57%), Gaps = 16/394 (4%)

Query: 1   MTPDC---LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLY 57
           MT      LE  ++LIK PSVTP D G   +L   L+ +GF I +  F       V+N +
Sbjct: 1   MTDSLSPTLELAVELIKRPSVTPHDAGCQELLSQRLQTIGFEITDLPFGE-----VQNFW 55

Query: 58  ARFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAV 117
           AR G++AP ++FAGH DVVP G    W +PPF+A + +G ++GRG  DMKGS+A F+ A 
Sbjct: 56  ARRGSQAPLVVFAGHTDVVPTGPEEKWEHPPFAAEVKDGVLHGRGAADMKGSLAAFMTAC 115

Query: 118 ARFIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGD 176
            RF+ K+ N  GSI  LIT DEEG A+NGT K++ ++  KGE  D CIVGEP+  H +GD
Sbjct: 116 ERFVKKHPNHRGSIGWLITSDEEGHAVNGTVKVVEYLVDKGEVIDWCIVGEPSSTHTVGD 175

Query: 177 TIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNM 236
            IK GRRGS+   + + G QGHVAYPHL +NPI    P L +L N  +D GN  F  T++
Sbjct: 176 VIKNGRRGSIGATLIVKGVQGHVAYPHLADNPIHKAAPALAELANEKWDEGNAFFPATSL 235

Query: 237 EITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHF 296
           +I+ I+ G  + NVIP ++ + FN+RF+   N   +K+   + L K   +     + + +
Sbjct: 236 QISNINGGTGATNVIPGELNIMFNLRFSTELNADVIKQRSEAILQKHGLD-----YDIEW 290

Query: 297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGR 355
                P   +    L     K+I +  G+   LSTSGGTSD RFI      V+E G    
Sbjct: 291 RLYGEPFLTSK-GPLIEATQKAIKHVRGSDTTLSTSGGTSDGRFIAPTGAQVVELGPCNA 349

Query: 356 TMHALNENASLQDLEDLTCIYENFLQNWFITPSQ 389
           T+H +NE   + +++ L+ IYE+ L+   +  S+
Sbjct: 350 TIHRINEQVLVSEIDQLSSIYEHILEELLVVGSE 383


>gi|119898298|ref|YP_933511.1| succinyl-diaminopimelate desuccinylase [Azoarcus sp. BH72]
 gi|238055169|sp|A1K719|DAPE_AZOSB RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|119670711|emb|CAL94624.1| succinyl-diaminopimelate desuccinylase [Azoarcus sp. BH72]
          Length = 380

 Score =  245 bits (625), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 156/384 (40%), Positives = 211/384 (54%), Gaps = 13/384 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L    +LI   SVTP+D G   ++   L  LGF  E  D        V NL+AR G+  
Sbjct: 8   TLALACELISRSSVTPEDAGCLQLIAQRLAPLGFVCERIDI-----GGVSNLWARRGSAR 62

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P L FAGH DVVP G  + W  PPF  TI +G +YGRG  DMK S+A F+ A+ RF+  +
Sbjct: 63  PLLCFAGHTDVVPTGPLDAWQSPPFEPTIRDGHLYGRGAADMKSSLAGFVTAIERFVAAH 122

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
            +  GSI+LL+T DEEG A  GT K++  +  +GE+ D C+VGEPT    +GD IK GRR
Sbjct: 123 PDHAGSIALLLTSDEEGVATCGTVKVVEALAARGERLDYCVVGEPTSVKTLGDMIKNGRR 182

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSLSG + + G+QGHVAYPHL  NPI  L P L +L    +D GN  F PT  +++ I  
Sbjct: 183 GSLSGTLRVKGRQGHVAYPHLARNPIHELAPALAELAAERWDDGNEFFPPTTWQVSNIHA 242

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NVIP    + FN RF  +     LK    + L +   +     + + +     P 
Sbjct: 243 GTGANNVIPGVCDVLFNFRFGSVSTADALKARTHAILDRHGLD-----YELDWHLSGKPF 297

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
                 +L + L  +I  T G    LST+GGTSD RFI D C  V+EFG V  ++H +NE
Sbjct: 298 ITG-RGQLVAALGNAIRETVGVETELSTTGGTSDGRFIADICAEVVEFGPVNASIHQVNE 356

Query: 363 NASLQDLEDLTCIYENFLQNWFIT 386
           + ++  +E L+ IYE  L+     
Sbjct: 357 HIAVDAVEPLSKIYERTLRALLTA 380


>gi|269103219|ref|ZP_06155916.1| N-succinyl-L,L-diaminopimelate desuccinylase [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268163117|gb|EEZ41613.1| N-succinyl-L,L-diaminopimelate desuccinylase [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 377

 Score =  245 bits (625), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 158/379 (41%), Positives = 224/379 (59%), Gaps = 13/379 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            +     L+   SVTP+D G   +++  L+ LGF IE   F     +   NL+AR GT+A
Sbjct: 6   VISLAKDLLSRRSVTPEDAGCQDVMIERLRQLGFCIETMVF-----NDTTNLWARRGTQA 60

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P  +FAGH DVVP G    W  PPF  TI +G +YGRG  DMKGS+AC I A+ RFI + 
Sbjct: 61  PLFVFAGHTDVVPSGPIEQWHTPPFEPTIKDGMLYGRGAADMKGSLACMIVAIERFIAEN 120

Query: 125 K-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
             + GSI LLIT DEEGP INGT +++  +E + EK D CIVGEP+   ++GD +K GRR
Sbjct: 121 PDHQGSIGLLITSDEEGPFINGTTRVVDTLEARNEKIDLCIVGEPSSTLVVGDVVKNGRR 180

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++G++T+ G QGHVAYPHL +NP+   +P L +L    +D GN  F PT+ +I  I+ 
Sbjct: 181 GSITGDLTVKGIQGHVAYPHLADNPVHRALPALAELAAKTWDNGNDYFPPTSFQIPNINA 240

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NV+P + ++ FN RF+    ++ +K ++   L +   +     + ++++    P 
Sbjct: 241 GTGASNVVPGECQVQFNFRFSTELTDEAIKAQVHEILDQHQLD-----YHLNWTLSGHP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
           FLT    L   +  +I       P LSTSGGTSD RFI      VIE G V  T+H +NE
Sbjct: 295 FLTEKGTLVDAVVAAIEEVAHITPELSTSGGTSDGRFIARTGAQVIELGPVNATIHKVNE 354

Query: 363 NASLQDLEDLTCIYENFLQ 381
              ++DLE LT +Y+  L+
Sbjct: 355 CVKIEDLELLTDMYQKVLE 373


>gi|85711706|ref|ZP_01042763.1| succinyl-diaminopimelate desuccinylase [Idiomarina baltica OS145]
 gi|85694566|gb|EAQ32507.1| succinyl-diaminopimelate desuccinylase [Idiomarina baltica OS145]
          Length = 377

 Score =  245 bits (625), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 156/385 (40%), Positives = 215/385 (55%), Gaps = 14/385 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           M+  + L+    L++ PS+TP D G   +L + LK LGF +E   F+        NL+AR
Sbjct: 1   MSNSETLQLAKTLLERPSITPADEGCQQVLGDRLKSLGFELESMIFED-----TTNLWAR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            G   P L FAGH DVVPPGD + W++PPF  T  EG +YGRG  DMKGS+A  I AV R
Sbjct: 56  LGQGKPVLCFAGHTDVVPPGDPSDWSFPPFQPTEHEGYLYGRGAADMKGSLAAMIVAVER 115

Query: 120 FIPKYKNFGS-ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           ++ +       I+ LIT DEEGP INGTK+++  +E + EK   CIVGEP+    +GD +
Sbjct: 116 YLKQVDEPPFDIAFLITSDEEGPFINGTKRVMETLESRNEKITWCIVGEPSSTEQLGDVV 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG +++ G QGHVAYPHL ENP+      L +LT   +D GN  F PT  ++
Sbjct: 176 KNGRRGSLSGSLSVIGVQGHVAYPHLAENPVHSAANALAELTQTRWDDGNEFFPPTTFQV 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I  G  + NVIP ++ + FN RF+       L++ + + L     N            
Sbjct: 236 SNIHAGTGAGNVIPGRLDIEFNFRFSTESTSTQLQQRVETILDAHNLNYQLNWKL----- 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTM 357
              P FLT    L + +  +I    G    LST+GGTSD RFI      +IE G V  T+
Sbjct: 291 -NGPAFLTAQGLLINKVQCAIKRVCGYPTKLSTAGGTSDGRFIAPTGAELIELGPVNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQN 382
           H ++E   + DL+ LT +Y+  L+ 
Sbjct: 350 HKVDECVKITDLDTLTDVYQAILEE 374


>gi|89067294|ref|ZP_01154807.1| succinyl-diaminopimelate desuccinylase [Oceanicola granulosus
           HTCC2516]
 gi|89046863|gb|EAR52917.1| succinyl-diaminopimelate desuccinylase [Oceanicola granulosus
           HTCC2516]
          Length = 382

 Score =  245 bits (625), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 157/383 (40%), Positives = 220/383 (57%), Gaps = 9/383 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +     L++CPSVTP++GGA  +L   L   GF+    D      +   NL+AR+G +
Sbjct: 6   DPVALTAALVRCPSVTPEEGGALVLLEELLSAAGFACTRVD-----RNGTPNLFARWGEK 60

Query: 64  A--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
                  F GH DVVP GD   W   PF   I++G ++GRG VDMK  +A F AA A F+
Sbjct: 61  GAAKSFGFNGHTDVVPVGDHAAWRVDPFGGEISDGILWGRGAVDMKSGVAAFAAAAADFV 120

Query: 122 PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
                 G+I L ITGDEEG + +GT  +L W+ + GE    C+VGEPTC   +G+ IKIG
Sbjct: 121 RDTPPDGAILLAITGDEEGGSADGTVALLDWMARAGEAMSVCLVGEPTCPETMGEMIKIG 180

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSLS  +T+ G QGH AYPH  +NP+  +  L+ +L +   D G   F P+ + + TI
Sbjct: 181 RRGSLSAFVTVTGVQGHSAYPHRAKNPLPAMARLMDRLASAALDDGTAHFDPSTLAVVTI 240

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
           D GN + NVIPA+ + + NIRFND  +  +L   + +      +        V   S   
Sbjct: 241 DTGNGATNVIPARSRATVNIRFNDRHSGDSLTAWLEAEAADVAEAFDVAIDVVVKVSG-- 298

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALN 361
             FLT    L+ L++ ++   TG  P+LST+GGTSDARF+KD+CPV+EFGLVG+TMH ++
Sbjct: 299 EAFLTPPGALSDLVAGAVAAETGVTPVLSTTGGTSDARFVKDHCPVVEFGLVGQTMHEVD 358

Query: 362 ENASLQDLEDLTCIYENFLQNWF 384
           E   +  +  L  IY   L ++F
Sbjct: 359 ERVPVAQIGQLKGIYRRILADYF 381


>gi|260776510|ref|ZP_05885405.1| N-succinyl-L,L-diaminopimelate desuccinylase [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260607733|gb|EEX33998.1| N-succinyl-L,L-diaminopimelate desuccinylase [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 377

 Score =  245 bits (625), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 151/388 (38%), Positives = 214/388 (55%), Gaps = 14/388 (3%)

Query: 1   MTPD-CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    L     LI   SVTP D G   +++  LK LGF IE   F+        N +AR
Sbjct: 1   MTDSPTLALAKDLISRQSVTPVDAGCQDVMIERLKALGFEIEVMVFED-----TTNFWAR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GTEAP   FAGH DVVP G+   W  PPF  T+ +G ++GRG  DMKGS+A  I AV +
Sbjct: 56  RGTEAPLFAFAGHTDVVPAGNVELWDTPPFEPTMVDGYLHGRGAADMKGSLASMIVAVEQ 115

Query: 120 FIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           FI ++ +  GSI  LIT DEEGP INGT +++  +  + E  D CIVGEP+   ++GD +
Sbjct: 116 FIAEHPDHKGSIGFLITSDEEGPFINGTVRVVETLMARDENIDMCIVGEPSSTELVGDVV 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGS++G++T+ G QGHVAYPHL +NP+   +  +H+L +  +D GN  F PT+ +I
Sbjct: 176 KNGRRGSITGDLTVKGVQGHVAYPHLAKNPVHQSLMAIHELASTEWDKGNDYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
             +  G  + NVIP +  + FN+RF+   N   + + +   L K   +     + + ++ 
Sbjct: 236 PNVHAGTGASNVIPGEFNVQFNLRFSTELNNDIIVKRVTDTLDKHDLD-----YELKWTF 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTM 357
              P        L   +  ++       P L T+GGTSD RFI      V+E G V  T+
Sbjct: 291 NGDPFLTD-TGALLDAVVDAVDTVNQTKPALLTTGGTSDGRFIARMGGQVVELGPVNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H +NE   + DLE LT +Y+  L+N   
Sbjct: 350 HKVNECVKVDDLEKLTKMYQKTLENLLA 377


>gi|262276456|ref|ZP_06054265.1| N-succinyl-L,L-diaminopimelate desuccinylase [Grimontia hollisae
           CIP 101886]
 gi|262220264|gb|EEY71580.1| N-succinyl-L,L-diaminopimelate desuccinylase [Grimontia hollisae
           CIP 101886]
          Length = 378

 Score =  245 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 151/388 (38%), Positives = 221/388 (56%), Gaps = 14/388 (3%)

Query: 1   MTPDCL-EHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT   +     +LI  PSVTP D G   +++  L+ LGF+IE   F+        NL+AR
Sbjct: 1   MTDSAVLSLAKELIGRPSVTPDDAGCQELMIKRLEALGFTIERMVFED-----TTNLWAR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GTEAP   FAGH DVVP G  + W  PPF  T+ +G ++GRG  DMKGS+A  + A  R
Sbjct: 56  RGTEAPLFAFAGHTDVVPAGPEDQWHTPPFEPTVIDGYLHGRGAADMKGSLAAMVVATER 115

Query: 120 FIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           FI ++ +  GS++ LIT DEEGP INGT +++  +  + E  D CIVGEP+  H +GD +
Sbjct: 116 FIAEHPDHKGSLAFLITSDEEGPFINGTTRVVDTLMARDELIDMCIVGEPSSTHAVGDVV 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGS++G++T+ G QGHVAYPHL  NP+   +P L +LT + +D GN  F PT+ +I
Sbjct: 176 KNGRRGSITGDLTVKGIQGHVAYPHLANNPVHQALPALAELTAMQWDQGNEYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
             +  G  + NVIP +  + FN+R++    ++ ++    S L     +   L + + ++ 
Sbjct: 236 PNVAAGTGASNVIPGEFHVQFNLRYSTELTDEDIQRRTHSVL-----DAHGLDYDIKWTF 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTM 357
              P        L   + +++ +     P L T+GGTSD RFI      VIE G V  T+
Sbjct: 291 NGKPFLTDAGS-LLDAVVEAVDDVNHEKPQLLTTGGTSDGRFIAQMGGQVIELGPVNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H +NE  ++ DLE LT +Y+  L+    
Sbjct: 350 HKVNECVNVADLEKLTDMYQKVLEKILA 377


>gi|157144596|ref|YP_001451915.1| succinyl-diaminopimelate desuccinylase [Citrobacter koseri ATCC
           BAA-895]
 gi|238064719|sp|A8ADB6|DAPE_CITK8 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|157081801|gb|ABV11479.1| hypothetical protein CKO_00316 [Citrobacter koseri ATCC BAA-895]
          Length = 375

 Score =  245 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 154/385 (40%), Positives = 222/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRAIGFTVEHMDFGDTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++  + G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   I+GD +K
Sbjct: 115 VAQHPDHQGRLAFLITSDEEASAKNGTVKVVETLMARNERLDYCLVGEPSSTEIVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P+L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++TLKE + + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFIQFNFRFSTELTDETLKERVHALLDK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|218768512|ref|YP_002343024.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           Z2491]
 gi|238064801|sp|A1ISU7|DAPE_NEIMA RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|121052520|emb|CAM08859.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           Z2491]
          Length = 381

 Score =  245 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 169/391 (43%), Positives = 225/391 (57%), Gaps = 14/391 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    LE    LI  PSVTP D     +LV  L  +GF+ EE  F        KN++ R
Sbjct: 1   MTETQSLELAKALISRPSVTPDDRDCQKLLVERLYKIGFAAEELHFGD-----TKNIWLR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+ P + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK SIACF+ A  R
Sbjct: 56  RGTKVPVVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTSIACFVTACER 115

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ ++  + GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GD I
Sbjct: 116 FVAEHPDHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVDKLGDMI 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I
Sbjct: 176 KNGRRGSLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNKYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S 
Sbjct: 236 SNINGGTGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDK-----HGVQYDLQWSC 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTM 357
              P FLT   KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+
Sbjct: 291 SGQP-FLTQAGKLTDVARAAIAETCGIEAELSTTGGTSDGRFIKAIAKELIELGPSNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFITPS 388
           H +NEN  L D+  L+ +YE  L       +
Sbjct: 350 HQINENVRLDDIPKLSAVYEGILARLLAGNA 380


>gi|330830409|ref|YP_004393361.1| succinyl-diaminopimelate desuccinylase 1 [Aeromonas veronii B565]
 gi|328805545|gb|AEB50744.1| Succinyl-diaminopimelate desuccinylase 1 [Aeromonas veronii B565]
          Length = 375

 Score =  245 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 150/385 (38%), Positives = 212/385 (55%), Gaps = 13/385 (3%)

Query: 3   PDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT 62
            D +     LI+ PSVTP D G   ++   L  +GF IE   F+        NL+AR G+
Sbjct: 2   SDVIALAKDLIRRPSVTPLDEGCQTLMAERLARIGFVIEPMVFED-----TTNLWARRGS 56

Query: 63  EAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIP 122
           E P   FAGH DVVP G  + W  PPF  TI +G +YGRG  DMKGS+A  + AV RF+ 
Sbjct: 57  EGPLFCFAGHTDVVPAGPLDKWHTPPFEPTIKDGVLYGRGAADMKGSLASMVVAVERFVA 116

Query: 123 KYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
           ++ +  GSI+ LIT DEEGP INGT +++  +E + EK   CIVGEP+   ++GD +K G
Sbjct: 117 EHPDHTGSIAFLITSDEEGPFINGTTRVIDTLEARNEKIRWCIVGEPSSTAVVGDVVKNG 176

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGS++G++ + G QGHVAYPHL +NPI    P L +L    +D GN  F PT+ +I  I
Sbjct: 177 RRGSITGDLLVRGVQGHVAYPHLADNPIHKAAPALAELAATVWDEGNAYFPPTSFQIANI 236

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
             G  + NVIP ++++ FN RF+    +  ++E + + L +   +     + + ++    
Sbjct: 237 QAGTGASNVIPGELQVQFNFRFSTKLTDMDIRERVEALLDRHGLD-----YQLSWTLSGQ 291

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHAL 360
           P        L      +I    G  P L T+GGTSD RFI      VIE G V  T+H +
Sbjct: 292 PFLTD-TGALLDAAVAAIEAVNGQRPALLTTGGTSDGRFIAPTGAEVIELGPVNATIHKV 350

Query: 361 NENASLQDLEDLTCIYENFLQNWFI 385
           NE     DL+ L  +Y+  L+    
Sbjct: 351 NECVKADDLDLLADMYQGVLERLLA 375


>gi|254361224|ref|ZP_04977368.1| asparaginase [Mannheimia haemolytica PHL213]
 gi|153092715|gb|EDN73764.1| asparaginase [Mannheimia haemolytica PHL213]
          Length = 382

 Score =  245 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 146/392 (37%), Positives = 211/392 (53%), Gaps = 17/392 (4%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  + +     LI+  S++PQD G    +   L+ LGF+IE   F         NL+A  
Sbjct: 1   MKNEIISLAQNLIRRDSISPQDKGCQQEIAQRLEKLGFNIEWLPFGD-----TLNLWATH 55

Query: 61  GTE----APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAA 116
           G+E     P ++FAGH DVVP GD + W YPPFSA I +G +YGRG  DMKGS++  + A
Sbjct: 56  GSENGKTEPCIVFAGHTDVVPVGDESQWAYPPFSAEIVDGMLYGRGAADMKGSLSALVVA 115

Query: 117 VARFIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIG 175
              F+  + N  G ++LLIT DEE  A +GT K++  +  + E     +VGEP+ + + G
Sbjct: 116 AETFVQHHPNHKGKVALLITSDEEAAAKDGTVKVVETLMARNEAVHYAVVGEPSSSKVFG 175

Query: 176 DTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTN 235
           D IK GRRGS++ ++ I G QGHVAYPHL ENP+   +  L +LT   +D GN  F PT+
Sbjct: 176 DVIKNGRRGSITADLYIEGIQGHVAYPHLAENPVHTSLGFLTELTTYQWDNGNEFFPPTS 235

Query: 236 MEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVH 295
           ++I  I  G  S NVIP ++ + FN+R+     ++ +K ++   L K         + + 
Sbjct: 236 LQIANIKAGTGSNNVIPGELYVQFNLRYCTEVTDEIIKAKVAEMLEKHGLK-----YRIS 290

Query: 296 FSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVG 354
           ++    P    +  KL     +++ N T   P L T GGTSD RFI      V+EFG + 
Sbjct: 291 WNLSGKPFLAGN-GKLVEAALQAVENVTKITPRLDTGGGTSDGRFIALMGAEVVEFGPLN 349

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNWFIT 386
            T+H +NE  S  DL     IY   L+    T
Sbjct: 350 ATIHKVNECVSADDLAHCGEIYYQILEKLLAT 381


>gi|15802994|ref|NP_289024.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           EDL933]
 gi|15832588|ref|NP_311361.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. Sakai]
 gi|168748475|ref|ZP_02773497.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4113]
 gi|168756238|ref|ZP_02781245.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4401]
 gi|168761075|ref|ZP_02786082.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4501]
 gi|168768558|ref|ZP_02793565.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4486]
 gi|168773620|ref|ZP_02798627.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4196]
 gi|168778432|ref|ZP_02803439.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4076]
 gi|168787812|ref|ZP_02812819.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC869]
 gi|168798837|ref|ZP_02823844.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC508]
 gi|195936613|ref|ZP_03081995.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4024]
 gi|208809384|ref|ZP_03251721.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4206]
 gi|208812596|ref|ZP_03253925.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4045]
 gi|208820847|ref|ZP_03261167.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4042]
 gi|209396481|ref|YP_002271940.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4115]
 gi|217327512|ref|ZP_03443595.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. TW14588]
 gi|254794416|ref|YP_003079253.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. TW14359]
 gi|261223096|ref|ZP_05937377.1| N-succinyl-diaminopimelate deacylase [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261259352|ref|ZP_05951885.1| N-succinyl-diaminopimelate deacylase [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291283691|ref|YP_003500509.1| Succinyl-diaminopimelate desuccinylase [Escherichia coli O55:H7
           str. CB9615]
 gi|81765646|sp|Q8XBE0|DAPE_ECO57 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064737|sp|B5Z008|DAPE_ECO5E RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|12516850|gb|AAG57581.1|AE005476_6 N-succinyl-diaminopimelate deacylase [Escherichia coli O157:H7 str.
           EDL933]
 gi|13362804|dbj|BAB36757.1| N-succinyl-diaminopimelate deacylase [Escherichia coli O157:H7 str.
           Sakai]
 gi|187770666|gb|EDU34510.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4196]
 gi|188017094|gb|EDU55216.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4113]
 gi|189003182|gb|EDU72168.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4076]
 gi|189356596|gb|EDU75015.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4401]
 gi|189362299|gb|EDU80718.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4486]
 gi|189368452|gb|EDU86868.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4501]
 gi|189372314|gb|EDU90730.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC869]
 gi|189378637|gb|EDU97053.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC508]
 gi|208729185|gb|EDZ78786.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4206]
 gi|208733873|gb|EDZ82560.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4045]
 gi|208740970|gb|EDZ88652.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4042]
 gi|209157881|gb|ACI35314.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. EC4115]
 gi|209763758|gb|ACI80191.1| N-succinyl-diaminopimelate deacylase [Escherichia coli]
 gi|209763760|gb|ACI80192.1| N-succinyl-diaminopimelate deacylase [Escherichia coli]
 gi|209763762|gb|ACI80193.1| N-succinyl-diaminopimelate deacylase [Escherichia coli]
 gi|209763764|gb|ACI80194.1| N-succinyl-diaminopimelate deacylase [Escherichia coli]
 gi|209763766|gb|ACI80195.1| N-succinyl-diaminopimelate deacylase [Escherichia coli]
 gi|217319879|gb|EEC28304.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. TW14588]
 gi|254593816|gb|ACT73177.1| N-succinyl-diaminopimelate deacylase [Escherichia coli O157:H7 str.
           TW14359]
 gi|290763564|gb|ADD57525.1| Succinyl-diaminopimelate desuccinylase [Escherichia coli O55:H7
           str. CB9615]
 gi|320188803|gb|EFW63462.1| N-succinyl-L,L-diaminopimelate desuccinylase [Escherichia coli
           O157:H7 str. EC1212]
 gi|320640975|gb|EFX10459.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. G5101]
 gi|320646257|gb|EFX15184.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H-
           str. 493-89]
 gi|320651763|gb|EFX20143.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H-
           str. H 2687]
 gi|320657148|gb|EFX24957.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O55:H7
           str. 3256-97 TW 07815]
 gi|320662907|gb|EFX30235.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O55:H7
           str. USDA 5905]
 gi|320667794|gb|EFX34705.1| succinyl-diaminopimelate desuccinylase [Escherichia coli O157:H7
           str. LSU-61]
 gi|326340266|gb|EGD64070.1| N-succinyl-L,L-diaminopimelate desuccinylase [Escherichia coli
           O157:H7 str. 1125]
 gi|326344951|gb|EGD68695.1| N-succinyl-L,L-diaminopimelate desuccinylase [Escherichia coli
           O157:H7 str. 1044]
          Length = 375

 Score =  245 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 152/385 (39%), Positives = 220/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDFADTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K +  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKAVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|162147915|ref|YP_001602376.1| succinyl-diaminopimelate desuccinylase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|238064788|sp|A9HKR2|DAPE_GLUDA RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|161786492|emb|CAP56074.1| putative succinyl-diaminopimelate desuccinylase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 385

 Score =  245 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 178/380 (46%), Positives = 224/380 (58%), Gaps = 9/380 (2%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L     LI+ PSVTP DGGA  +L   L+ LGF + +  F     +   NL+AR G   
Sbjct: 12  ALTLARDLIRAPSVTPDDGGAIGVLTAALRGLGFDVTDLPFGEG-PARTPNLFARLGRSG 70

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           PHL FAGH DVVPPGD   WT  PF A + +G +YGRG  DMKG IA F+ AVAR +   
Sbjct: 71  PHLCFAGHTDVVPPGDG-GWTSGPFEAALRDGCLYGRGACDMKGGIAAFVGAVARILESG 129

Query: 125 KN-FGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
           +   GS+SLLITGDEEGPA  GT K+L W+   G+  D C+VGEPT    +GD IKIGRR
Sbjct: 130 RTLRGSVSLLITGDEEGPATFGTVKVLEWMAAHGQVPDFCVVGEPTNPDHLGDVIKIGRR 189

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL+  I + G QGHVAYPH  +NP+  L+ +L  LT    D G   F P+++++TT+DV
Sbjct: 190 GSLNARIVVPGIQGHVAYPHRADNPVHRLLAILSDLTARPLDQGTEWFEPSSLQVTTVDV 249

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GN + NVIP +     NIRFNDL   + L + IR     G+ +V      V         
Sbjct: 250 GNEATNVIPGRATARLNIRFNDLHTGQGLADWIR-----GVAHVHAPGAEVTVQISGEAF 304

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
                 +L  +L+ SI   TG  P L T GGTSDARFI  YCPV EFGLVG +MH ++E+
Sbjct: 305 RTEPTPEL-DMLAASIQAVTGRAPRLDTGGGTSDARFISRYCPVAEFGLVGASMHKVDEH 363

Query: 364 ASLQDLEDLTCIYENFLQNW 383
             + DL  LT IY  FL+  
Sbjct: 364 VPVADLLALTDIYAAFLERL 383


>gi|148827243|ref|YP_001291996.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           PittGG]
 gi|238064748|sp|A5UFQ7|DAPE_HAEIG RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|148718485|gb|ABQ99612.1| succinyl-diaminopimelate desuccinylase [Haemophilus influenzae
           PittGG]
          Length = 377

 Score =  245 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 154/388 (39%), Positives = 214/388 (55%), Gaps = 13/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +     LI   S++P D G   I+   L+ LGF IE   F     +   NL+A+ 
Sbjct: 1   MREKVVSLAQDLIHRSSISPNDEGCQKIIAERLEKLGFQIEWMPF-----NDTLNLWAKH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT  P + FAGH DVVP GD N W+ PPFSA I +G +YGRG  DMKGS+A  I A   +
Sbjct: 56  GTSEPVIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEY 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    N  G I+LLIT DEE  A +GT +++  +  + EK   C+VGEP+    +GD +K
Sbjct: 116 VKANPNHKGIIALLITSDEEAAAKDGTIRVVETLMTRDEKITYCMVGEPSSAKNLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++G + I G QGHVAYPHL ENPI      L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITGNLYIQGIQGHVAYPHLAENPIHKAALFLQELTTYQWDKGNEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIPA++ + FN+R+     ++ +K+++   L K         + + ++  
Sbjct: 236 NIHAGTGSNNVIPAELYIQFNLRYCTEVTDEIIKQKVAEMLEKHNLK-----YRIEWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
            +P FLT   KL   ++ +I  T G  P   T GGTSD RFI      V+EFG +  T+H
Sbjct: 291 GNP-FLTKPGKLLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFIT 386
            +NE  S++DL     IY   L N   +
Sbjct: 350 KVNECVSVEDLGKCGEIYHKMLVNLLDS 377


>gi|260856564|ref|YP_003230455.1| N-succinyl-diaminopimelate deacylase [Escherichia coli O26:H11 str.
           11368]
 gi|257755213|dbj|BAI26715.1| N-succinyl-diaminopimelate deacylase [Escherichia coli O26:H11 str.
           11368]
 gi|323156071|gb|EFZ42230.1| succinyl-diaminopimelate desuccinylase [Escherichia coli EPECa14]
          Length = 375

 Score =  245 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 151/385 (39%), Positives = 221/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDFADTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  +L+ L  +Y+  ++  
Sbjct: 349 KINECVNAANLQLLARMYQRIMEQL 373


>gi|157375555|ref|YP_001474155.1| succinyl-diaminopimelate desuccinylase [Shewanella sediminis
           HAW-EB3]
 gi|238055224|sp|A8FW04|DAPE_SHESH RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|157317929|gb|ABV37027.1| succinyl-diaminopimelate desuccinylase [Shewanella sediminis
           HAW-EB3]
          Length = 376

 Score =  245 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 151/386 (39%), Positives = 207/386 (53%), Gaps = 13/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+ D L     LI   SVTP D G   ++ + L   GF IE   F         N++AR 
Sbjct: 1   MSQDVLTLAQDLISRESVTPLDEGCQQLMADRLSAKGFDIESMVFDD-----TTNMWARR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   P   FAGH DVVP GD N W  PPF   + +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GNSGPLFCFAGHTDVVPVGDLNRWHTPPFDPVVIDGYLHGRGAADMKGSLAAMLVATERF 115

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + K+  + GSI+ LIT DEEGP INGT +++  +E + EK    +VGEP+  H +GD +K
Sbjct: 116 VEKHPDHNGSIAFLITSDEEGPFINGTTRVIDTLEARNEKITWALVGEPSSTHKLGDIVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+G +T++G QGHVAYPHL +NPI    P L +L  + +D GN  F PT+ +I 
Sbjct: 176 NGRRGSLTGNLTVNGIQGHVAYPHLADNPIHNAAPALDELARMKWDNGNEFFPPTSFQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NVIP  +++ FN R++     + L + + + L     +   L + + ++  
Sbjct: 236 NINGGTGASNVIPGSLEVMFNFRYSTEVTAEELIKRVLNIL-----DAHGLDYDISWTFN 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P        L      +I   TG      TSGGTSD RFI      VIE G V  T+H
Sbjct: 291 GLPFLTGE-GPLLDATRDAIKQVTGTDTDPQTSGGTSDGRFIAPTGAHVIELGPVNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            +NE   + DLE L   YE  L+   
Sbjct: 350 KVNECVKVADLEQLALCYEVILEKLL 375


>gi|218710268|ref|YP_002417889.1| succinyl-diaminopimelate desuccinylase [Vibrio splendidus LGP32]
 gi|238055243|sp|B7VIL8|DAPE_VIBSL RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|218323287|emb|CAV19464.1| Succinyl-diaminopimelate desuccinylase [Vibrio splendidus LGP32]
          Length = 378

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 156/388 (40%), Positives = 212/388 (54%), Gaps = 14/388 (3%)

Query: 1   MTPD-CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    L     LI   SVTP+D G   +++  LK LGF IE   F+        N +AR
Sbjct: 1   MTDSPTLALAKDLISRQSVTPEDAGCQDLMIERLKALGFEIEVMVFED-----TTNFWAR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GTEAP   FAGH DVVP G    W   PF  TI +G ++GRG  DMKGS+A  + AV +
Sbjct: 56  RGTEAPLFAFAGHTDVVPAGPIEQWNTKPFEPTIIDGFLHGRGAADMKGSLASMVVAVEQ 115

Query: 120 FIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           FI K+ +  GSI  LIT DEEGP INGT +++  +  +GE  D CIVGEP+    +GD +
Sbjct: 116 FIAKHPDHTGSIGFLITSDEEGPFINGTVRVVEALMARGENIDMCIVGEPSSTEYVGDVV 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGS++G++TI G QGHVAYPHL  NP+   +  +++L    +D GN  F PT+ +I
Sbjct: 176 KNGRRGSITGDLTIKGTQGHVAYPHLANNPVHSSLLAINELATTEWDKGNDYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
             +  G  + NVIP +  + FN+RF+   N   + E I + L K         + + ++ 
Sbjct: 236 PNVSAGTGASNVIPGEFNVQFNLRFSTELNNDIIVERITNTLDK-----YDFEYDLKWTF 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTM 357
              P        L   +  ++ +     P L T+GGTSD RFI      V+E G V  T+
Sbjct: 291 NGDPFLTDAGS-LLDAIVDAVGHVNDVKPALLTTGGTSDGRFIARMKGQVVELGPVNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H +NE   + DLE LT +YE  L N F 
Sbjct: 350 HKVNECVKVADLEKLTDMYERTLVNLFA 377


>gi|86146840|ref|ZP_01065159.1| succinyl-diaminopimelate desuccinylase [Vibrio sp. MED222]
 gi|85835292|gb|EAQ53431.1| succinyl-diaminopimelate desuccinylase [Vibrio sp. MED222]
          Length = 378

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 156/388 (40%), Positives = 213/388 (54%), Gaps = 14/388 (3%)

Query: 1   MTPD-CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    L     LI   SVTP+D G   ++++ LK LGF IE   F+        N +AR
Sbjct: 1   MTDSPTLALAKDLISRQSVTPEDAGCQDLMIDRLKALGFEIEVMVFED-----TTNFWAR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GTEAP   FAGH DVVP G    W   PF  TI +G ++GRG  DMKGS+A  + AV +
Sbjct: 56  RGTEAPLFAFAGHTDVVPAGPIEQWNTKPFEPTIVDGFLHGRGAADMKGSLASMVVAVEQ 115

Query: 120 FIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           FI K+ +  GSI  LIT DEEGP INGT +++  +  +GE  D CIVGEP+    +GD +
Sbjct: 116 FIAKHPDHTGSIGFLITSDEEGPFINGTVRVVEALMARGENIDMCIVGEPSSTEYVGDVV 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGS++G++TI G QGHVAYPHL  NP+   +  +++L    +D GN  F PT+ +I
Sbjct: 176 KNGRRGSITGDLTIKGTQGHVAYPHLANNPVHSSLLAINELATTEWDKGNDYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
             +  G  + NVIP +  + FN+RF+   N   + E I + L K         + + ++ 
Sbjct: 236 PNVSAGTGASNVIPGEFNVQFNLRFSTELNNDIIVERITNTLDK-----YDFEYDLKWTF 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTM 357
              P        L   +  ++ +     P L T+GGTSD RFI      V+E G V  T+
Sbjct: 291 NGDPFLTDAGS-LLDAIVDAVGHVNDVKPALLTTGGTSDGRFIARMKGQVVELGPVNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H +NE   + DLE LT +YE  L N F 
Sbjct: 350 HKVNECVKVADLEKLTDMYERTLVNLFA 377


>gi|90415972|ref|ZP_01223905.1| succinyl-diaminopimelate desuccinylase [marine gamma
           proteobacterium HTCC2207]
 gi|90332346|gb|EAS47543.1| succinyl-diaminopimelate desuccinylase [marine gamma
           proteobacterium HTCC2207]
          Length = 398

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 148/386 (38%), Positives = 211/386 (54%), Gaps = 13/386 (3%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           T + +    +LI+  SVTP D G   +++  L  +GF+IE   F       V N +A  G
Sbjct: 24  TTETVLLTQELIRRRSVTPDDSGCQEVMIERLAAIGFTIERLRFGD-----VDNFWAVRG 78

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
              P L FAGH DVVP G   +W   PF ATI EG I GRG  DMKGS+A  + A  RF+
Sbjct: 79  DSGPTLCFAGHTDVVPTGPEENWQQAPFDATIVEGHIVGRGAADMKGSLAAMVVACERFV 138

Query: 122 PKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
             + N  G I+ LIT DEEG AINGT K++  +E++ E  + C++GEP+     GD +K 
Sbjct: 139 ALHPNHSGRIAFLITSDEEGIAINGTIKVIQLLEQRNELPEWCLIGEPSSTAKCGDVVKN 198

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGSL   +T+ G+QGHVAYPHL +NP+    P L  L +  +D GN  F  T+ +I+ 
Sbjct: 199 GRRGSLGCTLTVKGQQGHVAYPHLADNPVHRAAPALAALASEVWDNGNDFFPATSFQISN 258

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV 300
           I  G  + NVIP ++++ FN RF+    E+ + +   + L +         ++  ++   
Sbjct: 259 IKAGTGATNVIPGEMEVIFNFRFSTELTEQQIIQRTETLLDQHGLK-----YSADWNLSG 313

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHA 359
            P   +   +L +   +SI   TG    LST+GGTSD RFI      VIE G V  ++H 
Sbjct: 314 HPFLTSK-GELVTATVESIAEVTGMNTELSTAGGTSDGRFIAPLGVQVIELGPVNESIHK 372

Query: 360 LNENASLQDLEDLTCIYENFLQNWFI 385
           ++EN ++ DL  LT IY+  L     
Sbjct: 373 IDENTNIDDLNCLTEIYQTILSKLLA 398


>gi|291326199|ref|ZP_06573877.1| succinyl-diaminopimelate desuccinylase [Providencia rettgeri DSM
           1131]
 gi|291315359|gb|EFE55812.1| succinyl-diaminopimelate desuccinylase [Providencia rettgeri DSM
           1131]
          Length = 389

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 152/382 (39%), Positives = 217/382 (56%), Gaps = 13/382 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    ++   +LI  PS++P D G   IL   L  LGF++E   F         N +A  
Sbjct: 14  MDCPVIQLAKELISRPSISPDDQGCQAILTERLNQLGFTVEPMHF-----GNTLNFWAHR 68

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT+ P L FAGH DVVP G+  +W  PPFS TI    +YGRG  DMKGS+A  + A  RF
Sbjct: 69  GTQGPTLAFAGHTDVVPAGNSENWQTPPFSPTIINQHLYGRGAADMKGSVAAMVVAAERF 128

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + K+  + G ++ LIT DEE  A++GT K++  +  + E+ D C+VGEP+    +GD IK
Sbjct: 129 VKKHPQHQGRLAFLITSDEEADALDGTVKVVETLMARNERVDYCLVGEPSSQSQLGDIIK 188

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++  +TI G QGHVAYPHL +NP+      L +LT+  +D GN  F  T M+I 
Sbjct: 189 NGRRGSITANLTILGTQGHVAYPHLADNPVHRSTAFLQELTSTIWDNGNEFFPATTMQIA 248

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  + NVIP ++ + FN RF+     +    +IR R+   +     L++ + +S  
Sbjct: 249 NIHAGTGASNVIPGELFVQFNFRFST----ELTDTQIRDRVTS-MLERHGLTYKIEWSLS 303

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT  ++L +   ++I+  TG    LSTSGGTSD RFI      VIE G +  T+H
Sbjct: 304 GQP-FLTEKQELVTATLQAIHELTGLNAELSTSGGTSDGRFIAQMGTQVIELGPLNATIH 362

Query: 359 ALNENASLQDLEDLTCIYENFL 380
            ++E  S++DL+ L  IYE  +
Sbjct: 363 KVDECVSVKDLQQLALIYERVM 384


>gi|198283610|ref|YP_002219931.1| succinyl-diaminopimelate desuccinylase [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218667059|ref|YP_002426237.1| succinyl-diaminopimelate desuccinylase [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|238055193|sp|B7JBS5|DAPE_ACIF2 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238055194|sp|B5ES53|DAPE_ACIF5 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|198248131|gb|ACH83724.1| succinyl-diaminopimelate desuccinylase [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218519272|gb|ACK79858.1| succinyl-diaminopimelate desuccinylase [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 382

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 144/387 (37%), Positives = 205/387 (52%), Gaps = 13/387 (3%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
               LE    LI  PSVTP+D G   +++  LK +GF +          + V+N +A  G
Sbjct: 3   KSAVLELAEDLISRPSVTPEDAGCQELMIARLKAVGFRVTRLPA-----NGVENFWAERG 57

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
              P L FAGH DVVP G    W   PF   I +G +YGRG  DMKGS+A  + A  RF+
Sbjct: 58  GAGPRLCFAGHTDVVPSGPLAEWQNDPFQPIIRDGMLYGRGAADMKGSLAAMVVAAERFV 117

Query: 122 PKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
             +  + G ++ LIT DEEG A +GT+ ++ W+ + GE  D C+VGEP+   ++GD IK 
Sbjct: 118 ALHPAHSGRLAFLITSDEEGIATHGTRHVVDWLREHGETIDWCVVGEPSSEKVLGDVIKN 177

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGSL+G +T+HG QGHVAYP   +NPI      L  L +  +D GN  F PT ++ + 
Sbjct: 178 GRRGSLNGRLTVHGIQGHVAYPDKADNPIHRAFRPLADLVDQSWDAGNDFFPPTRLQFSN 237

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV 300
           I  G  + NVIP Q++  FN RF+     ++L+  +   L     +   + +T+ +    
Sbjct: 238 IHAGTGANNVIPGQLQADFNFRFSTESTPESLQAGVHKIL-----DASAMRYTIDWQLSG 292

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHA 359
            P F      L +   K++      +  LST GGTSD RFI      V+E G V  T+H 
Sbjct: 293 PPFFTAP-GPLVAATQKALQAVEQRVAQLSTGGGTSDGRFIAQLGGQVVELGPVNATIHK 351

Query: 360 LNENASLQDLEDLTCIYENFLQNWFIT 386
           +NE  ++ DLE L  IY   + +   T
Sbjct: 352 INECVAVADLEHLAQIYMEIMVHLLET 378


>gi|227355898|ref|ZP_03840290.1| N-succinyl-diaminopimelate deacylase [Proteus mirabilis ATCC 29906]
 gi|227163886|gb|EEI48788.1| N-succinyl-diaminopimelate deacylase [Proteus mirabilis ATCC 29906]
          Length = 376

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 155/383 (40%), Positives = 218/383 (56%), Gaps = 13/383 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI  PSV+P D G   +++  L  LGF+IE+  F        +NL+A  
Sbjct: 1   MSCPVIELAQQLISRPSVSPDDQGCQQLIIERLAPLGFTIEKMPF-----GQTENLWACR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G E   L FAGH DVVPPG    W  PPF  +I +G +YGRG  DMKGS+A  + A  RF
Sbjct: 56  GGEGETLAFAGHTDVVPPGANALWDNPPFEPSIRDGMLYGRGAADMKGSLAAMVVAAERF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  Y    G ++ LIT DEE  A +GT K++  +  +GE+ D C+VGEP+  H +GD IK
Sbjct: 116 VHAYPQHRGRLAFLITSDEEADAHDGTVKVVESLISRGERLDYCLVGEPSSQHQLGDMIK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++  +TI+G QGHVAYPHL +NPI    P +H+L N  +D GN  F  T M+I 
Sbjct: 176 NGRRGSITANVTIYGTQGHVAYPHLAQNPIHMASPFIHELVNTVWDNGNEYFPATTMQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  S NVIP ++ + FN RF+    ++ +++   + L K      +L + + +S  
Sbjct: 236 NINSGTGSNNVIPGELFIQFNFRFSTAITDEEIRQRTEALLQK-----YQLRYHISWSLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P       KL   +  S+ + T   P LSTSGGTSD RFI      V+E G +  T+H
Sbjct: 291 GQPFITGE-GKLLDAVRYSVKHYTNIEPTLSTSGGTSDGRFIAQMGAQVVELGPINATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQ 381
            +NE  S  DL+ L+ IY+  ++
Sbjct: 350 KVNECVSAADLQQLSRIYQRIME 372


>gi|240948332|ref|ZP_04752718.1| succinyl-diaminopimelate desuccinylase [Actinobacillus minor NM305]
 gi|240297371|gb|EER47912.1| succinyl-diaminopimelate desuccinylase [Actinobacillus minor NM305]
          Length = 379

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 143/387 (36%), Positives = 208/387 (53%), Gaps = 13/387 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +     LI+  S++P D G   ++   L+ +GF +E   F         NL+A  
Sbjct: 1   MERQIITLAQALIQRKSISPNDEGCQQLIAERLQAVGFKLEWLPFGD-----TLNLWATH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   P L FAGH DVVP GD + WTYPPFSA I +  +YGRG  DMKGS+A  + A   F
Sbjct: 56  GEGDPCLAFAGHTDVVPEGDESQWTYPPFSAEIVDDVLYGRGAADMKGSLAAMVIACETF 115

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +     + G I+LLIT DEE  A +GT K++  + ++ E    C+VGEP+    +GD +K
Sbjct: 116 VKNNPNHQGKIALLITSDEEAAAKDGTVKVVETLMQRQEPIHYCVVGEPSSTKQLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++  + I G QGHVAYPHL ENP+   +P L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITANLYIEGIQGHVAYPHLAENPVHTALPFLSELTAYQWDNGNEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN+R+    N++ +K ++   L K         H + ++  
Sbjct: 236 NIKAGTGSNNVIPGELYVQFNLRYCTEVNDEIIKAKVAEMLQKHGLK-----HRIEWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P    +  KL     +++ N T   P L T GGTSD RFI      V+EFG + +T+H
Sbjct: 291 GKPFLAGN-GKLVQATIQAVENVTQITPKLDTGGGTSDGRFIALMGAEVVEFGPINQTIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            +NE  ++ DL     +Y    +   +
Sbjct: 350 KVNECVNVNDLGKCGEVYYQIAEKLLL 376


>gi|71907354|ref|YP_284941.1| succinyl-diaminopimelate desuccinylase [Dechloromonas aromatica
           RCB]
 gi|123627561|sp|Q47FB0|DAPE_DECAR RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|71846975|gb|AAZ46471.1| succinyldiaminopimelate desuccinylase [Dechloromonas aromatica RCB]
          Length = 377

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 152/385 (39%), Positives = 213/385 (55%), Gaps = 13/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   LE   ++I C SVTP+D G   IL+  LK LGFSIE       N + V NL+AR 
Sbjct: 1   MSDTTLELAKRIIACASVTPEDAGCMDILIERLKPLGFSIEFI-----NRNGVTNLWARR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT AP  +FAGH DVVP G  + WT PPF+  I +G +YGRG  DMK S+A  + AV  F
Sbjct: 56  GTTAPLFVFAGHTDVVPTGPLDKWTSPPFAPEIRDGVLYGRGTADMKSSVAASVTAVEAF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +       GS++ L+T DEEG A +GT  ++  ++ +GE  D CI+GEPT    +GD +K
Sbjct: 116 VAANPQHPGSLAFLLTSDEEGDANDGTIAVVEALKARGETLDFCIIGEPTSVDTLGDMVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSLSG +T+ G Q H+AYP    NPI    P L +L    +D GN  + PT  +I+
Sbjct: 176 NGRRGSLSGVLTVKGIQCHIAYPEKGRNPIHEAAPALAELAATEWDQGNEYYQPTTWQIS 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  + NV+P  V + FN RF+     + L++ + + L K   +     + + ++  
Sbjct: 236 NIHGGTGATNVVPGSVDIKFNFRFSTASTPEGLQQRLSAILEKHKLD-----YEIKWTLG 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMH 358
             P FLT    L    + +I    G    LST+GGTSD RFI + C  ++E G V  T H
Sbjct: 291 ARP-FLTGRGPLADAATTAIREICGIETELSTTGGTSDGRFIAEICRQMLEIGPVNATSH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            ++E  ++  L  L+ IY   L+  
Sbjct: 350 KIDECIAVDALPKLSAIYRRILEQL 374


>gi|209542532|ref|YP_002274761.1| succinyl-diaminopimelate desuccinylase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209530209|gb|ACI50146.1| succinyl-diaminopimelate desuccinylase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 385

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 178/380 (46%), Positives = 225/380 (59%), Gaps = 9/380 (2%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L     LI+ PSVTP DGGA  +L   L+ LGF + +  F     +   NL+AR G   
Sbjct: 12  ALTLARDLIRAPSVTPDDGGAIGVLTAALRGLGFDVTDLPFGEG-PARTPNLFARLGRSG 70

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           PHL FAGH DVVPPGD   WT  PF A + +G++YGRG  DMKG IA F+ AVAR +   
Sbjct: 71  PHLCFAGHTDVVPPGDG-GWTSGPFEAALRDGRLYGRGACDMKGGIAAFVGAVARILESG 129

Query: 125 KN-FGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
           +   GS+SLLITGDEEGPA  GT K+L W+   G+  D C+VGEPT    +GD IKIGRR
Sbjct: 130 RTLRGSVSLLITGDEEGPATFGTVKVLEWMAAHGQVPDFCVVGEPTNPDHLGDVIKIGRR 189

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL+  I + G QGHVAYPH  +NP+  L+ +L  LT    D G   F P+++++TT+DV
Sbjct: 190 GSLNARIVVPGIQGHVAYPHRADNPVHRLLAILSDLTARPLDQGTEWFEPSSLQVTTVDV 249

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GN + NVIP +     NIRFNDL   + L + IR     G+ +V      V         
Sbjct: 250 GNEATNVIPGRATARLNIRFNDLHTGQGLADWIR-----GVAHVHAPGAEVTVQISGEAF 304

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
                 +L  +L+ SI   TG  P L T GGTSDARFI  YCPV EFGLVG +MH ++E+
Sbjct: 305 RTEPTPEL-DMLAASIQAVTGRAPRLDTGGGTSDARFISRYCPVAEFGLVGASMHKVDEH 363

Query: 364 ASLQDLEDLTCIYENFLQNW 383
             + DL  LT IY  FL+  
Sbjct: 364 VPVADLLALTDIYAAFLERL 383


>gi|226326348|ref|ZP_03801866.1| hypothetical protein PROPEN_00196 [Proteus penneri ATCC 35198]
 gi|225205299|gb|EEG87653.1| hypothetical protein PROPEN_00196 [Proteus penneri ATCC 35198]
          Length = 376

 Score =  244 bits (623), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 153/385 (39%), Positives = 214/385 (55%), Gaps = 13/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI  PS++P D G   ++++ L  LGF+IE   F         N +A  
Sbjct: 1   MSCPVIELAQQLISRPSISPDDQGCQQLIIDRLTPLGFTIERMPFGETE-----NFWACR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G E   L FAGH DVVP GD N W  PPF  +I +G +YGRG  DMKGS+A  I A  RF
Sbjct: 56  GGEGETLAFAGHTDVVPTGDPNLWDNPPFEPSIRDGMLYGRGAADMKGSLAAMIVAAERF 115

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  Y  + G ++ LIT DEE  A +GT K++  +  +GE+ D C+VGEP+  H +GD +K
Sbjct: 116 VHSYPDHRGRLAFLITSDEEAKATDGTVKVVQSLMSRGERLDYCLVGEPSSQHHLGDMVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++  + I G QGHVAYPHL ENPI    P + +L N  +D GN  F  T M+I 
Sbjct: 176 NGRRGSITANLIIQGVQGHVAYPHLAENPIHLASPFIQELINTVWDEGNEFFPATTMQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +++   + L K      +L + + +S  
Sbjct: 236 NIHAGTGSNNVIPGELFIQFNFRFSTAITDEEIRQRTEALLQK-----HQLRYQLEWSLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P       KL   +  S+ + T   P LSTSGGTSD RFI      V+E G V  T+H
Sbjct: 291 GQPFITG-QGKLLEAVCYSVKHYTNLEPELSTSGGTSDGRFIAQMGAQVVELGPVNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L+ IY+  ++  
Sbjct: 350 KVNECVNAADLQQLSRIYQRVMEQL 374


>gi|307822146|ref|ZP_07652378.1| succinyl-diaminopimelate desuccinylase [Methylobacter tundripaludum
           SV96]
 gi|307736712|gb|EFO07557.1| succinyl-diaminopimelate desuccinylase [Methylobacter tundripaludum
           SV96]
          Length = 375

 Score =  244 bits (623), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 164/385 (42%), Positives = 221/385 (57%), Gaps = 13/385 (3%)

Query: 3   PDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT 62
            + LE L  LI   SVTPQD G   +L   L  LGF  E  DF+        N++ R G 
Sbjct: 2   SNILELLKDLISRESVTPQDAGCQDVLAARLTKLGFKEERLDFEDTQ-----NIWLRRGE 56

Query: 63  EAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIP 122
             P L F GH DVVP G    W  PPF   I +GK+YGRG  DMKG IACFI AV RFI 
Sbjct: 57  AKPLLTFLGHTDVVPTGPLEAWVSPPFEPMIRDGKLYGRGAADMKGGIACFITAVERFIA 116

Query: 123 KYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
           K+  + GSI++++T DEEG A NG  K++  +E++ EK D C+VGEP+ +  IGD I++G
Sbjct: 117 KHPDHQGSIAVMMTSDEEGIATNGVVKVVEVLEQRNEKIDWCLVGEPSSDKKIGDVIRVG 176

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSL  ++TI G QGHVAYP L +NPI    P L  LT   +D GN  F PT+++++ I
Sbjct: 177 RRGSLCAKLTIAGIQGHVAYPELADNPIHTFAPALKDLTEEVWDHGNAFFPPTSLQVSNI 236

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
           + G  ++N+IP  V + FN+RF    +E+T+K+  R+ L K         + + +    +
Sbjct: 237 NAGTGAENIIPGSVNVQFNLRFCTELDEETIKQRTRAILDK-----YDFKYELEWRLSGN 291

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHAL 360
           P FLT    L      +I   TG   L  T GGTSD RFI      VIE G +  ++H +
Sbjct: 292 P-FLTEPGALIDAAHAAIKTVTGFETLDDTGGGTSDGRFIAPTGAQVIELGPLNESIHKI 350

Query: 361 NENASLQDLEDLTCIYENFLQNWFI 385
           NE+  ++DLE L+ IYE  L N  +
Sbjct: 351 NEHVGVEDLEILSDIYEQILVNLLV 375


>gi|58584825|ref|YP_198398.1| succinyl-diaminopimelate desuccinylase [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
 gi|75497750|sp|Q5GS68|DAPE_WOLTR RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|58419141|gb|AAW71156.1| Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase
           [Wolbachia endosymbiont strain TRS of Brugia malayi]
          Length = 401

 Score =  244 bits (623), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 165/385 (42%), Positives = 223/385 (57%), Gaps = 8/385 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D +E   +LI   S+TP+D GA   +   L+  GF  E  +F    T  VKNLYA++
Sbjct: 1   MKIDPVELTKKLISFKSITPRDDGAIEHIAAILEKSGFDCEILEFGDNKTK-VKNLYAKY 59

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIA-AVAR 119
                +L FAGH+DVVPPG    W   PFS  + +G +YGRG  DMK  IA FI   V  
Sbjct: 60  INGVQNLCFAGHVDVVPPGQLKDWISDPFSPEVRDGLLYGRGATDMKSGIAAFITAMVDL 119

Query: 120 FIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
              K++  GSIS LIT  EE     GTK +L W+E K +K D C+V EPT +  +GDTIK
Sbjct: 120 VAEKFRFNGSISALITSAEESTEEYGTKAVLKWMESKHKKIDYCVVAEPTSSEKLGDTIK 179

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGS + E+  HGKQGHVAYP L +NPI  +I +L+++ +  FD GN  F P+N EIT
Sbjct: 180 IGRRGSATFELICHGKQGHVAYPDLADNPIYKMISILNRIKDTTFDGGNKYFQPSNCEIT 239

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           TIDVGN + NVI   +   FNIR+N++     L + I         +     H+   +  
Sbjct: 240 TIDVGNSTDNVILDSITAGFNIRYNNMQTPDGLYKLIDEICFSVTNDYKLSMHSSRGAFL 299

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
            +P   T       ++  +I   T    +L+TSGGTSDA FIKD CPVIEFG++ +T H 
Sbjct: 300 STPDRNT------DVMFDAINKVTNIDAVLATSGGTSDAAFIKDVCPVIEFGMINKTSHQ 353

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           +NE   + D+  LT IY+ F++++F
Sbjct: 354 VNECVLVNDIHKLTAIYKEFIKSYF 378


>gi|113460723|ref|YP_718790.1| succinyl-diaminopimelate desuccinylase [Haemophilus somnus 129PT]
 gi|123327165|sp|Q0I1X3|DAPE_HAES1 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|112822766|gb|ABI24855.1| succinyldiaminopimelate desuccinylase [Haemophilus somnus 129PT]
          Length = 377

 Score =  244 bits (623), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 148/386 (38%), Positives = 215/386 (55%), Gaps = 14/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  + +     LI+ PS++P D G   ++   L+ +GF +E   F         NL+A  
Sbjct: 1   MKNNIITLTQSLIQRPSISPDDQGCQQLIAERLQAVGFKLEWLPFGD-----TLNLWATH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     + FAGH DVVP G+ + WTY PF A I E  +YGRG  DMKG++A  + A   F
Sbjct: 56  GE-GKCIAFAGHTDVVPIGNESQWTYLPFEARIVENMLYGRGAADMKGALAAMVIAAETF 114

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +     + G I+LLIT DEE  A NGT K++  + K+ EK D C+VGEP+     GD IK
Sbjct: 115 VKHLPNHQGKIALLITSDEEAAATNGTVKVVETLIKRNEKIDYCVVGEPSSATQFGDIIK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++G + I G QGHVAYPHL +NP+   +  L +LT+  +D GN  F PT+++I 
Sbjct: 175 NGRRGSITGNLYIQGVQGHVAYPHLADNPVHNALKFLDELTHYQWDKGNEFFPPTSLQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN+R+     ++ +K ++   L K      KL++ + ++  
Sbjct: 235 NIHAGTGSNNVIPGELYVQFNLRYCTEVTDEIIKTKVTEMLEK-----HKLTYRIDWNLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P  LT   KL +   +++   T   P L T GGTSDARFI      V+EFG + +T+H
Sbjct: 290 GKPF-LTPQGKLVNATLEAVEKFTQIRPHLDTGGGTSDARFIATMGAEVVEFGPLNQTIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            +NE  ++ DL     IY + L+  F
Sbjct: 349 KVNECVNIDDLAKCGEIYYHILEKLF 374


>gi|90022252|ref|YP_528079.1| succinyl-diaminopimelate desuccinylase [Saccharophagus degradans
           2-40]
 gi|122996053|sp|Q21HG2|DAPE_SACD2 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|89951852|gb|ABD81867.1| succinyldiaminopimelate desuccinylase [Saccharophagus degradans
           2-40]
          Length = 382

 Score =  244 bits (623), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 156/393 (39%), Positives = 214/393 (54%), Gaps = 19/393 (4%)

Query: 1   MTPD------CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVK 54
           MT +       ++    LI  PSVTP+D     +++  L+ +GF +E   F       V 
Sbjct: 1   MTNESAHNTPTVKLACDLIAQPSVTPEDAHCQRMMIERLEAIGFKVENLRFGD-----VD 55

Query: 55  NLYARFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFI 114
           N +A  G   P L FAGH DVVP GD   W   PF+ TI +G +YGRG  DMKGS+A  I
Sbjct: 56  NFWAIRGESGPILAFAGHTDVVPTGDLGKWATDPFTPTIKDGMLYGRGAADMKGSLAAMI 115

Query: 115 AAVARFIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHI 173
            A   FI  + N  G I+ LIT DEEGPAINGT K++ W+E + EK   C+VGEP+   +
Sbjct: 116 TACESFIAAHPNHTGRIAFLITSDEEGPAINGTVKVVEWLEARNEKIKWCLVGEPSSTTL 175

Query: 174 IGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSP 233
           +GD IK GRRGSL  E+ + G QGHVAYPHL  NPI  + P L ++ +  +D GN  F P
Sbjct: 176 VGDVIKNGRRGSLGAELIVKGVQGHVAYPHLAVNPIHMIAPALAEMASETWDNGNEFFPP 235

Query: 234 TNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHT 293
           T+ +++  + G  + NV+P +  + FN RF+       LK+   + L K   N     + 
Sbjct: 236 TSFQVSNFNSGTGATNVVPGEANVVFNFRFSTELTADILKQRTHAILDKHNVN-----YD 290

Query: 294 VHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGL 352
           + ++    P FLT + +L +    +I   TG    LST+GGTSD RFI      V+E G 
Sbjct: 291 LKWNLSGEP-FLTAEGELVAASVAAIKKITGRDTELSTAGGTSDGRFIAPTGAQVLELGP 349

Query: 353 VGRTMHALNENASLQDLEDLTCIYENFLQNWFI 385
           V  T+H +NE  S+ DL  L+ IY   L     
Sbjct: 350 VNATIHQINECVSVDDLNTLSDIYCTMLTELLA 382


>gi|293446824|ref|ZP_06663246.1| succinyl-diaminopimelate desuccinylase [Escherichia coli B088]
 gi|291323654|gb|EFE63082.1| succinyl-diaminopimelate desuccinylase [Escherichia coli B088]
          Length = 375

 Score =  244 bits (623), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 151/385 (39%), Positives = 220/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E   F         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMYFADTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMSRNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|254506858|ref|ZP_05118997.1| succinyl-diaminopimelate desuccinylase [Vibrio parahaemolyticus 16]
 gi|219550143|gb|EED27129.1| succinyl-diaminopimelate desuccinylase [Vibrio parahaemolyticus 16]
          Length = 377

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 154/388 (39%), Positives = 212/388 (54%), Gaps = 14/388 (3%)

Query: 1   MTPD-CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    L     LI   SVTP+D G    ++  LK LGF IE   F+        N +AR
Sbjct: 1   MTDSPTLALAKYLISRQSVTPEDAGCQDAMIERLKALGFEIEVMVFED-----TTNFWAR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GTEAP   FAGH DVVP G+ + W  PPF  T  +G ++GRG  DMKGS+A  I AV +
Sbjct: 56  RGTEAPLFAFAGHTDVVPAGNLDQWHTPPFEPTEIDGYLHGRGAADMKGSLASMIVAVEQ 115

Query: 120 FIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           FI    N  GSI  LIT DEEGP INGT +++  +  +GE  D CIVGEP+   ++GD +
Sbjct: 116 FIADNPNHKGSIGFLITSDEEGPFINGTVRVVETLMARGENIDMCIVGEPSSTEVVGDVV 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGS++G++T+ G QGHVAYPHL  NP+   +  +H+L    +D GN  F PT+ +I
Sbjct: 176 KNGRRGSITGDLTVKGTQGHVAYPHLANNPVHQSLMAIHELATTEWDQGNAYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
             +  G  + NVIP +  + FN+RF+   N   +   +   L K   +     + + ++ 
Sbjct: 236 PNVHAGTGASNVIPGEFNVQFNLRFSTELNNDMIVNRVVETLDKHELD-----YDLKWTF 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTM 357
              P        L   +  ++ +     P L T+GGTSD RFI    C V+E G V  T+
Sbjct: 291 NGDPFLTD-TGALLDAVVDAVDSVNQTKPALLTTGGTSDGRFIARMDCQVVELGPVNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H +NE   + DLE LT +Y+  L+N   
Sbjct: 350 HKVNECVKIDDLEKLTQMYQKTLENLLA 377


>gi|94500610|ref|ZP_01307140.1| succinyl-diaminopimelate desuccinylase [Oceanobacter sp. RED65]
 gi|94427165|gb|EAT12145.1| succinyl-diaminopimelate desuccinylase [Oceanobacter sp. RED65]
          Length = 381

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 164/382 (42%), Positives = 221/382 (57%), Gaps = 13/382 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L   I LI+  SVTP D     ++ + L+ LGF  E   F+      VKNL+AR GTE 
Sbjct: 6   TLALSIALIEQASVTPDDAECQPMMCDILEPLGFECETMQFEE-----VKNLWARKGTEG 60

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P + FAGH DVVP G  ++W +PPF ATI +G +YGRG  DMKGSIA F+AA  RF+  +
Sbjct: 61  PLVCFAGHTDVVPTGPESNWQHPPFDATIKDGMLYGRGAADMKGSIAAFLAATERFVKNH 120

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
            +  GSI+ LIT DEEGPA NGT+K++  +E++ EK D CIVGEP+     GD IK GRR
Sbjct: 121 PDHKGSIAYLITSDEEGPAKNGTRKVIKTLEERNEKIDMCIVGEPSSTKRCGDVIKNGRR 180

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL   + + GKQGHVAYPHL +NPI    P L +L    +D GN  F  T+ +I+ I  
Sbjct: 181 GSLGAVMKVKGKQGHVAYPHLAKNPIHLAAPALAELAQEEWDQGNDFFPATSFQISNIQG 240

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NVIP  V++ FN RF+       LK   ++ L K   +     + + ++    P 
Sbjct: 241 GTGATNVIPGVVEIVFNFRFSTELTADDLKYRTQAILDKHGLD-----YEIEWNLSGEPF 295

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
              H   L     ++I + T     LST+GGTSD RFI      V+E G +  T+H +NE
Sbjct: 296 LTDHGS-LVDAAVEAIKHVTDIETELSTAGGTSDGRFIAPTGAQVVELGPINATIHQVNE 354

Query: 363 NASLQDLEDLTCIYENFLQNWF 384
           + S+ DLE L+ +YE  L+N  
Sbjct: 355 HVSIHDLEQLSLVYERILENLL 376


>gi|296104106|ref|YP_003614252.1| succinyl-diaminopimelate desuccinylase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295058565|gb|ADF63303.1| succinyl-diaminopimelate desuccinylase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 375

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 150/383 (39%), Positives = 219/383 (57%), Gaps = 14/383 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRAIGFTVERMDFGDTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVPAGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNFGS-ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  + ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHKNRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSTEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P+L +L +I +D GN  F PT+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMLSELVSIEWDKGNEFFPPTSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            +  G  S NVIP    + FN RF+    ++ +K  + + L K      +L +TV +   
Sbjct: 235 NVKAGTGSNNVIPGDCFVQFNFRFSTELTDEMIKARVIALLEK-----YQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTQRGKLVDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQ 381
            +NE  +  DL+ L  +Y+  ++
Sbjct: 349 KINECVNAADLQLLARMYQRIME 371


>gi|255264415|ref|ZP_05343757.1| succinyl-diaminopimelate desuccinylase [Thalassiobium sp. R2A62]
 gi|255106750|gb|EET49424.1| succinyl-diaminopimelate desuccinylase [Thalassiobium sp. R2A62]
          Length = 383

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 155/383 (40%), Positives = 217/383 (56%), Gaps = 9/383 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT- 62
           D +    +L++CPSVTP++GGA  +L   L   GF     D        + NL+AR+G  
Sbjct: 7   DPVSLTTELVRCPSVTPEEGGALVLLDTLLSAHGFECTRVD-----RGGISNLFARWGDR 61

Query: 63  -EAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
            +     F GH DVVP GD N WT  PF A I +G +YGRG  DMK  +A F AA   F+
Sbjct: 62  ADPRTFGFNGHTDVVPIGDINDWTVDPFGAEIKDGFLYGRGSTDMKSGVAAFAAAAIDFV 121

Query: 122 PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
                 G++ L ITGDEE  A +GT  +L W++  GE+   C+VGEPT  + +G+ IKIG
Sbjct: 122 QTTPPNGALILAITGDEEDVAEHGTVALLDWMQANGEQMTDCLVGEPTSPNHMGEMIKIG 181

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSL+   T+ GKQGH AYPH   NPI  ++ L+ +L +   D G   F  + + + T+
Sbjct: 182 RRGSLTTYFTVTGKQGHSAYPHRANNPIPAMMRLMDRLASHTLDDGTEHFDASTLAVVTV 241

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
           D GNP+ NVIPA+ + + NIRFND      L + +  +  +          T    S   
Sbjct: 242 DTGNPATNVIPAECRATVNIRFNDAHTGAALTDWLDDQASQIAAEFGVEISTKTKISG-- 299

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALN 361
             F+T    L+ L+S+++   T   P +STSGGTSDARF+K +CPV+E GLVG+TMHA++
Sbjct: 300 ESFITPPGALSQLISEAVQTETNRTPEMSTSGGTSDARFVKHHCPVVECGLVGKTMHAVD 359

Query: 362 ENASLQDLEDLTCIYENFLQNWF 384
           E   +  +  L  IY   L+ +F
Sbjct: 360 ERVEVAQIHQLKSIYARILERYF 382


>gi|163752199|ref|ZP_02159402.1| succinyl-diaminopimelate desuccinylase [Shewanella benthica KT99]
 gi|161327928|gb|EDP99105.1| succinyl-diaminopimelate desuccinylase [Shewanella benthica KT99]
          Length = 376

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 156/386 (40%), Positives = 216/386 (55%), Gaps = 13/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+ D L     LI  PS+TP D G   ++ + L  +GF IE   F+        N++AR 
Sbjct: 1   MSQDVLTLAQDLISRPSLTPLDEGCQQLMADRLAKVGFDIEPMVFED-----TTNMWARR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GTE P   FAGH DVVP GD N W  PPF   + +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GTEKPLFCFAGHTDVVPVGDLNRWHTPPFDPVVIDGYLHGRGAADMKGSLAAMLVATERF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + K  +  GSI+ LIT DEEGP INGT +++  +E + EK    +VGEP+  H +GD +K
Sbjct: 116 VEKNPDHKGSIAFLITSDEEGPFINGTTRVIDTLEARNEKITWSLVGEPSSTHKLGDIVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+G +T++G QGHVAYPHL ENPI   +P L +L  + +D GN  F PT+ +I 
Sbjct: 176 NGRRGSLTGNLTVNGIQGHVAYPHLAENPIHKAMPALDELAKMHWDKGNEYFPPTSFQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NVIP  +++ FN R++     + L + + + L     +   L + +++   
Sbjct: 236 NINGGTGASNVIPGALEVMFNFRYSTEVTAEILIQRVLNIL-----DAHGLEYDINWIFN 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT D  L      +I   TG      T+GGTSD RFI      VIE G V  T+H
Sbjct: 291 GLP-FLTGDGPLLDATKAAIKQVTGTDTDPQTTGGTSDGRFIAPTGAQVIELGPVNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            +NE   + D+E L   YE  L+   
Sbjct: 350 KVNECVKVDDIEQLALCYEVILEKLL 375


>gi|148979877|ref|ZP_01815755.1| succinyl-diaminopimelate desuccinylase [Vibrionales bacterium
           SWAT-3]
 gi|145961569|gb|EDK26870.1| succinyl-diaminopimelate desuccinylase [Vibrionales bacterium
           SWAT-3]
          Length = 378

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 157/388 (40%), Positives = 213/388 (54%), Gaps = 14/388 (3%)

Query: 1   MTPD-CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    L     LI   SVTP+D G   +++N LK LGF IE   F+        N +AR
Sbjct: 1   MTDSPTLALAKDLISRQSVTPEDAGCQELMINRLKALGFEIEVMVFED-----TTNFWAR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GTEAP   FAGH DVVP G    W   PF  TI +G ++GRG  DMKGS+A  I AV +
Sbjct: 56  RGTEAPLFAFAGHTDVVPAGPIEQWNTKPFEPTIVDGYLHGRGAADMKGSLASMIVAVEQ 115

Query: 120 FIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           FI KY +  GSI  LIT DEEGP INGT +++  +  +GE  D CIVGEP+    +GD +
Sbjct: 116 FIEKYPDHSGSIGFLITSDEEGPFINGTVRVVEALMARGENIDMCIVGEPSSTEFVGDVV 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGS++G++TI G QGHVAYPHL  NP+   +  +++L    +D GN  F PT+ +I
Sbjct: 176 KNGRRGSITGDLTIKGTQGHVAYPHLANNPVHSSLLAINELATTEWDQGNNYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
             +  G  + NVIP +  + FN+RF+   +   + E + + L K         + + ++ 
Sbjct: 236 PNVSAGTGASNVIPGEFNVQFNLRFSTELSNDIIVERVTTTLDK-----YDFEYDLKWTF 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTM 357
              P        L   +  ++ +     P L T+GGTSD RFI      V+E G V  T+
Sbjct: 291 NGDPFLTDAGS-LLDAIVDAVGHVNDVKPALLTTGGTSDGRFIARMGGQVVELGPVNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H +NE   + DLE LT +YE  L N F 
Sbjct: 350 HKVNECVKVADLEKLTDMYERTLVNLFA 377


>gi|110806404|ref|YP_689924.1| succinyl-diaminopimelate desuccinylase [Shigella flexneri 5 str.
           8401]
 gi|123048026|sp|Q0T246|DAPE_SHIF8 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|110615952|gb|ABF04619.1| N-succinyl-diaminopimelate deacylase [Shigella flexneri 5 str.
           8401]
          Length = 375

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 152/385 (39%), Positives = 221/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPYDAGCQALLIERLQAIGFTVERMDFADTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|329114450|ref|ZP_08243212.1| Succinyl-diaminopimelate desuccinylase [Acetobacter pomorum DM001]
 gi|326696526|gb|EGE48205.1| Succinyl-diaminopimelate desuccinylase [Acetobacter pomorum DM001]
          Length = 391

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 163/378 (43%), Positives = 225/378 (59%), Gaps = 7/378 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +     LI+ PSV+P  G +  +L   L+ LGF +    F         N +AR GT 
Sbjct: 17  DPVGVAQALIRLPSVSPDPGASQHLLAAMLERLGFEVTHLPFGEG-AERTPNFFARLGTG 75

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
           +PH+ +AGH DVVPPGD   W+YPP++A I +G +YGRG  DMKG IA F++AVAR +  
Sbjct: 76  SPHICYAGHTDVVPPGDEADWSYPPYAADIVDGVLYGRGACDMKGGIASFVSAVARHVAA 135

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               GSIS LITGDEEGPA  GT K+L W+ +  +  D C+VGEPT   ++G+ +K+GRR
Sbjct: 136 GPGKGSISFLITGDEEGPATYGTVKVLEWMAQHNQIPDYCLVGEPTNPKVLGEMVKVGRR 195

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL+  I + G QGHVAYPH  +NP+  L+ +L  L     D G   F P+++++T++DV
Sbjct: 196 GSLNAHIVVEGTQGHVAYPHRADNPVHRLLAVLEALRATPLDNGTEYFEPSSLQVTSVDV 255

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GN + NVIPA+ +   NIRFNDL     LK  + +   +           V         
Sbjct: 256 GNGATNVIPARAEARLNIRFNDLHTGAALKGWVETICRQHAPRSR-----VETKISGESF 310

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
             +  ++ T+ L ++I   TG  P L T GGTSDARFI  YC V EFGLVG ++H ++E+
Sbjct: 311 LTSPTQE-TTALVEAIQQVTGRTPKLDTGGGTSDARFISRYCAVSEFGLVGASIHKVDEH 369

Query: 364 ASLQDLEDLTCIYENFLQ 381
             + DLE LT IY+ FL+
Sbjct: 370 TDIADLEMLTRIYQTFLE 387


>gi|329893763|ref|ZP_08269851.1| N-succinyl-L,L-diaminopimelate desuccinylase [gamma proteobacterium
           IMCC3088]
 gi|328923486|gb|EGG30800.1| N-succinyl-L,L-diaminopimelate desuccinylase [gamma proteobacterium
           IMCC3088]
          Length = 375

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 152/387 (39%), Positives = 214/387 (55%), Gaps = 14/387 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M P  L    +LI+  S+TP+DG    ++   L+ +GF      F       V NL+A  
Sbjct: 1   MNP-TLALCCELIERQSITPEDGACQTLMATRLEAIGFKSRPMPFGE-----VSNLWASR 54

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G+  P L+FAGH DVVP G    W  PPF+ TI +G ++GRG  DMK S+A  I A  RF
Sbjct: 55  GSGGPTLVFAGHTDVVPTGPLEQWQSPPFTPTIRDGHLFGRGAADMKASLAAMITACERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  + N  G I+ LIT DEEGPA +GT K++  +  +GE  D C++GEP+    +GD IK
Sbjct: 115 VAAHPNHRGRIAFLITSDEEGPAHDGTVKVIEQLASEGEAIDWCVIGEPSSTAQLGDVIK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS    +TI GKQGH+AYPHL +NPI   +  L  L    +D GN  F  T ++I+
Sbjct: 175 NGRRGSQGARLTIFGKQGHIAYPHLADNPIHKALAALSSLIEQHWDEGNEFFPATQLQIS 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  + NVIP +V + FN+R++     + L+++I + L K       + + + +   
Sbjct: 235 NIHGGTGATNVIPGEVVVDFNLRYSSETTAQELEQKITALLDK-----FAIKYHIDWVRS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTMH 358
             P       +LT  +S ++    G  P LSTSGGTSD RFI  Y   VIE G V  T+H
Sbjct: 290 GKPFLTRP-GQLTHAVSNAVQKVCGIQPELSTSGGTSDGRFIAPYDIDVIELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            +NE  +++D+E L+ IYE  L     
Sbjct: 349 QINECVAVEDVERLSLIYEQVLVELLA 375


>gi|300311475|ref|YP_003775567.1| succinyl-diaminopimelate desuccinylase [Herbaspirillum seropedicae
           SmR1]
 gi|300074260|gb|ADJ63659.1| succinyl-diaminopimelate desuccinylase protein [Herbaspirillum
           seropedicae SmR1]
          Length = 377

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 155/383 (40%), Positives = 213/383 (55%), Gaps = 13/383 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L    +L+   SVTP+D G    L   L  LGF  E           V NL+AR GT  
Sbjct: 6   TLALTQELMSLSSVTPEDKGCQARLAELLTPLGFVCETIQSGE-----VTNLWARKGTAQ 60

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF-IPK 123
           P ++FAGH DVVP G    W   PF  T+ EG++YGRG  DMK SIA  + A   F    
Sbjct: 61  PLVVFAGHTDVVPTGPLEKWQSHPFQPTLREGRLYGRGASDMKTSIAAMVVACEEFTAAH 120

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
             + GSI  LIT DEEGPAI+GT  + + ++ +GE+ D CIVGEPT    +GD IK GRR
Sbjct: 121 PDHKGSIGFLITSDEEGPAIDGTVVVCNALKARGEQLDYCIVGEPTSAKTLGDMIKNGRR 180

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           G++SG++T+ G QGH+AYP L  NPI    P L +L    +D GN  + PT+ +I+ I  
Sbjct: 181 GTMSGKLTVKGIQGHIAYPQLARNPIHQAAPALAELVAEQWDAGNEYYLPTSWQISNIHG 240

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NVIP +V + FN RF+     + L++ + + L K         + + ++    P 
Sbjct: 241 GTGASNVIPGEVMIDFNFRFSTASTVEGLQQRVHAILDKHGLE-----YDLKWTVGGLP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMHALNE 362
           FLT    L+  LSK+I + TG    LST+GGTSD RFI   CP VIEFG    ++H ++E
Sbjct: 295 FLTPRGDLSDALSKAIKDETGLDTELSTTGGTSDGRFIAQICPQVIEFGPPNDSIHKIDE 354

Query: 363 NASLQDLEDLTCIYENFLQNWFI 385
           +  ++ ++ L  IY   L+N   
Sbjct: 355 HIEVRYIDPLKNIYRKTLENLLA 377


>gi|298369143|ref|ZP_06980461.1| succinyl-diaminopimelate desuccinylase [Neisseria sp. oral taxon
           014 str. F0314]
 gi|298283146|gb|EFI24633.1| succinyl-diaminopimelate desuccinylase [Neisseria sp. oral taxon
           014 str. F0314]
          Length = 381

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 168/391 (42%), Positives = 224/391 (57%), Gaps = 14/391 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    LE    LI   SVTP D     +L   L  +GF+ EE  F        KN++ R
Sbjct: 1   MTETQSLELAKALISRSSVTPDDRDCQKLLAERLHKIGFAAEELHFGD-----TKNIWLR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+AP + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK SIACF+ A  R
Sbjct: 56  RGTQAPVVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTSIACFVTACER 115

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ ++  + GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD I
Sbjct: 116 FVVEHPDHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMI 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I
Sbjct: 176 KNGRRGSLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S 
Sbjct: 236 SNINGGTGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDK-----HGVQYDLQWSC 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTM 357
              P FLTH  KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+
Sbjct: 291 SGQP-FLTHAGKLTDVARAAISETCGVETELSTTGGTSDGRFIKAIAKELIELGPSNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFITPS 388
           H +NEN  L D+  L+ +YE  L       +
Sbjct: 350 HQINENVRLDDIPKLSAVYEGILARLLAEKA 380


>gi|197285415|ref|YP_002151287.1| succinyl-diaminopimelate desuccinylase [Proteus mirabilis HI4320]
 gi|238064772|sp|B4EY70|DAPE_PROMH RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|194682902|emb|CAR43264.1| N-succinyl-diaminopimelate deacylase [Proteus mirabilis HI4320]
          Length = 376

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 155/383 (40%), Positives = 217/383 (56%), Gaps = 13/383 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI  PSV+P D G   +++  L  LGF+IE+  F        +NL+A  
Sbjct: 1   MSCPVIELAQQLISRPSVSPDDQGCQQLIIERLTPLGFTIEKMPF-----GQTENLWACR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G E   L FAGH DVVPPG    W  PPF  +I +G +YGRG  DMKGS+A  + A  RF
Sbjct: 56  GGEGETLAFAGHTDVVPPGANALWDNPPFEPSIRDGMLYGRGAADMKGSLAAMVVAAERF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  Y    G ++ LIT DEE  A +GT K++  +  +GE+ D C+VGEP+  H +GD IK
Sbjct: 116 VHAYPQHRGRLAFLITSDEEADAHDGTVKVVESLISRGERLDYCLVGEPSSQHQLGDMIK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++  +TI+G QGHVAYPHL +NPI    P +H+L N  +D GN  F  T M+I 
Sbjct: 176 NGRRGSITANVTIYGTQGHVAYPHLAQNPIHMASPFIHELVNTVWDNGNEYFPATTMQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +++   + L K      +L + + +S  
Sbjct: 236 NIHSGTGSNNVIPGELFIQFNFRFSTAITDEEIRQRTEALLQK-----YQLRYHISWSLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P       KL   +  S+ + T   P LSTSGGTSD RFI      V+E G +  T+H
Sbjct: 291 GQPFITGE-GKLLDAVRYSVKHYTNIEPTLSTSGGTSDGRFIAQMGAQVVELGPINATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQ 381
            +NE  S  DL+ L+ IY+  ++
Sbjct: 350 KVNECVSAADLQQLSRIYQRIME 372


>gi|77360274|ref|YP_339849.1| succinyl-diaminopimelate desuccinylase [Pseudoalteromonas
           haloplanktis TAC125]
 gi|123589450|sp|Q3IL20|DAPE_PSEHT RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|76875185|emb|CAI86406.1| Succinyl-diaminopimelate desuccinylase (SDAP) [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 376

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 159/386 (41%), Positives = 222/386 (57%), Gaps = 13/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT D +     LI+  SVTP+D G   ++ + L+ +GF+IE   F         N +AR 
Sbjct: 1   MTNDVIALAQALIQRESVTPEDAGCQQMMNDRLQAVGFNIESLFFTD-----TLNTWARK 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT++PH  FAGH DVVP G   +W YPPFS  +  G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GTQSPHFCFAGHTDVVPTGPEKNWQYPPFSGLVENGLLHGRGAADMKGSLAAMLVATERF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + K+ +  GSIS LIT DEEGP INGT +++  +E +GEK D C+VGEP+   ++GD +K
Sbjct: 116 VTKHPDHKGSISFLITSDEEGPFINGTTRVIDTLEARGEKIDMCLVGEPSSRDVLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+G +T+ G QGHVAYP L +NPI    P L +L+   +D GN  F  T+ +I+
Sbjct: 176 NGRRGSLTGFLTVKGIQGHVAYPQLAQNPIHLTTPALTELSQTVWDHGNEYFPATSFQIS 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NVIP ++++ FN RF+       L++ + + L +   N     + + +   
Sbjct: 236 NINGGTGAGNVIPGELEVQFNFRFSTEVTHTQLQQRVNAILQQHNLN-----YELSWIVN 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT    L     K+I + TG    L T+GGTSD RFI      VIE G    T+H
Sbjct: 291 GQP-FLTEHGPLVDATVKAIKSVTGLTTNLETTGGTSDGRFIAQTGAKVIELGPRNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E  S  DL  L  IYE  L+N  
Sbjct: 350 KVDECVSTDDLIALCDIYEQILENLL 375


>gi|121594425|ref|YP_986321.1| succinyl-diaminopimelate desuccinylase [Acidovorax sp. JS42]
 gi|238055195|sp|A1W7M0|DAPE_ACISJ RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|120606505|gb|ABM42245.1| succinyldiaminopimelate desuccinylase [Acidovorax sp. JS42]
          Length = 391

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 154/393 (39%), Positives = 217/393 (55%), Gaps = 18/393 (4%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+P  L    QLI  PSVTP D G   +L   L  LGF+ E  D   +N   V NL+++ 
Sbjct: 1   MSPTLL-LTEQLIARPSVTPDDAGCLDLLARRLAPLGFACERLDSGPENF-RVSNLWSKR 58

Query: 61  G--------TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIAC 112
                         ++FAGH DVVP G    W+ PPF+ T  +G++YGRG  DMK SIA 
Sbjct: 59  SAALSGQAQAATKTVVFAGHTDVVPTGPVEQWSSPPFTPTHRDGRLYGRGASDMKASIAA 118

Query: 113 FIAAVARFIPKYKNFG-SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCN 171
           F+ AV  F+    +    I+LL+T DEEGP+++GTK ++  +  +GE+ D CIVGEPT  
Sbjct: 119 FVVAVEEFLAATPDPRLDIALLLTSDEEGPSVDGTKVVIEQLRARGERLDWCIVGEPTSV 178

Query: 172 HIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTF 231
              GD IK GRRG+LSG +T+ G QGH+AYP L  NPI   +P L +L    +D GN  F
Sbjct: 179 EQTGDMIKNGRRGTLSGRLTVRGVQGHIAYPQLARNPIHQAVPALTELAATVWDMGNAFF 238

Query: 232 SPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLS 291
            PT+ +++ I  G  + NVIP QV + FN RF+     + L++ + + L +         
Sbjct: 239 PPTSWQMSNIHGGTGATNVIPGQVVIDFNFRFSTESTAEGLQQRVHAVLDRHGLE----- 293

Query: 292 HTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEF 350
           + + ++    P   T   +L   + ++I   TG    LST+GGTSD RFI   CP VIE 
Sbjct: 294 YDLTWTLGGQPFLTTP-GELVQAVQQAIRAETGLETELSTTGGTSDGRFIAQICPQVIEL 352

Query: 351 GLVGRTMHALNENASLQDLEDLTCIYENFLQNW 383
           G    ++H ++EN  L D+E L  IY   L++ 
Sbjct: 353 GPPNASIHKIDENVRLVDIEPLKNIYRRTLEHL 385


>gi|238919136|ref|YP_002932650.1| succinyl-diaminopimelate desuccinylase [Edwardsiella ictaluri
           93-146]
 gi|238868704|gb|ACR68415.1| succinyl-diaminopimelate desuccinylase, putative [Edwardsiella
           ictaluri 93-146]
          Length = 377

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 152/381 (39%), Positives = 222/381 (58%), Gaps = 13/381 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L    QLI+CPS++P D G   IL+  L+ L F IEE            NL+A  G   
Sbjct: 6   VLTLAQQLIRCPSISPNDAGCQEILLARLRALDFHIEEMPRGDTR-----NLWAWRGGNG 60

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P L FAGH DVVPPGD   W +PPFS T+ +G +YGRG  DMKGS+A  + A  RF+   
Sbjct: 61  PVLAFAGHTDVVPPGDERQWRHPPFSPTLQDGMLYGRGAADMKGSLAAMVVAAERFVSAR 120

Query: 125 K-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
             + G ++ LIT DEE  A+NGT +++  +  +GE+ D C+VGEP+    +GD +K GRR
Sbjct: 121 PEHRGRLAFLITSDEEASAVNGTVRVVEALMARGERLDYCLVGEPSSERCLGDVVKNGRR 180

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++  +TIHG QGHVAYPHL +NP+   +P+L +L  I +D GN  F PT+++I  I  
Sbjct: 181 GSITANLTIHGTQGHVAYPHLADNPVHRAMPMLAELIAIEWDRGNDFFPPTSLQIANIAA 240

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  S NVIP  + + FN+RF+   + +++++ + + L         L +T+++S    P 
Sbjct: 241 GTGSNNVIPGDLDVQFNLRFSTESSVESIQQRVTALL-----ERHGLRYTLNWSLSGLP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
           FLT   +L   +  ++    G  P L T+GGTSD RFI      V+E G +  T+H +NE
Sbjct: 295 FLTPGGELVDAVVNAVACYGGQTPRLLTTGGTSDGRFIARMGAQVVELGPLNATIHKVNE 354

Query: 363 NASLQDLEDLTCIYENFLQNW 383
             S  DL+ L+ +Y+  ++  
Sbjct: 355 CVSAADLQSLSRMYQRIMEQL 375


>gi|58698595|ref|ZP_00373493.1| succinyl-diaminopimelate desuccinylase [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|58534891|gb|EAL58992.1| succinyl-diaminopimelate desuccinylase [Wolbachia endosymbiont of
           Drosophila ananassae]
          Length = 382

 Score =  244 bits (621), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 165/385 (42%), Positives = 222/385 (57%), Gaps = 11/385 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D +E   +LI   S+TP+DGGA   +    K  GF  E  +F  K    VKNLYA++
Sbjct: 1   MKIDPVELTKKLISFESITPRDGGAIEYIATIFKKSGFDCEILEFGDK----VKNLYAKY 56

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIA-AVAR 119
               P+L FAGH+DVVPPG    W + PF+  + +G +YGRG  DMK  +A FIA  V  
Sbjct: 57  INGVPNLCFAGHVDVVPPGQLKDWAFGPFNPEVRDGILYGRGAADMKSGVAAFIAAMVNL 116

Query: 120 FIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
              K++  GSIS LIT  EE     GTK +L W++ K +K D C+V EPT +  +GDTIK
Sbjct: 117 IAEKFQFNGSISALITSAEESTEEYGTKAVLEWMKSKQKKVDFCVVAEPTSSEKLGDTIK 176

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGS++ E+  HGKQGHVAYP L +NPI  +I +L ++ N  FD GN  F P++ E+T
Sbjct: 177 IGRRGSVTFELICHGKQGHVAYPDLADNPIYKVISILSKVKNTTFDHGNKYFQPSHCEVT 236

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           TIDVGN + N+IP      FNIR+N+      L + I         +     H+      
Sbjct: 237 TIDVGNNTSNLIPGLATTRFNIRYNNEQTPGGLYKLIDEICSSVTNDYKLSVHSSRDVFL 296

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
            +P   T       ++  +I   T     LSTSGGTSDA FIKD CPVIEFG++ +T H 
Sbjct: 297 STPDRNT------DIMLDAINKVTSIDAALSTSGGTSDAAFIKDVCPVIEFGIINKTAHQ 350

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           +NE   + D+  LT IY+ F++N+ 
Sbjct: 351 INECVLVNDIHKLTAIYKEFIENYL 375


>gi|94310362|ref|YP_583572.1| succinyl-diaminopimelate desuccinylase [Cupriavidus metallidurans
           CH34]
 gi|238064782|sp|Q1LNH3|DAPE_RALME RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|93354214|gb|ABF08303.1| N-succinyl-diaminopimelate deacylase [Cupriavidus metallidurans
           CH34]
          Length = 383

 Score =  244 bits (621), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 160/389 (41%), Positives = 217/389 (55%), Gaps = 14/389 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYA-- 58
           M P  L     LI+  SVTP D G   +L   LK LGF+ E       +   V NL+A  
Sbjct: 1   MNP-TLALTEDLIRRRSVTPADEGCQAVLETRLKALGFTCENIVSGPDDF-RVTNLWAVK 58

Query: 59  --RFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAA 116
               GT    L FAGH DVVP G  + W+  PF  +  +GK+YGRG  DMK SIA F+ A
Sbjct: 59  RGTQGTAGKLLAFAGHTDVVPTGPLDQWSSDPFEPSHRDGKLYGRGAADMKTSIAGFVVA 118

Query: 117 VARFIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIG 175
           V  F+ K+  + GSI+ LIT DEEGPA +GT K++  ++ +GE+ D C+VGEPT    +G
Sbjct: 119 VEEFVAKHPEHKGSIAFLITSDEEGPAHDGTVKVVEALKARGERLDYCVVGEPTSVDTLG 178

Query: 176 DTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTN 235
           D +K GRRGSLSG++T+ G QGH+AYPHL  NPI    P L  L N  +D GN  F PT 
Sbjct: 179 DMVKNGRRGSLSGKLTVKGVQGHIAYPHLARNPIHLAAPALTTLVNEVWDAGNEYFPPTT 238

Query: 236 MEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVH 295
            +++ I  G  + NVIP  V + FN RF+       LK  + + L +   +     +T+ 
Sbjct: 239 WQMSNIHGGTGATNVIPGHVTIDFNFRFSTASTPDGLKSRVHAILDQHGLD-----YTLD 293

Query: 296 FSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVG 354
           ++    P FLT    L+  L  +I   TG    LST+GGTSD RFI   CP VIEFG   
Sbjct: 294 WTLGGEP-FLTPRGDLSEALGAAIAAETGVKTELSTTGGTSDGRFIAKICPQVIEFGPPN 352

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNW 383
            ++H ++E+  ++ +E L  +Y   L+  
Sbjct: 353 ASIHKIDEHVEVRFVEPLKNVYRGVLERL 381


>gi|204929618|ref|ZP_03220692.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|204321337|gb|EDZ06537.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
          Length = 375

 Score =  244 bits (621), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 151/385 (39%), Positives = 220/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF+IE  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRKIGFTIEHMDFGDTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GRGE-TLAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ +  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPHHRGRLAFLITSDEEASAKNGTVKVVEALMARNERLDYCLVGEPSSTEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M++ 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDRGNDFFPATSMQVA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +KE + + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKERVHALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|304414141|ref|ZP_07395509.1| N-succinyl-diaminopimelate deacylase [Candidatus Regiella
           insecticola LSR1]
 gi|304283355|gb|EFL91751.1| N-succinyl-diaminopimelate deacylase [Candidatus Regiella
           insecticola LSR1]
          Length = 393

 Score =  244 bits (621), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 160/386 (41%), Positives = 221/386 (57%), Gaps = 14/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT   ++   QLIK PSV+P D G   IL   LK +GF+IE  +F        KN  A  
Sbjct: 18  MTCPVIKLAKQLIKRPSVSPADEGCQEILTQRLKAIGFTIEPMNFAD-----TKNFCAWR 72

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVPPGD N W +PPF  TI  G +YGRG  DMKGS+A  + A  RF
Sbjct: 73  GE-GKTLAFAGHTDVVPPGDENRWDFPPFEPTIRNGMLYGRGAADMKGSLAAMVVAAERF 131

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           I    N+ G +  LIT DEE  A NGT K++  ++ + E+ D C+VGEP+ N  +GD +K
Sbjct: 132 ITVNPNYIGRLVFLITSDEEAKATNGTVKVVEVLQAREERLDYCLVGEPSSNKCLGDVVK 191

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++  ++IHG QGHVAYPHL +NPI   +P+L +L +I +D GN +F  T+M+I 
Sbjct: 192 NGRRGSMTANLSIHGVQGHVAYPHLAKNPIHWALPMLQELVSIQWDKGNVSFPSTSMQIA 251

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    E  +K+ + + L        +L++++ +   
Sbjct: 252 NIQAGTGSNNVIPGELFVQFNFRFSTELTESMIKQRVETLL-----EQYRLNYSIDWVVS 306

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P FLT    L   +  ++    G  P LST+GGTSD RFI      V+E G V  T+H
Sbjct: 307 GQP-FLTEKGDLVDAVINAVRCYNGITPELSTAGGTSDGRFIALLGAQVVELGPVNETIH 365

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            +NE     DL+ L+ IY+  ++   
Sbjct: 366 KVNECVKAADLQLLSRIYQRIMERIL 391


>gi|149374443|ref|ZP_01892217.1| succinyl-diaminopimelate desuccinylase [Marinobacter algicola
           DG893]
 gi|149361146|gb|EDM49596.1| succinyl-diaminopimelate desuccinylase [Marinobacter algicola
           DG893]
          Length = 382

 Score =  244 bits (621), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 157/383 (40%), Positives = 214/383 (55%), Gaps = 14/383 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L+  + LI+ PSVTP D G   ++++ L  LGF  E   F   +     NL+AR G++ 
Sbjct: 12  TLKLAVDLIRRPSVTPDDAGCQELMMSRLAALGFKGEALRFGETD-----NLWARKGSDG 66

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P L FAGH DVVP G   +W +PPF A I +G ++GRG  DMKGS+A FI A  RF+  +
Sbjct: 67  PLLAFAGHTDVVPTGPEKNWRHPPFEAVIDDGFLHGRGAADMKGSLAAFITACERFVTSH 126

Query: 125 K-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
             + GSI+LLIT DEEGPA +GT K++  +E + EK D C++GEP+    +GD IK GRR
Sbjct: 127 PDHRGSIALLITSDEEGPAQDGTVKVVETLEARNEKIDWCLIGEPSSTREVGDVIKNGRR 186

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL G +T+ G QGHVAYPHL ENP+  + P L  L    +D GN  F PT  +IT I+ 
Sbjct: 187 GSLHGYLTVQGTQGHVAYPHLAENPVHTVAPALDALAKEFWDDGNDFFPPTTFQITKIEA 246

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  S N+IP +  + FN R+      ++L+E + + L +         + + +     P 
Sbjct: 247 GTGS-NIIPGECLVHFNFRYCTENTAESLEERVVAILDRHELK-----YDLQWHLSGRPF 300

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
                  L S    +I + TG    LSTSGGTSD RFI      V+E G +  T+H +NE
Sbjct: 301 LTD-SGSLVSAAQSAIRSVTGRETELSTSGGTSDGRFIAPTGAQVLELGPINATIHKVNE 359

Query: 363 NASLQDLEDLTCIYENFLQNWFI 385
                DL  L+ IYE  L     
Sbjct: 360 CVKAADLNTLSEIYEQVLVELLA 382


>gi|323967915|gb|EGB63327.1| succinyl-diaminopimelate desuccinylase [Escherichia coli M863]
 gi|325496498|gb|EGC94357.1| N-succinyl-diaminopimelate deacylase [Escherichia fergusonii
           ECD227]
 gi|327252121|gb|EGE63793.1| succinyl-diaminopimelate desuccinylase [Escherichia coli STEC_7v]
          Length = 375

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 152/385 (39%), Positives = 221/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   I++  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQAIMIERLQAIGFTVERMDFADTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|330445308|ref|ZP_08308960.1| succinyl-diaminopimelate desuccinylase [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328489499|dbj|GAA03457.1| succinyl-diaminopimelate desuccinylase [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 376

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 155/379 (40%), Positives = 217/379 (57%), Gaps = 13/379 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            +     L+  PSVTP+D G   +++  L+ LGF+IE   F+        NL+AR GT+A
Sbjct: 6   VIALAKDLMSRPSVTPEDAGCQDVMIARLEQLGFTIETMVFED-----TTNLWARRGTQA 60

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P  +FAGH DVVP G    W  PPF  TI +G ++GRG  DMKGS+AC I A+ RFI + 
Sbjct: 61  PLFVFAGHTDVVPSGPVEQWHTPPFEPTIIDGYLHGRGAADMKGSLACMIVAIERFIAEN 120

Query: 125 K-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
             + GSI+LLIT DEEGP INGT +++  +E + EK D CIVGEP+    +GD +K GRR
Sbjct: 121 PDHNGSIALLITSDEEGPFINGTTRVVDTLEARNEKIDMCIVGEPSSTLNVGDVVKNGRR 180

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++G++T+ G QGHVAYPHL  NP+   +P L +L    +D GN  F PT+ +I  I  
Sbjct: 181 GSITGDLTVKGIQGHVAYPHLANNPVHKALPALAELAATTWDNGNEYFPPTSFQIPNIAA 240

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NVIP + ++ FN RF+    +  +K  + S L     +   L + + ++    P 
Sbjct: 241 GTGASNVIPGEFQVQFNFRFSTELTDTEIKRRVHSVL-----DAHGLDYDLKWTLSGHPF 295

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
                  L   +  +I       P L T+GGTSD RFI      V+E G V  T+H +NE
Sbjct: 296 LTDK-GTLVEAVVAAIEEVNHQQPELLTTGGTSDGRFIARTGAQVVELGPVNATIHKVNE 354

Query: 363 NASLQDLEDLTCIYENFLQ 381
              + DLE LT +Y+  L+
Sbjct: 355 CVKVADLEKLTDMYQKVLE 373


>gi|254439436|ref|ZP_05052930.1| succinyl-diaminopimelate desuccinylase [Octadecabacter antarcticus
           307]
 gi|198254882|gb|EDY79196.1| succinyl-diaminopimelate desuccinylase [Octadecabacter antarcticus
           307]
          Length = 380

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 158/386 (40%), Positives = 221/386 (57%), Gaps = 9/386 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  D +   + LI+CP+VTP +GGA  +L   L   GF     D      +   NL+AR+
Sbjct: 1   MPVDPIALTVDLIRCPTVTPTEGGALQLLDRLLSDAGFETWRVD-----RAGTPNLFARW 55

Query: 61  GTEA--PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVA 118
           G         F GH DVVP GD   WT  PF   I +G +YGRG  DMK  +A F AA  
Sbjct: 56  GARGANKSFGFNGHTDVVPVGDAAAWTVDPFGGEICDGVLYGRGATDMKSGVAAFAAAAI 115

Query: 119 RFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
            F+      G+I L IT DEEGP+ +GT  +L W+   GE   ACIVGEPTC  ++G+ I
Sbjct: 116 DFVQVTPPDGAIILAITCDEEGPSTDGTIALLDWMRSHGEAMTACIVGEPTCPDVMGEMI 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K+GRRGSL+   T+ GKQGH AYPH   NP+  ++ L+ +L +   D G+  F P+ + +
Sbjct: 176 KVGRRGSLTSHFTVTGKQGHSAYPHRANNPLPAMVRLMDRLASYEMDKGSDHFDPSTLAV 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
            TID GNP+ NVIPA  K S N+RFNDL   +++   ++  +     +           S
Sbjct: 236 VTIDTGNPATNVIPAICKASANVRFNDLHTSQSVIAWMQGEVDVVAADFGVQIDMACRVS 295

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMH 358
                F+T   +L+ L+  ++   TG  P LST+GGTSDARF+KD+CPV+E GLVG+TMH
Sbjct: 296 G--ESFITPPGELSDLVCAAVLAETGMTPELSTTGGTSDARFVKDHCPVVEVGLVGKTMH 353

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E   ++ +  L  IY+  L+++F
Sbjct: 354 QVDECVPVEQITQLKAIYDRILRSYF 379


>gi|16765803|ref|NP_461418.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|161502366|ref|YP_001569478.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|161612767|ref|YP_001586732.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167991788|ref|ZP_02572887.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168238211|ref|ZP_02663269.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168243256|ref|ZP_02668188.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168261482|ref|ZP_02683455.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|194446769|ref|YP_002041742.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194450617|ref|YP_002046546.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194733983|ref|YP_002115545.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197262106|ref|ZP_03162180.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|198245701|ref|YP_002216550.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|205353586|ref|YP_002227387.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207857894|ref|YP_002244545.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|81522296|sp|Q8ZN75|DAPE_SALTY RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName: Full=Aspartyl peptidase;
           AltName: Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238055209|sp|B5FQH3|DAPE_SALDC RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238055210|sp|B5R4J0|DAPE_SALEP RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238055211|sp|B5RCV3|DAPE_SALG2 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238055212|sp|B4TD58|DAPE_SALHS RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238055213|sp|B4T0L0|DAPE_SALNS RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238055214|sp|A9N2Z9|DAPE_SALPB RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238055216|sp|B4TR55|DAPE_SALSV RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064816|sp|A9MHQ8|DAPE_SALAR RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|16421025|gb|AAL21377.1| N-succinyl-diaminopimelate deacylase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|160863713|gb|ABX20336.1| hypothetical protein SARI_00399 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|161362131|gb|ABX65899.1| hypothetical protein SPAB_00466 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194405432|gb|ACF65654.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194408921|gb|ACF69140.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194709485|gb|ACF88706.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197240361|gb|EDY22981.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197288943|gb|EDY28316.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|197940217|gb|ACH77550.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|205273367|emb|CAR38339.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205329839|gb|EDZ16603.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205337585|gb|EDZ24349.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205349336|gb|EDZ35967.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|206709697|emb|CAR34047.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|261247683|emb|CBG25510.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267994593|gb|ACY89478.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301159035|emb|CBW18548.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312913471|dbj|BAJ37445.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|320086975|emb|CBY96745.1| N-succinyl-diaminopimelate deacylase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|321222815|gb|EFX47886.1| N-succinyl-L,L-diaminopimelate desuccinylase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. TN061786]
 gi|322613778|gb|EFY10717.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322619479|gb|EFY16355.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322624984|gb|EFY21813.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322629573|gb|EFY26349.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322633997|gb|EFY30734.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322635565|gb|EFY32276.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322644381|gb|EFY40922.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322652092|gb|EFY48454.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322655255|gb|EFY51564.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322658302|gb|EFY54568.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322664302|gb|EFY60499.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322669470|gb|EFY65619.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322673197|gb|EFY69303.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322676588|gb|EFY72656.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322683339|gb|EFY79353.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322685775|gb|EFY81768.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323130813|gb|ADX18243.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323192547|gb|EFZ77776.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323199593|gb|EFZ84684.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323201249|gb|EFZ86317.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323208079|gb|EFZ93024.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323210198|gb|EFZ95099.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323217064|gb|EGA01786.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323220597|gb|EGA05046.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323225483|gb|EGA09714.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323229247|gb|EGA13371.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323235438|gb|EGA19522.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323237376|gb|EGA21439.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323245131|gb|EGA29132.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323248834|gb|EGA32760.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323253121|gb|EGA36953.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323255920|gb|EGA39665.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323260962|gb|EGA44559.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323266398|gb|EGA49886.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323269771|gb|EGA53221.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326624305|gb|EGE30650.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326628683|gb|EGE35026.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
 gi|332989411|gb|AEF08394.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 375

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 152/385 (39%), Positives = 220/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF+IE  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRKIGFTIEHMDFGDTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GRGE-TLAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ +  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   I+GD +K
Sbjct: 115 VAQHPHHRGRLAFLITSDEEASAKNGTVKVVEALMARNERLDYCLVGEPSSTEIVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M++ 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDRGNDFFPATSMQVA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +KE + + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKERVHALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|222111085|ref|YP_002553349.1| succinyl-diaminopimelate desuccinylase [Acidovorax ebreus TPSY]
 gi|238064731|sp|B9MJL1|DAPE_DIAST RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|221730529|gb|ACM33349.1| succinyl-diaminopimelate desuccinylase [Acidovorax ebreus TPSY]
          Length = 391

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 157/393 (39%), Positives = 217/393 (55%), Gaps = 18/393 (4%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLY--- 57
           M+P  L    QLI  PSVTP D G   +L   L  LGF+ E  D   +N   V NL+   
Sbjct: 1   MSPTLL-LTEQLIAHPSVTPDDAGCLDLLARRLAPLGFACERLDSGPENF-RVSNLWSKR 58

Query: 58  --ARFGTEA---PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIAC 112
             AR G        ++FAGH DVVP G    W+ PPF+ T  +G++YGRG  DMK SIA 
Sbjct: 59  TAARSGQAQAATKTVVFAGHTDVVPTGPVEQWSSPPFTPTHRDGRLYGRGASDMKASIAA 118

Query: 113 FIAAVARFIPKYKNFG-SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCN 171
           F+ AV  F+    +    I+LL+T DEEGP+++GTK ++  +  +GE+ D CIVGEPT  
Sbjct: 119 FVVAVEEFLAATPDPRLDIALLLTSDEEGPSVDGTKVVIEQLRARGERLDWCIVGEPTSV 178

Query: 172 HIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTF 231
              GD IK GRRG+LSG +T+ G QGH+AYP L  NPI   +P L +L    +D GN  F
Sbjct: 179 EQTGDMIKNGRRGTLSGRLTVRGVQGHIAYPQLARNPIHQAVPALTELAATVWDEGNAFF 238

Query: 232 SPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLS 291
            PT+ +++ I  G  + NVIP QV + FN RF+     + L++ + + L +         
Sbjct: 239 PPTSWQMSNIHGGTGATNVIPGQVVIDFNFRFSTESTAEGLQQRVHAVLDRHGLE----- 293

Query: 292 HTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEF 350
           + + ++    P   T   +L   + ++I   TG    LST+GGTSD RFI   CP VIE 
Sbjct: 294 YDLTWTLGGQPFLTTP-GELVQAVQQAIRAETGLETELSTTGGTSDGRFIAQICPQVIEL 352

Query: 351 GLVGRTMHALNENASLQDLEDLTCIYENFLQNW 383
           G    ++H ++EN  L D+E L  IY   L + 
Sbjct: 353 GPPNASIHKIDENVRLVDIEPLKNIYRRTLDHL 385


>gi|294085064|ref|YP_003551824.1| acetylornithine deacetylase-like protein [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292664639|gb|ADE39740.1| Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase
           and related deacylase [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 392

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 174/389 (44%), Positives = 230/389 (59%), Gaps = 17/389 (4%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA- 64
           ++   +LI+CPSVTP D GA  +LV  L  LGF      F   +   + NL+A  G +A 
Sbjct: 8   VDLTQRLIRCPSVTPADAGALDVLVTELTALGFECTRLAFGDGDA-RIDNLFAWLGNKAA 66

Query: 65  -----PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
                 H  FAGH DVVP GD + W + PFS T+ +G IYGRG  DMKG IA F+ AVAR
Sbjct: 67  SGTETKHFCFAGHTDVVPVGDADAWQFDPFSGTLDQGNIYGRGASDMKGGIAAFVGAVAR 126

Query: 120 FIPKYKNF----GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIG 175
            + +         +ISL+ITGDEEG A+NGT KM+ W+++ G   D C+VGEPT    +G
Sbjct: 127 LLARDSFDPAKGHAISLMITGDEEGDAVNGTVKMVEWVQEHGFVPDFCVVGEPTNPDAVG 186

Query: 176 DTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTN 235
           D IK GRRGSLS ++T+ G QGHVAYPHL +NP   L+ +L  + +   D GN  F P+ 
Sbjct: 187 DVIKNGRRGSLSCQLTVEGAQGHVAYPHLADNPFARLLDMLAPVNSCELDGGNAFFDPST 246

Query: 236 MEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVH 295
             IT+ID  NP+ NVIPA+ +  FNIRFN      +L   +     +             
Sbjct: 247 ANITSIDTNNPAGNVIPARAQARFNIRFNTEHTADSLIGWLEEHFTRVG-----GIWHAD 301

Query: 296 FSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGR 355
           + +   P  LT    LT ++  +I   TG  P LSTSGGTSDARFI   CPV EFGLVGR
Sbjct: 302 WRASAHPF-LTEPGMLTDIMIAAISKVTGRDPQLSTSGGTSDARFITTLCPVAEFGLVGR 360

Query: 356 TMHALNENASLQDLEDLTCIYENFLQNWF 384
           TMH ++E+ ++ D++ L+ IYEN L ++F
Sbjct: 361 TMHKVDEHTAIADIDVLSAIYENMLASYF 389


>gi|56412635|ref|YP_149710.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|62181048|ref|YP_217465.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|197361570|ref|YP_002141206.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|224582985|ref|YP_002636783.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|75481765|sp|Q57LM8|DAPE_SALCH RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|81361651|sp|Q5PLR5|DAPE_SALPA RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238055215|sp|B5BB22|DAPE_SALPK RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|254767084|sp|C0PYS5|DAPE_SALPC RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|56126892|gb|AAV76398.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|62128681|gb|AAX66384.1| N-succinyl-diaminopimelate deacylase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|197093046|emb|CAR58484.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|224467512|gb|ACN45342.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|322715531|gb|EFZ07102.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
          Length = 375

 Score =  243 bits (620), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 152/385 (39%), Positives = 220/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF+IE  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRKIGFTIEHMDFGDTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GRGE-TLAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ +  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   I+GD +K
Sbjct: 115 VAQHPHHRGRLAFLITSDEEASAKNGTVKVVEALMARNERLDYCLVGEPSSTEIVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M++ 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDRGNDFFPATSMQVA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +KE + + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEIIKERVHALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|88859997|ref|ZP_01134636.1| Succinyl-diaminopimelate desuccinylase (SDAP) [Pseudoalteromonas
           tunicata D2]
 gi|88817991|gb|EAR27807.1| Succinyl-diaminopimelate desuccinylase (SDAP) [Pseudoalteromonas
           tunicata D2]
          Length = 377

 Score =  243 bits (619), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 157/388 (40%), Positives = 220/388 (56%), Gaps = 14/388 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           M+  + +     LI+ PSVTP+D G   ++   LK LGFSIEE  F         N++AR
Sbjct: 1   MSQSEVITLAQALIQRPSVTPKDEGCQTLMAERLKKLGFSIEELFFVDTQ-----NMWAR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            G ++P   FAGH DVVP G  N W   PF+AT+ +G ++GRG  DMKGS+A  I A  R
Sbjct: 56  KGQQSPLFCFAGHTDVVPTGPINAWHLDPFAATVQDGYLHGRGAADMKGSLAAMIVATER 115

Query: 120 FIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           FI  + +  GSI+ LIT DEEGP INGT +++  +E + EK D C+VGEP+  H +GD +
Sbjct: 116 FITDFPDHKGSIAFLITSDEEGPFINGTTRVIDVLEARNEKIDLCLVGEPSSTHQVGDVV 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSL+G +T+ G QGHVAYP L +NPI  + P L +L+   +D GN  F  T+ +I
Sbjct: 176 KNGRRGSLTGFVTVKGIQGHVAYPQLAKNPIHLVSPALTELSQTVWDQGNAFFPATSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I  G  + NVIP ++ + FN RF+     + L+  + S L     +     + +++  
Sbjct: 236 SNIQAGTGAGNVIPGELDVQFNFRFSTEVTVEQLQVRVVSIL-----DHYGFDYDINWII 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTM 357
              P  LT +  L     K+I         L T+GGTSD RFI      V+E G    T+
Sbjct: 291 NGLPF-LTAEGSLVEATVKAIKQVQHIETSLETTGGTSDGRFIAQTGAQVVELGPCNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H +NE  S++DLE LT IY + L+    
Sbjct: 350 HKVNECVSIEDLERLTDIYYHILREILA 377


>gi|161870391|ref|YP_001599563.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           053442]
 gi|238064800|sp|A9M0W6|DAPE_NEIM0 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|161595944|gb|ABX73604.1| succinyl-diaminopimelate desuccinylase [Neisseria meningitidis
           053442]
          Length = 381

 Score =  243 bits (619), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 169/391 (43%), Positives = 225/391 (57%), Gaps = 14/391 (3%)

Query: 1   MTP-DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    LE    LI  PSVTP D     +LV  L  +GF+ EE  F        KN++ R
Sbjct: 1   MTETQSLELAKALISRPSVTPDDRDCQKLLVERLYKIGFAAEELHFGD-----TKNIWLR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GT+ P + FAGH DVVP G    W  PPF  T  +G++YGRG  DMK SIACF+ A  R
Sbjct: 56  RGTKVPVVCFAGHTDVVPTGPVEKWDSPPFEPTERDGRLYGRGAADMKTSIACFVTACER 115

Query: 120 FIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+ ++  + GSI+LLIT DEEG A++GT K++  ++ +GE  D CIVGEPT    +GD I
Sbjct: 116 FVAEHPDHQGSIALLITSDEEGDALDGTTKVVDVLKARGELIDYCIVGEPTAVDKLGDMI 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I
Sbjct: 176 KNGRRGSLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNKYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + I+ G  + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S 
Sbjct: 236 SNINGGTGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDK-----HGVQYDLQWSC 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTM 357
              P FLT   KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+
Sbjct: 291 SGQP-FLTQAGKLTDVARAAIAETCGIEAELSTTGGTSDGRFIKAIAKELIELGPSNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFITPS 388
           H +NEN  L D+  L+ +YE  L       +
Sbjct: 350 HQINENVRLNDIPKLSAVYEGILARLLAGNA 380


>gi|315497923|ref|YP_004086727.1| succinyl-diaminopimelate desuccinylase [Asticcacaulis excentricus
           CB 48]
 gi|315415935|gb|ADU12576.1| succinyl-diaminopimelate desuccinylase [Asticcacaulis excentricus
           CB 48]
          Length = 384

 Score =  243 bits (619), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 170/383 (44%), Positives = 223/383 (58%), Gaps = 10/383 (2%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           T D +E    LI  PSVTP D GA   +  TL+ LGF+ E   F+      ++NLYAR G
Sbjct: 8   TLDPVELTKALINHPSVTPVDAGAMDRVQQTLESLGFACERLKFRE-----IENLYARRG 62

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
           T +P+L FAGH DVVP G  + W   PF+ATI  G + GRG VDMKG IA +IAAV+RF 
Sbjct: 63  TASPNLCFAGHTDVVPEGALDGWRSDPFAATIENGVLTGRGAVDMKGGIAAWIAAVSRF- 121

Query: 122 PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
                 GS+S LITGDEEG A++GTKK++  + + GE  D CIVGEPT + ++GD IK+G
Sbjct: 122 --DNVPGSLSFLITGDEEGEALDGTKKVVEHLRQTGEVIDHCIVGEPTSSAVLGDMIKVG 179

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGS++  IT+ GKQGHVAYP    NPI  L+ ++ +L     D G   F P+N+EITT 
Sbjct: 180 RRGSINATITVTGKQGHVAYPQRALNPIPVLVAVMAELDGRVLDEGYERFLPSNLEITTF 239

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
           DV N + N+IP       NIRFN   +  +L+  I   +             V  +    
Sbjct: 240 DVANKTTNLIPQTASGRINIRFNPTHSGASLQAWIEE-VCARHAERSGAVIEVKAAISGE 298

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALN 361
              LT       ++  +I +        ST+GGTSDARFI+  CPV+EFGLVG+TMH +N
Sbjct: 299 AF-LTEAGPFVDVIQNAILDVLKVEADPSTTGGTSDARFIRALCPVVEFGLVGQTMHQVN 357

Query: 362 ENASLQDLEDLTCIYENFLQNWF 384
           E   +QDL  LT  Y   +  +F
Sbjct: 358 EATPVQDLYALTEAYTALISKYF 380


>gi|217970598|ref|YP_002355832.1| succinyl-diaminopimelate desuccinylase [Thauera sp. MZ1T]
 gi|217507925|gb|ACK54936.1| succinyl-diaminopimelate desuccinylase [Thauera sp. MZ1T]
          Length = 385

 Score =  243 bits (619), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 155/383 (40%), Positives = 217/383 (56%), Gaps = 13/383 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L    +LI  PSVTP+D G   ++ + L  LGF +E  D     +  V NL+AR G  A
Sbjct: 10  TLALACELIARPSVTPEDAGCLELVASRLAPLGFRLERID-----SGGVCNLWARRGIAA 64

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P L FAGH DVVPPG  + W+ PPF+ TI +G +YGRG  DMK S+A F+ A+ RF+  +
Sbjct: 65  PVLCFAGHTDVVPPGPDSAWSSPPFAPTIRDGVLYGRGAADMKSSLAAFVTAIERFVAAH 124

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
            +  GSI+LL+T DEEG A +GT K++  +  +GE+ D C+VGEPT    +GD IK GRR
Sbjct: 125 PDHAGSIALLLTSDEEGIATHGTVKVVEALAARGERLDYCVVGEPTSVQTLGDMIKNGRR 184

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSLSG + + G+QGHVAYP L  NPI    P L +L    +D GN  F PT  +++ I  
Sbjct: 185 GSLSGTLRVKGQQGHVAYPQLARNPIHLFAPALAELAASDWDQGNEFFPPTTWQVSNIHA 244

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NVIP   ++ FN RF  + +   LK      L +   +     + + +     P 
Sbjct: 245 GTGANNVIPGVCEVMFNFRFGSVSSADELKSRTCEVLDRHGLD-----YEIDWHLSGKPF 299

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNE 362
                 +L   LS +I  T G    LST+GGTSD RFI + C  V+EFG V  ++H ++E
Sbjct: 300 ITG-RGRLVGALSAAIRETLGVETELSTTGGTSDGRFIAEICAEVVEFGPVNASIHKIDE 358

Query: 363 NASLQDLEDLTCIYENFLQNWFI 385
           + +   +E L+ +YE  L    +
Sbjct: 359 HIAADAIEPLSVVYERTLTALLV 381


>gi|167549502|ref|ZP_02343261.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|168466774|ref|ZP_02700628.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197251549|ref|YP_002147435.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|200386710|ref|ZP_03213322.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|238913620|ref|ZP_04657457.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|238064815|sp|B5F0L0|DAPE_SALA4 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|195630741|gb|EDX49333.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197215252|gb|ACH52649.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|199603808|gb|EDZ02353.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|205325344|gb|EDZ13183.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
          Length = 375

 Score =  243 bits (619), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 152/385 (39%), Positives = 220/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF+IE  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRKIGFTIEHMDFGDTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GRGE-TLAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ +  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   I+GD +K
Sbjct: 115 VAQHPHHRGRLAFLITSDEEASAKNGTVKVVEALMARHERLDYCLVGEPSSTEIVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M++ 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDRGNDFFPATSMQVA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +KE + + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKERVHALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|291333837|gb|ADD93520.1| succinyl diaminopimelate desuccinylase [uncultured marine bacterium
           MedDCM-OCT-S04-C13]
          Length = 376

 Score =  243 bits (619), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 157/387 (40%), Positives = 220/387 (56%), Gaps = 13/387 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    L    QL+   SVTP+D G   ++++ L  +GF      F       V NL+A  
Sbjct: 1   MDSATLALTKQLVARQSVTPEDDGCQTLMIDRLAKIGFETTPLRFDD-----VDNLWAIR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT  P L FAGH DVVP G   HW YPPF  T A+G++YGRG  DMKGS+A  + AV +F
Sbjct: 56  GTGGPILCFAGHTDVVPTGPEEHWRYPPFQPTEADGQLYGRGTADMKGSLAAMVVAVEQF 115

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           I ++  + G I+ LIT DEEG A NGT K++ W++++    + C+VGEP+ +   GD IK
Sbjct: 116 IAEHPDHHGRIAFLITSDEEGIAANGTVKVVDWLQQQLITPEYCLVGEPSSSSQCGDVIK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL  ++TI G QGHVAYPHL  NPI   +P L +L    +D GN  F  T+ +I+
Sbjct: 176 NGRRGSLGCQLTIKGIQGHVAYPHLGRNPIHLAMPALDELAQEVWDQGNDFFPATSFQIS 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  + NVIP ++ ++FN RF+   +++ L++   + L K         + + +   
Sbjct: 236 NITAGTGATNVIPGELNVTFNFRFSTEVSDQQLRDRTEAILDKHGLE-----YAIDWLLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P FLT + +L +    SI   TG    LST+GGTSD RFI      VIE G    T+H
Sbjct: 291 GQP-FLTAEGELVAAAMASIKQVTGLDTELSTAGGTSDGRFIAPMGTQVIELGPTNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            ++EN ++ DL+ LT IY+  LQ   +
Sbjct: 350 KVDENTNIADLDILTNIYQVLLQKLLL 376


>gi|261856825|ref|YP_003264108.1| succinyl-diaminopimelate desuccinylase [Halothiobacillus
           neapolitanus c2]
 gi|261837294|gb|ACX97061.1| succinyl-diaminopimelate desuccinylase [Halothiobacillus
           neapolitanus c2]
          Length = 383

 Score =  242 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 152/384 (39%), Positives = 214/384 (55%), Gaps = 13/384 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            +     LI+  SVTP+D G   +L   L  + F+I    F       V NL+A  G+  
Sbjct: 10  TIALAQDLIRRASVTPEDAGCQPLLAERLAAMDFTITPLRF-----GAVDNLWAVRGSSG 64

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P   FAGH DVVP GD   W+ PPF+A I +  + GRG  DMKGSIA  + A+ RF+   
Sbjct: 65  PLFCFAGHTDVVPTGDATAWSQPPFAANIVDDVLIGRGSADMKGSIAAMVTAIERFVQTT 124

Query: 125 KNFGS-ISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
                 ++ LIT DEEG A++GT K++ W+  + EK D C+VGEP+    +GD  KIGRR
Sbjct: 125 PEPPFRMAFLITSDEEGVAVDGTVKVIEWLNARDEKIDWCLVGEPSSRERLGDEYKIGRR 184

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++G + +HGKQGHVAYPHL +NP+    P L +LT I +D GN  F P+ ++I  I  
Sbjct: 185 GSITGNLVVHGKQGHVAYPHLADNPVHRAAPFLAELTAIEWDQGNAHFPPSTLQIANIQA 244

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NVIP  + + FN+RFN   + + ++  + + L K      +L HT+++S    P 
Sbjct: 245 GTGANNVIPGALHVQFNLRFNTESSVEKIQARVEALLEK-----HQLRHTLNWSVSGQP- 298

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
           FLT        +  ++   TG  PL ST+GGTSD RFI      V+E G +  T+H ++E
Sbjct: 299 FLTKQGAFVQAVEAAVAQVTGVKPLPSTAGGTSDGRFIAPTGAEVVELGPLNATIHQIDE 358

Query: 363 NASLQDLEDLTCIYENFLQNWFIT 386
              +  L DL+ IYE  L     T
Sbjct: 359 RVPVAHLIDLSRIYEALLNQLAAT 382


>gi|329849463|ref|ZP_08264309.1| succinyl-diaminopimelate desuccinylase [Asticcacaulis biprosthecum
           C19]
 gi|328841374|gb|EGF90944.1| succinyl-diaminopimelate desuccinylase [Asticcacaulis biprosthecum
           C19]
          Length = 383

 Score =  242 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 161/381 (42%), Positives = 213/381 (55%), Gaps = 11/381 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +     LI+  SVTP D GA  ++   L+ LGF+ E   F       ++NLYAR GT 
Sbjct: 11  DPVVLTQNLIRRESVTPADAGAMDVVQRVLEGLGFACERLKF-----GQIENLYARRGTT 65

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            P+L FAGH DVVP G  + W Y PF A I +G + GRG VDMKG IA +I      + +
Sbjct: 66  GPNLCFAGHTDVVPGGVRSLWRYDPFGAEIHDGLVIGRGAVDMKGGIAAWI----AAVSR 121

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               GS+S LITGDEEG A +GT +++ W+ ++GE  D CIVGEP+ +  +GD IK+GRR
Sbjct: 122 VDVPGSLSFLITGDEEGEASDGTIRVVEWLRERGEVIDHCIVGEPSSSAQLGDMIKVGRR 181

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++   T+ GKQGHVAYP    NP+  L+ L+  L     D G   F P+N+EITTID 
Sbjct: 182 GSINATFTVTGKQGHVAYPQRALNPLPVLVDLVAALKARVLDDGYEGFPPSNLEITTIDT 241

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GN + NVIP       NIRFN       LK       +                S     
Sbjct: 242 GNTATNVIPQSAMARVNIRFNPTHTGAELKAWFEGLAVDHAARSGAKIDVRVSISG--EA 299

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           FLT       L+++ I    G     ST+GGTSDARFI+  CPV+EFGLVG+TMH +NE 
Sbjct: 300 FLTEPGPFVDLIAEVIQAQFGIETDRSTTGGTSDARFIRALCPVVEFGLVGQTMHQINEC 359

Query: 364 ASLQDLEDLTCIYENFLQNWF 384
             + +L+ LT +Y   ++ +F
Sbjct: 360 VPVTELQALTDVYAALIEAYF 380


>gi|120555465|ref|YP_959816.1| succinyl-diaminopimelate desuccinylase [Marinobacter aquaeolei VT8]
 gi|238064789|sp|A1U3R0|DAPE_MARAV RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|120325314|gb|ABM19629.1| succinyldiaminopimelate desuccinylase [Marinobacter aquaeolei VT8]
          Length = 376

 Score =  242 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 155/383 (40%), Positives = 211/383 (55%), Gaps = 14/383 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            LE    LI+  SVTP D G   ++++ L  LGFS E   F   +     NL+AR G   
Sbjct: 6   TLELAKDLIRRQSVTPDDAGCQELMMSRLAPLGFSGENLRFGETD-----NLWARKGNNG 60

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P L FAGH DVVP G   +W +PPF   I +G ++GRG  DMKGS+A FI A  RF+  +
Sbjct: 61  PVLAFAGHTDVVPTGPEKNWAHPPFDPIIKDGYLHGRGAADMKGSLAAFITACERFVANH 120

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
            N  GSI+LLIT DEEGPA +GT K++  +E + EK D C++GEP+  H +GD IK GRR
Sbjct: 121 PNHRGSIALLITSDEEGPAQDGTVKVVETLEARNEKMDWCLIGEPSSTHQVGDVIKNGRR 180

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL G +T+ G QGHVAYPHL EN +  + P L  L    +D GN  F PT  +IT ++ 
Sbjct: 181 GSLHGYLTVRGVQGHVAYPHLAENAVHNVAPALDALAKEFWDNGNDFFPPTTFQITRVEA 240

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  S N++P +  + FN R+      ++L+E + + L +         + + +     P 
Sbjct: 241 GVGS-NIVPGECLVHFNFRYCTENTAESLEERVVAILDRHNLK-----YDLQWHLSGRPF 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
                  L S    +I   TG    LSTSGGTSD RFI      V+E G +  T+H ++E
Sbjct: 295 LTDK-GALVSAAQNAIRTVTGRETELSTSGGTSDGRFIAPTGAQVVELGPINATIHKVDE 353

Query: 363 NASLQDLEDLTCIYENFLQNWFI 385
               +DL+ L+ IYE  L     
Sbjct: 354 CVKAEDLDTLSEIYEQILVELLA 376


>gi|300691619|ref|YP_003752614.1| N-succinyl-diaminopimelate deacylase [Ralstonia solanacearum PSI07]
 gi|299078679|emb|CBJ51337.1| N-succinyl-diaminopimelate deacylase [Ralstonia solanacearum PSI07]
          Length = 383

 Score =  242 bits (618), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 159/389 (40%), Positives = 216/389 (55%), Gaps = 14/389 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYA-- 58
           M+P  L     LI+  SVTP+D G   +L+  L   GF  E       +   V NL+A  
Sbjct: 1   MSP-TLALTEDLIRRRSVTPEDKGCQDVLIERLSAAGFQCEAVVSGPDHF-RVTNLWAVK 58

Query: 59  --RFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAA 116
             R GT    L+FAGH DVVP G    W   PF  T  +GK+YGRG  DMK SIA F+ A
Sbjct: 59  RGRAGTGGKLLVFAGHTDVVPTGPVEQWHSDPFEPTHRDGKLYGRGAADMKTSIAGFVVA 118

Query: 117 VARFIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIG 175
              F+ K+ +  GSI  LIT DEEGPA +GT K+   +  +GE+ D C+VGEPT    +G
Sbjct: 119 SEEFVAKHPDHAGSIGFLITSDEEGPAHDGTVKVCDLLRARGERLDYCVVGEPTSVSTLG 178

Query: 176 DTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTN 235
           D +K GRRGSLSG++T++G QGH+AYPHL +NPI   +P L  L    +D GN  F PT 
Sbjct: 179 DMVKNGRRGSLSGKLTVNGVQGHIAYPHLAKNPIHLAVPALTALAAEKWDDGNAYFPPTT 238

Query: 236 MEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVH 295
            +++ I  G  + NVIP  V + FN RF+     + LK  + + L     +   L +T+ 
Sbjct: 239 WQMSNIHGGTGATNVIPGHVTIDFNFRFSTASTPEGLKSRVHAIL-----DAHGLDYTLA 293

Query: 296 FSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVG 354
           ++    P FLT   +L+  LS +I    G    LST+GGTSD RFI   CP VIEFG   
Sbjct: 294 WTLGGEP-FLTERGELSEALSTAIQAECGVATELSTTGGTSDGRFIAKLCPQVIEFGPPN 352

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNW 383
            ++H ++E+  +  +E L  +Y   L+  
Sbjct: 353 ASIHKIDEHVDVAFIEPLKNVYRRVLETL 381


>gi|261493030|ref|ZP_05989571.1| asparaginase [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261311307|gb|EEY12469.1| asparaginase [Mannheimia haemolytica serotype A2 str. BOVINE]
          Length = 382

 Score =  242 bits (618), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 144/392 (36%), Positives = 210/392 (53%), Gaps = 17/392 (4%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  + +     LI+  S++PQD G    +   L+ LGF+IE   F         NL+A  
Sbjct: 1   MKNEIISLAQNLIRRDSISPQDKGCQQEIAQRLEKLGFNIEWLPFGD-----TLNLWATH 55

Query: 61  GTE----APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAA 116
           G+E     P ++FAGH DVVP GD + W YPPFSA I +G +YGRG  DMKGS++  + A
Sbjct: 56  GSENGKTEPCIVFAGHTDVVPVGDESQWAYPPFSAEIVDGMLYGRGAADMKGSLSALVVA 115

Query: 117 VARFIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIG 175
              F+  + N  G ++LLIT DEE  A +GT K++  +  + E     +VGEP+ + + G
Sbjct: 116 AETFVQHHPNHKGKVALLITSDEEAAAKDGTVKVVETLMARNEAVHYAVVGEPSSSKVFG 175

Query: 176 DTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTN 235
           D IK GRRGS++ ++ I G QGHVAYPHL ENP+   +  L  LT   +D GN  F PT+
Sbjct: 176 DVIKNGRRGSITADLYIEGIQGHVAYPHLAENPVHTSLGFLTDLTTYQWDNGNEFFPPTS 235

Query: 236 MEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVH 295
           ++I  I  G  S NVIP ++ + FN+R+     ++ +K ++   L K         + + 
Sbjct: 236 LQIANIKAGTGSNNVIPGELYIQFNLRYCTEVTDEIIKAKVTEMLEKQGLK-----YRIS 290

Query: 296 FSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVG 354
           ++    P    +  KL     +++ N     P L T GGTSD RFI      V+EFG + 
Sbjct: 291 WNLSGKPFLAGN-GKLVEAALQAVENVAKITPRLDTGGGTSDGRFIALMGAEVVEFGPLN 349

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNWFIT 386
            T+H +NE  S+ +L     IY   L+    T
Sbjct: 350 TTIHKVNECVSVDNLAHCGEIYYQILEKLLAT 381


>gi|119385567|ref|YP_916622.1| succinyl-diaminopimelate desuccinylase [Paracoccus denitrificans
           PD1222]
 gi|238064766|sp|A1B5Y2|DAPE_PARDP RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|119376162|gb|ABL70926.1| succinyldiaminopimelate desuccinylase [Paracoccus denitrificans
           PD1222]
          Length = 382

 Score =  242 bits (618), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 171/389 (43%), Positives = 225/389 (57%), Gaps = 11/389 (2%)

Query: 1   MTP--DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYA 58
           MTP  D  +   +LI+C SVTP +GGA  +L + L   GF     D +      V NL+A
Sbjct: 1   MTPIPDPAQLTARLIRCASVTPDEGGALVLLADVLGAAGFECHRVDRE-----GVPNLFA 55

Query: 59  RFG-TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAV 117
           R+G   A    F GH DVVPPGD   WT+PPFS   AEG I+GRG  DMK  +A F AA 
Sbjct: 56  RWGAQGARTFGFNGHTDVVPPGDPASWTHPPFSGHEAEGWIWGRGATDMKSGVAAFAAAA 115

Query: 118 ARFIPK-YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGD 176
             F+ +     G++ L ITGDEEGP  +GT+ +L W+  +GE+ D CIVGEP+    +G+
Sbjct: 116 IGFVTQTPPPDGAVILAITGDEEGPGKHGTRALLDWMAARGERMDVCIVGEPSNPDRMGE 175

Query: 177 TIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNM 236
            IKIGRRGS++ +I  HG QGH AYPH   NPI  L+ LLH+LT+   D G   F P+ +
Sbjct: 176 MIKIGRRGSMTLQIEAHGIQGHAAYPHRARNPIHALLRLLHELTDAPLDEGTEHFDPSGL 235

Query: 237 EITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHF 296
           ++TT+D GNP+ NVIP + +   NIRFND    ++L   IR+R                 
Sbjct: 236 QVTTVDCGNPASNVIPERARAVINIRFNDAHTAESLDRMIRARAAAISAETKVDFAISTD 295

Query: 297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRT 356
            S     FLT       L++  +   TG  P+LSTSGGTSDARF+KD+CPV+EFGLVG  
Sbjct: 296 VSG--ESFLTAPGPFVDLVAGVVREETGLDPVLSTSGGTSDARFVKDHCPVLEFGLVGHF 353

Query: 357 MHALNENASLQDLEDLTCIYENFLQNWFI 385
           MH ++E      +  L  IY   L+ +F 
Sbjct: 354 MHQVDERVPADQVRQLARIYRRILERYFA 382


>gi|121998253|ref|YP_001003040.1| succinyl-diaminopimelate desuccinylase [Halorhodospira halophila
           SL1]
 gi|238064751|sp|A1WX26|DAPE_HALHL RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|121589658|gb|ABM62238.1| succinyldiaminopimelate desuccinylase [Halorhodospira halophila
           SL1]
          Length = 378

 Score =  242 bits (618), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 152/383 (39%), Positives = 224/383 (58%), Gaps = 13/383 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            LE   +LI+ PSVTP+D G   ++   L   GF  E       N + V NL+A+ GTE 
Sbjct: 4   TLELARELIQRPSVTPEDAGCQTLVAERLAAAGFGAEWL-----NAAGVTNLWAQRGTER 58

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P   F GH DVVP G  + W +PPF   +  G +YGRG  DMKGS+A F+AAV RF+ ++
Sbjct: 59  PLFCFLGHTDVVPSGPESAWQHPPFQPIVENGCLYGRGAADMKGSVAAFVAAVERFVARH 118

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
            +  G+I++L+T DEEGPA++GT++++  +  +G   D C+VGEP+    +GD  K+GRR
Sbjct: 119 PDHAGAIAVLLTSDEEGPAVDGTRRVVETLAARGAAIDYCLVGEPSSQARLGDEYKVGRR 178

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL+G +T+HG+QGHVAYPH  +NPI    P L +L    +D G+  F PT+ +I+ I  
Sbjct: 179 GSLTGHLTVHGEQGHVAYPHQADNPIHAFAPALQELVATEWDQGDADFPPTSFQISNIQA 238

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NVIP  +++ FN+R+    + + L+E I S L +       + HT+H+    +P 
Sbjct: 239 GTGADNVIPGAMEVVFNLRYAPAVSAEELQERIESILHR-----HGVHHTLHWRHSGAPF 293

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
                  L   + +++   TG  P  STSGGTSD RF+      V+E G +  T+H  NE
Sbjct: 294 ATRE-GALIDAVEQAVTAHTGQCPRRSTSGGTSDGRFMGPTGAQVVELGPLNATIHKANE 352

Query: 363 NASLQDLEDLTCIYENFLQNWFI 385
           + ++ DLE L  IY + LQ+   
Sbjct: 353 HVAVADLEALEAIYFDILQHLLA 375


>gi|170767336|ref|ZP_02901789.1| succinyl-diaminopimelate desuccinylase [Escherichia albertii
           TW07627]
 gi|170123670|gb|EDS92601.1| succinyl-diaminopimelate desuccinylase [Escherichia albertii
           TW07627]
          Length = 375

 Score =  242 bits (618), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 154/385 (40%), Positives = 222/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+CPS++P D G   I++  L+ LGF+IE  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRCPSLSPDDAGCQAIMIERLRALGFTIERMDFADTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVPPGD + W  PPF   I +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVPPGDTDRWINPPFEPAIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHKGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDKGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKTQVLALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFI-KDYCPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI +    V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFITRMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|168817766|ref|ZP_02829766.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205344997|gb|EDZ31761.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
          Length = 375

 Score =  242 bits (618), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 152/385 (39%), Positives = 220/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF+IE  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRKIGFTIEHMDFGDTQ-----NFWAWS 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GRGE-TLAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ +  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   I+GD +K
Sbjct: 115 VAQHPHHRGRLAFLITSDEEASAKNGTVKVVEALMARNERLDYCLVGEPSSTEIVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M++ 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDRGNDFFPATSMQVA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +KE + + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKERVHALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|297183962|gb|ADI20082.1| acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase
           and related deacylases [uncultured alpha proteobacterium
           EB080_L06A09]
          Length = 377

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 164/385 (42%), Positives = 222/385 (57%), Gaps = 8/385 (2%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT D +     LI+C SVTP++ GA  +L   L   GF     D       +V NL+AR+
Sbjct: 1   MTIDPVNLTADLIRCESVTPKEAGALVLLEELLAKAGFECNRVD-----RGLVSNLFARW 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT    L F GH DVVP G  + W+  PF A I +G +YGRG  DMK  +A F AA   F
Sbjct: 56  GT-GKTLGFNGHTDVVPIGSLDDWSVDPFGAEIKDGFLYGRGSTDMKSGVAAFAAAAIDF 114

Query: 121 IPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
           +      GSI L ITGDEEG A +GT  +L W+    E  + CIVGEPTC   +G+ +KI
Sbjct: 115 VENNPAGGSIVLAITGDEEGQAKDGTLALLDWMNDNNETINHCIVGEPTCPENMGEMMKI 174

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGS++   T+ G QGH AYPH  +NP+  +  L+  LT+   D G+  F P+ + +TT
Sbjct: 175 GRRGSMTAYFTVRGIQGHSAYPHRAKNPLPVMAELICDLTSFELDQGSEHFDPSTLAVTT 234

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV 300
           ID GN + NVIPA+ + + NIRFND+   + L   ++    K         +     S  
Sbjct: 235 IDTGNLANNVIPAECRATVNIRFNDMHTSEELSVWLKEVTNKIASKSDVEINMEIQVSG- 293

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHAL 360
              F+T     + L+S S+Y+ TG  P  STSGGTSDARF+KD+CPV+EFGLVG+TMH +
Sbjct: 294 -ESFITALGSFSDLVSNSVYSETGIYPQASTSGGTSDARFVKDHCPVVEFGLVGKTMHQV 352

Query: 361 NENASLQDLEDLTCIYENFLQNWFI 385
           +E  S+  +  L  IY N ++N+F 
Sbjct: 353 DERVSVNHIHQLKAIYANIIKNYFA 377


>gi|323977351|gb|EGB72437.1| succinyl-diaminopimelate desuccinylase [Escherichia coli TW10509]
          Length = 375

 Score =  242 bits (617), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 151/385 (39%), Positives = 220/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAIGFTVERMDFADTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVV PGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVSPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|116049094|ref|YP_792104.1| succinyl-diaminopimelate desuccinylase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|122258202|sp|Q02IY2|DAPE_PSEAB RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|115584315|gb|ABJ10330.1| succinyl-diaminopimelate desuccinylase [Pseudomonas aeruginosa
           UCBPP-PA14]
          Length = 383

 Score =  242 bits (617), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 155/384 (40%), Positives = 213/384 (55%), Gaps = 14/384 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            LE   +LI+ PSVTP D     +++  L+  GF++E    +      V N +AR G + 
Sbjct: 11  TLELACELIRRPSVTPLDADCQALMMRRLEAAGFALEPMRIEE-----VDNFWARRGGDG 65

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEG-KIYGRGIVDMKGSIACFIAAVARFI-P 122
           P L FAGH DVVP G    W + PF A I +   + GRG  DMKGS+A  I AV RF+  
Sbjct: 66  PVLCFAGHTDVVPTGPLQAWQHQPFDALIDDQGMLCGRGAADMKGSLASMIVAVERFVAD 125

Query: 123 KYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
             K+ G+I+ LIT DEEGPA +GTK ++  +  +GE+ D CIVGEP+   ++GD +K GR
Sbjct: 126 HPKHKGAIAFLITSDEEGPAHHGTKAVVERLAARGERLDWCIVGEPSSTSLVGDVVKNGR 185

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSL  ++TI G QGHVAYPHL +NPI    P L +L    +D GN  F PT+ +++ ++
Sbjct: 186 RGSLGAKLTIRGVQGHVAYPHLAKNPIHLAAPALAELAAEHWDDGNAFFPPTSFQVSNLN 245

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
            G  + NVIP ++   FN RF+     + L++ + + L K   +       V ++    P
Sbjct: 246 SGTGATNVIPGELTALFNFRFSTESTVEGLQKRVEAILDKHGLD-----WHVEWALSGLP 300

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMHALN 361
            FLT   +L   ++ SI   TG     STSGGTSD RFI      V+E G V  T+H +N
Sbjct: 301 -FLTEPGELLDAVAASIRAVTGREARPSTSGGTSDGRFIATMGTQVVELGPVNATIHQVN 359

Query: 362 ENASLQDLEDLTCIYENFLQNWFI 385
           E     DLE LT IY   L     
Sbjct: 360 ERVLASDLELLTEIYYQTLVRLLA 383


>gi|152980053|ref|YP_001353762.1| succinyl-diaminopimelate desuccinylase [Janthinobacterium sp.
           Marseille]
 gi|238064756|sp|A6SZR5|DAPE_JANMA RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|151280130|gb|ABR88540.1| succinyl-diaminopimelate desuccinylase [Janthinobacterium sp.
           Marseille]
          Length = 375

 Score =  242 bits (617), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 156/383 (40%), Positives = 219/383 (57%), Gaps = 13/383 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L    +LI   SVTP+D G    L+  L+ LGF  E  +     +  V NL+AR GT  
Sbjct: 4   TLALTEELIALSSVTPEDKGCQSRLIELLEPLGFVCETIE-----SDGVTNLWARKGTTQ 58

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P L+FAGH DVVP G    WT PPF  T  EGK+YGRG  DMK SIA  + A   F+  +
Sbjct: 59  PLLVFAGHTDVVPTGPLEQWTSPPFVPTQREGKLYGRGAADMKTSIAAMVVAAEEFVQAH 118

Query: 125 K-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
             + GSI  LIT DEEGPA +GT  + + ++ +GE+ D C+VGEPT + ++GDTIK GRR
Sbjct: 119 PAHKGSIGFLITSDEEGPATDGTVIVCNALKARGEQLDYCVVGEPTSSDVLGDTIKNGRR 178

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS+SG++T+ G QGH+AYP L  NPI    P L +L    +D GN  + PT+ +++ I  
Sbjct: 179 GSMSGKLTVKGIQGHIAYPQLARNPIHQCAPALAELVAEKWDDGNEYYLPTSWQVSNIHG 238

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NVIP  V + FN RF        L++ + + L K         + + +S    P 
Sbjct: 239 GAGASNVIPGNVVIDFNFRFCTASTVDGLQKRVHAILDKHGLE-----YDLKWSISGHP- 292

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMHALNE 362
           FLT    L+  +S +I + TG    LST+GGTSD RFI   CP V+EFG    ++H ++E
Sbjct: 293 FLTPKGTLSDAMSDAIKSETGVTTELSTTGGTSDGRFIAQICPQVVEFGPPNGSIHKIDE 352

Query: 363 NASLQDLEDLTCIYENFLQNWFI 385
           +  ++ ++ L  IY   ++N  +
Sbjct: 353 HIEVRFIDPLKNIYRRTMENLLL 375


>gi|168232029|ref|ZP_02657087.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|194472281|ref|ZP_03078265.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194458645|gb|EDX47484.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|205333703|gb|EDZ20467.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
          Length = 375

 Score =  242 bits (617), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 152/385 (39%), Positives = 220/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF+IE  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRKIGFTIEHMDFGDTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GRGE-TLAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ +  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   I+GD +K
Sbjct: 115 VAQHPHHRGRLAFLITSDEEASAKNGTVKVVEALMARHERLDYCLVGEPSSTEIVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M++ 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDRGNDFFPATSMQVA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +KE + + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKERVHALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVLELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|37526612|ref|NP_929956.1| succinyl-diaminopimelate desuccinylase [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|81419150|sp|Q7N3J4|DAPE_PHOLL RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|36786044|emb|CAE15096.1| Succinyl-diaminopimelate desuccinylase (SDAP) [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 375

 Score =  242 bits (617), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 159/385 (41%), Positives = 224/385 (58%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT   +E   QLI+ PS++P D G   I++  L+ +GF+IE   F   N     N +A  
Sbjct: 1   MTCPVIELAQQLIRQPSISPDDKGCQDIMIAHLQTIGFTIERMPFGDTN-----NFWAYR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   P L FAGH DVVP GD + W YPPF  TI  G +YGRG  DMKGS+A  I A  RF
Sbjct: 56  GI-GPTLAFAGHTDVVPAGDESQWEYPPFEPTIRNGMLYGRGAADMKGSLAAMIVAAERF 114

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  +  + G ++ LIT DEE  A +GT K++  +  + E+ D C++GEP+  H +GD +K
Sbjct: 115 VAAHPNHNGRLAFLITSDEEAKATHGTVKVVEALMSRNERLDYCLIGEPSSQHRLGDMVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +T+HG QGHVAYPHL +NPI  ++P L  L N  +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTANLTVHGIQGHVAYPHLADNPIHRVLPALQTLVNTHWDEGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP  V++ FN RF+    +  ++E++ + L         L++T+ +   
Sbjct: 235 NIHAGTGSHNVIPGNVQVQFNFRFSTELTDSQIREQVETIL-----KNHNLNYTIEWILA 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   +L + + +SI    G  P LSTSGGTSD RFI      V+E G +  T+H
Sbjct: 290 GQP-FLTAKGELVNAVIQSIDQYCGYQPELSTSGGTSDGRFIAQMGAQVVELGPLNSTIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE+ S  DL+ L+ IY+  ++  
Sbjct: 349 KVNESVSAADLQQLSRIYQRVMEQL 373


>gi|319786521|ref|YP_004145996.1| succinyl-diaminopimelate desuccinylase [Pseudoxanthomonas
           suwonensis 11-1]
 gi|317465033|gb|ADV26765.1| succinyl-diaminopimelate desuccinylase [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 380

 Score =  242 bits (617), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 141/390 (36%), Positives = 216/390 (55%), Gaps = 14/390 (3%)

Query: 3   PDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT 62
            + L+   +LI  PSVTP D G   +L   L+  GF+ E   +       V NL+A  G+
Sbjct: 2   SEVLDLACELIARPSVTPGDAGCQALLAARLQRAGFACESLRYGE-----VDNLWATHGS 56

Query: 63  E-APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
              P L+  GH DVVPPG    W   PF   + +G +YGRG  DMKGS+A F+ A  RF+
Sbjct: 57  GEGPVLVLLGHTDVVPPGPREAWASDPFQPQVRDGVLYGRGAADMKGSVAAFVVAAERFV 116

Query: 122 PKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKI 180
             +  + G+++LL+T DEEG AI+G +++ +   ++G++ D CI GEP+    +GD +++
Sbjct: 117 AAHPDHPGTLALLLTSDEEGDAIDGVRRVATTFRQRGQRIDWCITGEPSSTAKLGDLLRV 176

Query: 181 GRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITT 240
           GRRGSLS  +T+ G QGHVAYPH   NPI    P L +L    +D G  +F PT+++++ 
Sbjct: 177 GRRGSLSATLTVRGVQGHVAYPHKARNPIHQAAPALAELVARVWDEGYESFPPTSLQVSN 236

Query: 241 IDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPV 300
           I  G  + NVIP ++++ FN+R+N  W+   L+ EI + L +   +     H + +    
Sbjct: 237 IHAGTGANNVIPGELQVLFNLRYNPHWDAPKLEAEIAALLDRHGLD-----HELRWHRSG 291

Query: 301 SPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHA 359
            P +      L     + +    G  P  ST GGTSDARFI       IE G V  ++H 
Sbjct: 292 EPFYTPE-GTLRVAAREVLSEVAGAPPEESTGGGTSDARFIAPLGAQCIEVGPVNASIHQ 350

Query: 360 LNENASLQDLEDLTCIYENFLQNWFITPSQ 389
           ++EN S+ DLE L  +Y+  ++   + P++
Sbjct: 351 VDENVSVADLEALPGLYQRLVERLLLQPAR 380


>gi|323491420|ref|ZP_08096604.1| succinyl-diaminopimelate desuccinylase [Vibrio brasiliensis LMG
           20546]
 gi|323314289|gb|EGA67369.1| succinyl-diaminopimelate desuccinylase [Vibrio brasiliensis LMG
           20546]
          Length = 377

 Score =  242 bits (616), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 151/388 (38%), Positives = 210/388 (54%), Gaps = 14/388 (3%)

Query: 1   MTPD-CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    L     LI   SVTP+D G   +++  LK LGF+IE   F+        N +AR
Sbjct: 1   MTDSPTLALAKDLISRQSVTPEDAGCQEVMIERLKALGFNIEVMVFED-----TTNFWAR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GTEAP   FAGH DVVP G    W  PPF  TI    ++GRG  DMKGS+A  I AV +
Sbjct: 56  RGTEAPLFAFAGHTDVVPAGKLKQWDTPPFEPTIKGEFLHGRGAADMKGSLASMIVAVEQ 115

Query: 120 FIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           FI +  N  GSI  LIT DEEGP INGT +++  + ++GE  D CIVGEP+   ++GD +
Sbjct: 116 FIAENPNHKGSIGFLITSDEEGPFINGTVRVVETLMERGENIDMCIVGEPSSTEVVGDVV 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGS++G++T+ G QGHVAYPHL  NP+   +  +++L    +D GN  F PT+ +I
Sbjct: 176 KNGRRGSITGDLTVKGIQGHVAYPHLARNPVHQSLLAINELATTEWDQGNAYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
             +  G  + NVIP +  + FN+RF+   +   +   +   L K   +     + + ++ 
Sbjct: 236 PNVHAGTGASNVIPGEFNVQFNLRFSTELSNDVIVARVTETLDKHDLD-----YDLKWTF 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTM 357
              P        L   +  ++       P L T+GGTSD RFI      V+E G V  T+
Sbjct: 291 NGDPFLTD-TGALLDAVVDAVDTVNQTKPALLTTGGTSDGRFIARMGGQVVELGPVNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H +NE   + DLE LT +Y+  L N   
Sbjct: 350 HKVNECVKVADLEKLTEMYQKTLDNLLA 377


>gi|262042090|ref|ZP_06015266.1| succinyl-diaminopimelate desuccinylase [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
 gi|330013587|ref|ZP_08307675.1| succinyl-diaminopimelate desuccinylase [Klebsiella sp. MS 92-3]
 gi|259040571|gb|EEW41666.1| succinyl-diaminopimelate desuccinylase [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
 gi|328533466|gb|EGF60199.1| succinyl-diaminopimelate desuccinylase [Klebsiella sp. MS 92-3]
          Length = 375

 Score =  242 bits (616), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 152/385 (39%), Positives = 220/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELAQQLIRRPSLSPDDAGCQALMIERLRAIGFTVEPMDFGDTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GHGE-TLAFAGHTDVVPAGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + +Y N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQYPNHRGRLAFLITSDEEASAKNGTVKVVETLMARNERLDYCLVGEPSSTEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P+L +L NI +D GN  F PT+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMLAELVNIEWDKGNEFFPPTSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            +  G  S NVIP  + + FN RF+    ++ +K  + + L K      +L ++V +   
Sbjct: 235 NVQSGTGSNNVIPGDMFVQFNFRFSTELTDEMIKSRVIALLEK-----YQLRYSVEWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTGRGKLVDAVVNAIEHYNEIKPQLLTNGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRVMEQL 373


>gi|238022142|ref|ZP_04602568.1| hypothetical protein GCWU000324_02048 [Kingella oralis ATCC 51147]
 gi|237866756|gb|EEP67798.1| hypothetical protein GCWU000324_02048 [Kingella oralis ATCC 51147]
          Length = 373

 Score =  242 bits (616), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 167/382 (43%), Positives = 226/382 (59%), Gaps = 13/382 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           +    QL+  PS+TP D G   I+   L  LGF IE       N    KNLYAR G+++P
Sbjct: 3   IALAKQLLSQPSITPNDHGCQDIIATRLVALGFKIEWH-----NHGNTKNLYARIGSQSP 57

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            L FAGH DVVP GD   WT+PPF  T   GK+Y RG  DMK +IACF+ A  R++  + 
Sbjct: 58  VLCFAGHTDVVPTGDTAQWTFPPFEPTEHNGKLYARGAADMKTAIACFVVAAERYLTAHP 117

Query: 126 NF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
            F GS++LLIT DEEG   +GT +++  +  +GE +D CIVGEPT  H +GD +K GRRG
Sbjct: 118 QFSGSLALLITSDEEGDGKDGTTRVVETLRARGETFDYCIVGEPTAQHQLGDMLKNGRRG 177

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG + IHGKQGH+AYPHL ENPI    P L +L N  +D GN  F  T+ +I+ I  G
Sbjct: 178 SLSGSLKIHGKQGHIAYPHLAENPIHRAAPALAELINTQWDNGNAYFPATSFQISNIHSG 237

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
             + NVIPA + + FN RF+    E +LK ++   L     +  +L + + +    +P F
Sbjct: 238 TGATNVIPADIAVQFNFRFSTEQTEGSLKSQVHQIL-----DAHQLRYDLDWQLSGNP-F 291

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNEN 363
           LT    LT +  ++  +  G  P LST+GGTSD RFIK     +IE G V  T+H ++E+
Sbjct: 292 LTKAGTLTQIAQRACQHICGITPELSTTGGTSDGRFIKAISRELIELGFVNATIHQIDEH 351

Query: 364 ASLQDLEDLTCIYENFLQNWFI 385
            +L D+  LT IY+  +Q  F 
Sbjct: 352 IALDDIPKLTAIYQTIMQELFA 373


>gi|84389717|ref|ZP_00991269.1| succinyl-diaminopimelate desuccinylase [Vibrio splendidus 12B01]
 gi|84376818|gb|EAP93692.1| succinyl-diaminopimelate desuccinylase [Vibrio splendidus 12B01]
          Length = 378

 Score =  242 bits (616), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 156/388 (40%), Positives = 210/388 (54%), Gaps = 14/388 (3%)

Query: 1   MTPD-CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    L     LI   SVTP+D G   +++  LK LGF IE   F+        N +AR
Sbjct: 1   MTDSPTLALAKDLISRQSVTPEDAGCQDLMIERLKALGFEIEVMVFED-----TTNFWAR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            GTE P   FAGH DVVP G    W   PF  TI +G ++GRG  DMKGS+A  I AV +
Sbjct: 56  RGTEVPLFAFAGHTDVVPAGPIEQWHTKPFEPTIVDGFLHGRGAADMKGSLASMIVAVEQ 115

Query: 120 FIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           FI K+ +  GSI  LIT DEEGP INGT +++  +  +GE  D CIVGEP+    +GD +
Sbjct: 116 FIAKHPDHTGSIGFLITSDEEGPFINGTVRVVEALMARGENIDMCIVGEPSSTEYVGDVV 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGS++G++TI G QGHVAYPHL  NP+   +  +++L    +D GN  F PT+ +I
Sbjct: 176 KNGRRGSITGDLTIKGTQGHVAYPHLANNPVHSSLLAINELATTEWDKGNDYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
             +  G  + NVIP +  + FN+RF+   N   + E I + L K         + + +  
Sbjct: 236 PNVSAGTGASNVIPGEFNVQFNLRFSTELNNDIIVERITNTLDK-----YDFEYDLKWIF 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY-CPVIEFGLVGRTM 357
              P        L   +  ++ +     P L T+GGTSD RFI      V+E G V  T+
Sbjct: 291 NGDPFLTDAGS-LLDAIVDAVGHVNDVKPALLTTGGTSDGRFIARMKGQVVELGPVNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H +NE   + DLE LT +YE  L N F 
Sbjct: 350 HKVNECVKVADLEKLTDMYERTLVNLFA 377


>gi|295676836|ref|YP_003605360.1| succinyl-diaminopimelate desuccinylase [Burkholderia sp. CCGE1002]
 gi|295436679|gb|ADG15849.1| succinyl-diaminopimelate desuccinylase [Burkholderia sp. CCGE1002]
          Length = 379

 Score =  242 bits (616), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 155/385 (40%), Positives = 217/385 (56%), Gaps = 17/385 (4%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF---- 60
            L    QLI   SVTP D     +L+  L  LGF  E  +     ++ V NL+A      
Sbjct: 4   TLALTEQLIARASVTPDDQHCQRLLIERLAALGFEHETIE-----SNGVTNLWAVKRGAD 58

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GTE   L FAGH DVVP G    W   PF  T  +GK+YGRG  DMK SIA F+ A   F
Sbjct: 59  GTEGKLLAFAGHTDVVPTGPLEQWQSAPFEPTQRDGKLYGRGAADMKASIAGFVVASEEF 118

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +       GSI+ LIT DEEGPA +GT K++  ++++GE+ D CIVGEPT +   GD +K
Sbjct: 119 VAANPQHRGSIAFLITSDEEGPATDGTVKVVDALQQRGERMDYCIVGEPTSSERFGDMVK 178

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS+SG++T+ G QGH+AYPHL +NP+  L P L +L    +D GN  F PT  +++
Sbjct: 179 NGRRGSMSGKLTVKGVQGHIAYPHLAKNPVHLLAPALAELVAERWDEGNEYFPPTTWQVS 238

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            +  G  + NVIP    + FN RF+     + L++ + + L K         + +H++  
Sbjct: 239 NLHSGAGATNVIPGHADVMFNFRFSTASTVEGLQKRVHAILDKHGLE-----YELHWTIS 293

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMH 358
             P FLT   +L+S L+K+I + TG    LST+GGTSD RFI   C  VIEFG +  ++H
Sbjct: 294 GLP-FLTPRGELSSALAKAIKDETGVDTELSTTGGTSDGRFIARICKQVIEFGPLNASIH 352

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            ++E+  +  +E L  +Y   L+  
Sbjct: 353 KIDEHIEVAHIEPLKNVYRRVLEQL 377


>gi|73541584|ref|YP_296104.1| succinyl-diaminopimelate desuccinylase [Ralstonia eutropha JMP134]
 gi|123624818|sp|Q470C3|DAPE_RALEJ RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|72118997|gb|AAZ61260.1| succinyldiaminopimelate desuccinylase [Ralstonia eutropha JMP134]
          Length = 383

 Score =  242 bits (616), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 158/389 (40%), Positives = 215/389 (55%), Gaps = 14/389 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYA-- 58
           MT   L     LI+  SVTP D G   +L   LK LGF+ E       +   V NL+A  
Sbjct: 1   MTA-TLALTEDLIRRRSVTPADEGCQAVLETRLKALGFTCEAIVSGPDDF-RVTNLWAVK 58

Query: 59  --RFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAA 116
               GT+   L FAGH DVVP G    W   PF  T  +G++YGRG  DMK SIA F+ A
Sbjct: 59  RGTQGTDGKLLAFAGHTDVVPTGPLEQWNSDPFEPTHRDGRLYGRGAADMKTSIAGFVVA 118

Query: 117 VARFIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIG 175
           V  F+  +  + GSI+ LIT DEEGPA +GT K++  ++ +GE+ D C++GEPT    +G
Sbjct: 119 VEEFVKAHPAHAGSIAFLITSDEEGPAHDGTIKVVEALKARGERLDYCVIGEPTSVDTLG 178

Query: 176 DTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTN 235
           D +K GRRGSLSG++ + G Q H+AYPHL  NPI    P L +L    +D GN  F PT+
Sbjct: 179 DMVKNGRRGSLSGKLVVKGVQCHIAYPHLGRNPIHEAAPALAELAAEVWDQGNEYFPPTS 238

Query: 236 MEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVH 295
            +++ I  G  + NVIP  V + FN RF+     + LK  + + L K         +T+ 
Sbjct: 239 WQMSNIHGGTGATNVIPGHVTIDFNFRFSTASTPEGLKSRVHAILDKHKLE-----YTLD 293

Query: 296 FSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVG 354
           ++    P FLT    L+  LS +I   TG    LST+GGTSD RFI   CP VIEFG   
Sbjct: 294 WTLGGEP-FLTPRGDLSDALSAAIEAETGVKTELSTTGGTSDGRFIAKICPQVIEFGPPN 352

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNW 383
            T+H ++EN  ++ ++ L  +Y   L+  
Sbjct: 353 ATIHKIDENVEVRFIDPLKNVYRGVLERL 381


>gi|299067444|emb|CBJ38643.1| N-succinyl-diaminopimelate deacylase [Ralstonia solanacearum CMR15]
          Length = 386

 Score =  242 bits (616), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 158/389 (40%), Positives = 215/389 (55%), Gaps = 14/389 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYA-- 58
           M+P  L     LI+  SVTP+D G   +L+  L   GF  E       +   V NL+A  
Sbjct: 4   MSP-TLALTEDLIRRRSVTPEDKGCQDVLIERLSAAGFQCETVVSGPDHF-RVTNLWAVK 61

Query: 59  --RFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAA 116
             R GT+   L+FAGH DVVP G    W   PF  T  +GK+YGRG  DMK SIA F+ A
Sbjct: 62  RGRAGTDGKLLVFAGHTDVVPTGPVEQWRSDPFEPTHRDGKLYGRGAADMKTSIAGFVVA 121

Query: 117 VARFIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIG 175
              F+  + +  GSI  LIT DEEGPA +GT K+   +  +GE+ D C+VGEPT    +G
Sbjct: 122 AEEFVAGHPDHAGSIGFLITSDEEGPAHDGTIKVCDLLRTRGERMDYCVVGEPTSVSTLG 181

Query: 176 DTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTN 235
           D +K GRRGSLSG++T++G QGH+AYPHL +NPI    P L  L    +D GN  F PT 
Sbjct: 182 DMVKNGRRGSLSGKLTVNGVQGHIAYPHLAKNPIHLAAPALTALVAEQWDDGNAYFPPTT 241

Query: 236 MEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVH 295
            +++ I  G  + NVIP  V + FN RF+     + LK  + + L     +   L +T+ 
Sbjct: 242 WQMSNIHGGTGATNVIPGHVVIDFNFRFSTASTPEGLKARVHAIL-----DAHGLDYTLA 296

Query: 296 FSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVG 354
           ++    P FLT   +L+  LS +I    G    LST+GGTSD RFI   CP VIEFG   
Sbjct: 297 WTLGGEP-FLTERGELSEALSSAIRTECGVATELSTTGGTSDGRFIAKLCPQVIEFGPPN 355

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNW 383
            ++H ++E+  +  +E L  +Y   L+  
Sbjct: 356 ASIHKIDEHVDVAFIEPLKNVYRRVLETL 384


>gi|56479089|ref|YP_160678.1| succinyl-diaminopimelate desuccinylase [Aromatoleum aromaticum
           EbN1]
 gi|81598505|sp|Q5NYT7|DAPE_AZOSE RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|56315132|emb|CAI09777.1| predicted peptidase M20 [Aromatoleum aromaticum EbN1]
          Length = 384

 Score =  242 bits (616), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 163/380 (42%), Positives = 219/380 (57%), Gaps = 13/380 (3%)

Query: 8   HLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHL 67
              +LI   SVTP D G   ++   L  LGF  E  D     +S V NL+AR G  AP L
Sbjct: 12  LACELISRSSVTPDDCGCLDLIAARLAPLGFRFERVD-----SSGVCNLWARRGGTAPVL 66

Query: 68  MFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF 127
            FAGH DVVP G  + W  PPF  T+  G+++GRG  DMK SIA F+ A+ RF+  + + 
Sbjct: 67  CFAGHTDVVPAGPLDGWDSPPFEPTVRGGQLFGRGAADMKTSIAAFVTAIERFVATHPDH 126

Query: 128 -GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSL 186
            GSI+LL+T DEEG A +GT K++  +  +GE+ D C+VGEPT  + +GDTIK GRRGSL
Sbjct: 127 VGSIALLLTSDEEGIATHGTVKVVEALAGRGERLDYCVVGEPTSVNTLGDTIKNGRRGSL 186

Query: 187 SGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNP 246
           SG + + G QGHVAYP L  NPI    P L +L +I +D GN  F PT  +++ I  G  
Sbjct: 187 SGTLRVKGVQGHVAYPQLARNPIHEFAPALAELASIRWDEGNEFFPPTTWQVSNIHAGTG 246

Query: 247 SKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLT 306
           + NVIP   ++ FN RF  + +   L++     L +   +     + + +     P FLT
Sbjct: 247 ANNVIPGTCEVLFNFRFASVSSADELRQRTHVVLDRHGLD-----YELDWHLSGKP-FLT 300

Query: 307 HDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMHALNENAS 365
              KL   LS +I +T G    LSTSGGTSD RFI D C  V+EFG V  T+H +NE+ +
Sbjct: 301 GRGKLVEALSDAIRDTVGVETELSTSGGTSDGRFIADICNEVVEFGPVNATIHKVNESVA 360

Query: 366 LQDLEDLTCIYENFLQNWFI 385
           L  +E L+ IYE  L    +
Sbjct: 361 LDAIEPLSAIYERTLNALLL 380


>gi|311278616|ref|YP_003940847.1| succinyl-diaminopimelate desuccinylase [Enterobacter cloacae SCF1]
 gi|308747811|gb|ADO47563.1| succinyl-diaminopimelate desuccinylase [Enterobacter cloacae SCF1]
          Length = 375

 Score =  242 bits (616), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 150/385 (38%), Positives = 221/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELAQQLIRRPSLSPDDAGCQALMIERLRAIGFTVEAMDFGDTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD N W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GKGE-TLAFAGHTDVVPAGDANRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A +GT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHKGRLAFLITSDEEASATHGTVKVVEALMARNERLDYCLVGEPSSTEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P++++L  I +D GN  F PT+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMINELVAIEWDKGNDYFPPTSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP  + + FN RF+    ++ +K ++ + L K      +L +T+ +   
Sbjct: 235 NIQAGTGSNNVIPGDLHVQFNFRFSTELTDEAIKAKVVALLDK-----HQLRYTLDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTGRGKLVDAVVNAIEHYNEVKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|146308087|ref|YP_001188552.1| succinyl-diaminopimelate desuccinylase [Pseudomonas mendocina ymp]
 gi|238064775|sp|A4XWV4|DAPE_PSEMY RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|145576288|gb|ABP85820.1| succinyldiaminopimelate desuccinylase [Pseudomonas mendocina ymp]
          Length = 380

 Score =  242 bits (616), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 153/388 (39%), Positives = 216/388 (55%), Gaps = 15/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           +TP  LE    LI+ PSVTP D G   +++  L   GF +E    +      V+N +A+ 
Sbjct: 5   LTP-TLELAFDLIRRPSVTPVDEGCQELMMRRLAACGFEVERMRIEE-----VENFWAKR 58

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEG-KIYGRGIVDMKGSIACFIAAVAR 119
           G + P L FAGH DVVP G  + W Y PF   + E   + GRG  DMKGS+A  I AV R
Sbjct: 59  GGDGPVLCFAGHTDVVPTGPLDAWQYQPFDVRVDEEGMLCGRGAADMKGSLASMIVAVER 118

Query: 120 FIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           F+  Y N  G+IS LIT DEEGPA +GTK ++  + ++ E+ D CIVGEP+   ++GD +
Sbjct: 119 FVADYPNHRGAISFLITSDEEGPAQHGTKAVVERLRERSERLDWCIVGEPSSTTLLGDVV 178

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGSL   +T++GKQGHVAYPHL +NPI    P L +L    +D GN  F PT+ ++
Sbjct: 179 KNGRRGSLGCTLTVYGKQGHVAYPHLAKNPIHLAAPALAELAAEHWDHGNDYFPPTSFQV 238

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
           + ++ G  + NVIP ++K  FN RF+     + L++ + + L K   +     + + ++ 
Sbjct: 239 SNLNSGTGATNVIPGELKAVFNFRFSTESTVEGLQQRVTAILDKHGLD-----YHLEWAL 293

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTM 357
              P       +L   ++ SI N TG     STSGGTSD RFI      V+E G V  T+
Sbjct: 294 SGLPFLTQP-GELLDAVAASIKNVTGRDTTPSTSGGTSDGRFIATLGTQVVELGPVNATI 352

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H +NE     DL+ LT +Y   +     
Sbjct: 353 HQINERVLASDLDLLTEVYYQTMVKLLA 380


>gi|296390468|ref|ZP_06879943.1| succinyl-diaminopimelate desuccinylase [Pseudomonas aeruginosa
           PAb1]
          Length = 383

 Score =  242 bits (616), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 155/384 (40%), Positives = 213/384 (55%), Gaps = 14/384 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            LE   +LI+ PSVTP D     +++  L+  GF++E    +      V N +AR G + 
Sbjct: 11  TLELACELIRRPSVTPLDADCQALMMRRLEAAGFALEPMRIEE-----VDNFWARRGGDG 65

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEG-KIYGRGIVDMKGSIACFIAAVARFI-P 122
           P L FAGH DVVP G    W + PF A I +   + GRG  DMKGS+A  I AV RF+  
Sbjct: 66  PVLCFAGHTDVVPTGPLQAWQHQPFDALIDDQGMLCGRGAADMKGSLASMIVAVERFVAD 125

Query: 123 KYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
             K+ G+I+ LIT DEEGPA +GTK ++  +  +GE+ D CIVGEP+   ++GD +K GR
Sbjct: 126 HPKHKGAIAFLITSDEEGPAHHGTKAVVERLAARGERLDWCIVGEPSSTSLVGDVVKNGR 185

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSL  ++TI G QGHVAYPHL +NPI    P L +L    +D GN  F PT+ +++ ++
Sbjct: 186 RGSLGAKLTIRGVQGHVAYPHLAKNPIHLAAPALAELAAEHWDDGNAFFPPTSFQVSNLN 245

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
            G  + NVIP ++   FN RF+     + L++ + + L K   +       V ++    P
Sbjct: 246 SGTGATNVIPGELTALFNFRFSTESTVEGLQKRVEAILDKHGLD-----WHVEWALSGLP 300

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMHALN 361
            FLT   +L   ++ SI   TG     STSGGTSD RFI      V+E G V  T+H +N
Sbjct: 301 -FLTEPGELLDAVAASIRAVTGRETRPSTSGGTSDGRFIATMGTQVVELGPVNATIHQVN 359

Query: 362 ENASLQDLEDLTCIYENFLQNWFI 385
           E     DLE LT IY   L     
Sbjct: 360 ERVLASDLELLTEIYYQTLVRLLA 383


>gi|311694050|gb|ADP96923.1| succinyl-diaminopimelate desuccinylase [marine bacterium HP15]
          Length = 378

 Score =  242 bits (616), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 157/383 (40%), Positives = 214/383 (55%), Gaps = 14/383 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            LE  + LI+ PSVTP D G   ++++ L  LGF+ E   F   +     NL+AR G+E 
Sbjct: 8   TLELAVDLIRRPSVTPDDAGCQELMMSRLAPLGFTGENLRFGDTD-----NLWARKGSEG 62

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P L FAGH DVVP G   +W++PPF   I +G + GRG  DMKGS+A F+ A  RF+  Y
Sbjct: 63  PVLAFAGHTDVVPTGPEKNWSHPPFDPVIRDGYLLGRGAADMKGSLAAFVTACERFVASY 122

Query: 125 K-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
             + GSI+LLIT DEEGPA +GT K++  +E + EK D C++GEP+    +GD IK GRR
Sbjct: 123 PDHRGSIALLITSDEEGPAQHGTVKVVETLEARNEKIDWCLIGEPSSTREVGDVIKNGRR 182

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL G +T+HG QGHVAYPHL ENP+  + P L  L    +D GN  F PT  +IT ++ 
Sbjct: 183 GSLHGYLTVHGVQGHVAYPHLAENPVHLVAPALDALAKEFWDNGNDFFPPTTFQITKLEA 242

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  S N+IP +  + FN R+      ++L+E + + L +         + + +     P 
Sbjct: 243 GTGS-NIIPGECLVHFNFRYCTENTAESLEERVVAILDRHNLK-----YDLQWHLSGRPF 296

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
                  L S    +I   TG    LSTSGGTSD RFI      V+E G +  T+H ++E
Sbjct: 297 LTDK-GALVSASQSAIRTVTGRETELSTSGGTSDGRFIAPTGAQVVELGPINATIHKVDE 355

Query: 363 NASLQDLEDLTCIYENFLQNWFI 385
                DL  L+ IYE  L     
Sbjct: 356 CVKADDLNTLSEIYEQILIELLA 378


>gi|152983580|ref|YP_001349571.1| succinyl-diaminopimelate desuccinylase [Pseudomonas aeruginosa PA7]
 gi|238064773|sp|A6V936|DAPE_PSEA7 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|150958738|gb|ABR80763.1| succinyl-diaminopimelate desuccinylase [Pseudomonas aeruginosa PA7]
          Length = 383

 Score =  242 bits (616), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 156/384 (40%), Positives = 212/384 (55%), Gaps = 14/384 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            LE   +LI+ PSVTP D     +++  L+  GF++E    +      V N +AR G + 
Sbjct: 11  TLELACELIRRPSVTPVDADCQALMMRRLEAAGFALEPMRIEE-----VDNFWARRGGDG 65

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEG-KIYGRGIVDMKGSIACFIAAVARFIPK 123
           P L FAGH DVVP G    W + PF A I E   + GRG  DMKGS+A  I AV RF+  
Sbjct: 66  PVLCFAGHTDVVPTGPVQAWQHQPFDALIDEQGMLCGRGAADMKGSLASMIVAVERFVAD 125

Query: 124 YK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
           +  + G+I+ LIT DEEGPA +GTK ++  +  +GE+ D CIVGEP+   ++GD +K GR
Sbjct: 126 HPGHKGAIAFLITSDEEGPAHHGTKAVVERLAARGERLDWCIVGEPSSTSLVGDVVKNGR 185

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSL   +TI G QGHVAYPHL +NPI    P L +L    +D GN  F PT+ +I+ ++
Sbjct: 186 RGSLGARLTIRGVQGHVAYPHLAKNPIHLAAPALAELAAEHWDDGNAFFPPTSFQISNLN 245

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
            G  + NVIP ++   FN RF+     + L++ + + L K   +       V ++    P
Sbjct: 246 SGTGATNVIPGELSALFNFRFSTESTVEGLQKRVEAILDKHGLD-----WHVEWALSGLP 300

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMHALN 361
            FLT   +L   ++ SI   TG     STSGGTSD RFI      V+E G V  T+H +N
Sbjct: 301 -FLTEPGELLDAVAASIKAVTGRETRPSTSGGTSDGRFIATMGTQVVELGPVNATIHQVN 359

Query: 362 ENASLQDLEDLTCIYENFLQNWFI 385
           E     DLE LT IY   L     
Sbjct: 360 ERVLASDLELLTEIYYQTLVRLLA 383


>gi|260598858|ref|YP_003211429.1| succinyl-diaminopimelate desuccinylase [Cronobacter turicensis
           z3032]
 gi|260218035|emb|CBA32738.1| Succinyl-diaminopimelate desuccinylase [Cronobacter turicensis
           z3032]
          Length = 375

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 149/385 (38%), Positives = 221/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  +          N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLRAVGFTVEPMNIGDTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT    L FAGH DVVP GD   W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GTGE-TLAFAGHTDVVPAGDVERWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ +  G ++ LIT DEE  A NGT K++  +  +GE+ D C+VGEP+ + ++GD +K
Sbjct: 115 VAQHPHHRGRLAFLITSDEEASAANGTVKVVEALMARGERLDYCLVGEPSSSEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P+L++L  I +D GN  F PT+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMLNELVGIEWDRGNEFFPPTSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP  + + FN RF+    ++ +K+ + + L        +L +T+ +   
Sbjct: 235 NIQAGTGSNNVIPGDLHVQFNFRFSTQLTDEMIKQRVVALL-----EQHQLRYTLDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  ++++     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVHHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE     DL+ L  +Y+  ++  
Sbjct: 349 KINECVKASDLQLLARMYQRIMEQL 373


>gi|330504258|ref|YP_004381127.1| succinyl-diaminopimelate desuccinylase [Pseudomonas mendocina
           NK-01]
 gi|328918544|gb|AEB59375.1| succinyl-diaminopimelate desuccinylase [Pseudomonas mendocina
           NK-01]
          Length = 380

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 154/391 (39%), Positives = 217/391 (55%), Gaps = 17/391 (4%)

Query: 1   MTPDC---LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLY 57
           MTP     LE    LI+ PSVTP D G   +++  L   GF +E    +      V+N +
Sbjct: 1   MTPTLTPTLELAFDLIRRPSVTPVDEGCQELMMRRLAACGFEVERMRIEE-----VENFW 55

Query: 58  ARFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEG-KIYGRGIVDMKGSIACFIAA 116
           A+ G + P L FAGH DVVP G  + W Y PF   + E   + GRG  DMKGS+A  I A
Sbjct: 56  AKRGGDGPVLCFAGHTDVVPTGPLDAWQYQPFDVRVDEEGMLCGRGAADMKGSLASMIIA 115

Query: 117 VARFIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIG 175
           V RF+ ++ N  G+IS LIT DEEGPA +GTK ++  + ++GE+ D CIVGEP+   ++G
Sbjct: 116 VERFVAEHPNHKGAISFLITSDEEGPAQHGTKAVVERLRERGERLDWCIVGEPSSTSLLG 175

Query: 176 DTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTN 235
           D +K GRRGSL   +T++GKQGHVAYPHL +NPI    P L +L    +D GN  F PT+
Sbjct: 176 DVVKNGRRGSLGCTLTVYGKQGHVAYPHLAKNPIHLAAPALAELAAEHWDHGNDYFPPTS 235

Query: 236 MEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVH 295
            +++ ++ G  + NVIP ++K  FN RF+     + L++ + + L K   +     + + 
Sbjct: 236 FQVSNLNSGTGATNVIPGELKAVFNFRFSTESTVEGLQQRVTAILDKHGLD-----YHLE 290

Query: 296 FSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVG 354
           ++    P        L   ++ SI N TG     STSGGTSD RFI      V+E G V 
Sbjct: 291 WALSGLPFLTQP-GDLLDAVAASIKNVTGRDTTPSTSGGTSDGRFIATLGTQVVELGPVN 349

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNWFI 385
            T+H +NE     DL+ LT +Y   +     
Sbjct: 350 ATIHQINERVLASDLDLLTEVYYQTMVKLLA 380


>gi|258541766|ref|YP_003187199.1| succinyl-diaminopimelate desuccinylase [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256632844|dbj|BAH98819.1| acetylornithine deacetylase [Acetobacter pasteurianus IFO 3283-01]
 gi|256635901|dbj|BAI01870.1| acetylornithine deacetylase [Acetobacter pasteurianus IFO 3283-03]
 gi|256638956|dbj|BAI04918.1| acetylornithine deacetylase [Acetobacter pasteurianus IFO 3283-07]
 gi|256642010|dbj|BAI07965.1| acetylornithine deacetylase [Acetobacter pasteurianus IFO 3283-22]
 gi|256645065|dbj|BAI11013.1| acetylornithine deacetylase [Acetobacter pasteurianus IFO 3283-26]
 gi|256648120|dbj|BAI14061.1| acetylornithine deacetylase [Acetobacter pasteurianus IFO 3283-32]
 gi|256651173|dbj|BAI17107.1| acetylornithine deacetylase [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654164|dbj|BAI20091.1| acetylornithine deacetylase [Acetobacter pasteurianus IFO 3283-12]
          Length = 391

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 161/378 (42%), Positives = 226/378 (59%), Gaps = 7/378 (1%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +     LI+ PSV+P  G + ++L   L+ LGF +    F         N +AR GT 
Sbjct: 17  DPVGVAQALIRLPSVSPDPGASQYLLAAMLERLGFEVIHLPFGEG-AERTPNFFARLGTG 75

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
           +PH+ +AGH DVVPPG+   W++PP++A I +G +YGRG  DMKG IA F++AVAR +  
Sbjct: 76  SPHICYAGHTDVVPPGNEADWSHPPYAADIVDGVLYGRGACDMKGGIAAFVSAVARHVAA 135

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               GSIS LITGDEEGPA  GT K+L W+ +  +  D C+VGEPT   ++G+ +K+GRR
Sbjct: 136 GPGKGSISFLITGDEEGPATYGTVKVLEWMAQHNQIPDYCLVGEPTNPKVLGEMVKVGRR 195

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL+  I + G QGHVAYPH  +NP+  L+ +L  L     D G   F P+++++T++DV
Sbjct: 196 GSLNAHIVVEGTQGHVAYPHRADNPVHRLLAVLEALRATPLDNGTEYFEPSSLQVTSVDV 255

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GN + NVIPA+ +   NIRFNDL     LK  + +   +           V         
Sbjct: 256 GNGATNVIPARAEARLNIRFNDLHTGAALKGWVETVCRQHAPRSR-----VEIKISGESF 310

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
             +  ++ T+ L ++I   TG  P L T GGTSDARFI  YC V EFGLVG ++H ++E+
Sbjct: 311 LTSPTQE-TTALVEAIKQVTGRTPKLDTGGGTSDARFISRYCAVSEFGLVGASIHKVDEH 369

Query: 364 ASLQDLEDLTCIYENFLQ 381
             + DLE LT IY+ FL+
Sbjct: 370 TDVADLEMLTRIYQTFLE 387


>gi|167855229|ref|ZP_02477999.1| succinyl-diaminopimelate desuccinylase [Haemophilus parasuis 29755]
 gi|167853682|gb|EDS24926.1| succinyl-diaminopimelate desuccinylase [Haemophilus parasuis 29755]
          Length = 377

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 144/382 (37%), Positives = 207/382 (54%), Gaps = 13/382 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +     LI+  S++P D G   ++   L+ +GF +E   F         NL+A  
Sbjct: 1   MQNQIISLSRSLIQRKSISPNDEGCQQLIAERLQAVGFKLEWLPFGD-----TLNLWATH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   P L FAGH DVVP GD + WTYPPFSA I +  +YGRG  DMKGS+A  + A   F
Sbjct: 56  GEGEPCLAFAGHTDVVPEGDESQWTYPPFSAEIVDDMLYGRGAADMKGSLAAMVIACETF 115

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +     + G I+LLIT DEE  A +GT K++  + ++ E    C+VGEP+    +GD +K
Sbjct: 116 VKNNPNHQGKIALLITSDEEAAAKDGTVKVVETLMQRQEPIHYCVVGEPSSTKQLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++  + I G QGHVAYPHL ENP+   +P L +LT   +D GN  F PT+++I 
Sbjct: 176 NGRRGSITANLYIEGIQGHVAYPHLAENPVHTALPFLSELTAYQWDNGNEFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN+R+    N++ +K ++   L K         H + ++  
Sbjct: 236 NIKAGTGSNNVIPGELYVQFNLRYCTEVNDEIIKTKVAEMLRKYGLK-----HRIEWNLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P    +  KL     +++ N T   P L T GGTSD RFI      V+EFG + +T+H
Sbjct: 291 GKPFLADN-GKLVQATIQAVENVTQITPKLDTGGGTSDGRFIALMGAEVVEFGPINQTIH 349

Query: 359 ALNENASLQDLEDLTCIYENFL 380
            +NE  ++ DL     +Y   L
Sbjct: 350 KVNECVNVNDLGKCGEVYYQIL 371


>gi|313106134|ref|ZP_07792389.1| succinyl-diaminopimelate desuccinylase [Pseudomonas aeruginosa
           39016]
 gi|310878891|gb|EFQ37485.1| succinyl-diaminopimelate desuccinylase [Pseudomonas aeruginosa
           39016]
          Length = 383

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 155/384 (40%), Positives = 213/384 (55%), Gaps = 14/384 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            LE   +LI+ PSVTP D     +++  L+  GF++E    +      V N +AR G + 
Sbjct: 11  TLELACELIRRPSVTPLDADCQALMMRRLEAAGFALEPMRIEE-----VDNFWARRGGDG 65

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEG-KIYGRGIVDMKGSIACFIAAVARFI-P 122
           P L FAGH DVVP G    W + PF A I +   + GRG  DMKGS+A  I AV RF+  
Sbjct: 66  PVLCFAGHTDVVPTGPLQAWQHQPFDALIDDQGMLCGRGAADMKGSLASMIVAVERFVAD 125

Query: 123 KYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
             K+ G+I+ LIT DEEGPA +GTK ++  +  +GE+ D CIVGEP+   ++GD +K GR
Sbjct: 126 HPKHKGAIAFLITSDEEGPAHHGTKAVVERLAARGERLDWCIVGEPSSTSLVGDVVKNGR 185

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSL  ++TI G QGHVAYPHL +NPI    P L +L    +D GN  F PT+ +++ ++
Sbjct: 186 RGSLGAKLTIRGVQGHVAYPHLAKNPIHLAAPALAELAAEHWDDGNAFFPPTSFQVSNLN 245

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
            G  + NVIP ++   FN RF+     + L++ + + L K   +       V ++    P
Sbjct: 246 SGTGATNVIPGELTALFNFRFSTESTVEGLQKRVEAILDKHGLD-----WHVEWALSGLP 300

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMHALN 361
            FLT   +L   ++ SI   TG     STSGGTSD RFI      V+E G V  T+H +N
Sbjct: 301 -FLTEPGELLDAVAASIRAVTGRETQPSTSGGTSDGRFIATMGTQVVELGPVNATIHQVN 359

Query: 362 ENASLQDLEDLTCIYENFLQNWFI 385
           E     DLE LT IY   L     
Sbjct: 360 ERVLASDLELLTEIYYQTLVRLLA 383


>gi|113970195|ref|YP_733988.1| succinyl-diaminopimelate desuccinylase [Shewanella sp. MR-4]
 gi|123029684|sp|Q0HJ36|DAPE_SHESM RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|113884879|gb|ABI38931.1| succinyldiaminopimelate desuccinylase [Shewanella sp. MR-4]
          Length = 381

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 152/380 (40%), Positives = 207/380 (54%), Gaps = 13/380 (3%)

Query: 7   EHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPH 66
           E   +LI  PSVTP D G   ++   L  +GF+IE   F+        N++AR G E P 
Sbjct: 12  ELTKELIARPSVTPLDEGCQTLMAERLAAIGFNIEPMVFED-----TTNMWARRGNEGPV 66

Query: 67  LMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKN 126
             FAGH DVVP GD + W  PPF  TI +G +YGRG  DMKGS+A  I A  RF+ K+ N
Sbjct: 67  FCFAGHTDVVPAGDLSRWHTPPFEPTIIDGYLYGRGAADMKGSLAAMIVATERFVAKHPN 126

Query: 127 F-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGS 185
             GSI+ LIT DEEGP INGT +++  +E + EK    +VGEP+    +GD +K GRRGS
Sbjct: 127 HPGSIAFLITSDEEGPFINGTTRVIDTLEARNEKITWALVGEPSSTLKLGDVVKNGRRGS 186

Query: 186 LSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGN 245
           L+  +T+ G QGHVAYPHL +NPI    P L +L+   +D GN  F PT+M+I  I+ G 
Sbjct: 187 LTANLTVKGIQGHVAYPHLADNPIHKAAPFLAELSQTHWDNGNEFFPPTSMQIANINGGT 246

Query: 246 PSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFL 305
            + NVIP  +++ FN R++     + L E + + L     +     + + ++    P   
Sbjct: 247 GASNVIPGTLEVMFNFRYSTEVTAEILIERVEALLTAHELD-----YDISWTFNGLPFLT 301

Query: 306 THDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNENA 364
                L      +I   TG      T+GGTSD RFI      V+E G V  T+H +NE  
Sbjct: 302 GE-GPLLDATRHAIRQITGYDTDPQTTGGTSDGRFIAPTGAKVLELGPVNATIHKVNECV 360

Query: 365 SLQDLEDLTCIYENFLQNWF 384
            + DLE L   YE  L+   
Sbjct: 361 KIDDLEQLALCYEVILEQLL 380


>gi|152971336|ref|YP_001336445.1| succinyl-diaminopimelate desuccinylase [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|238064758|sp|A6TC94|DAPE_KLEP7 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|150956185|gb|ABR78215.1| succinyl-diaminopimelate desuccinylase [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
          Length = 375

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 151/385 (39%), Positives = 219/385 (56%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELAQQLIRRPSLSPDDAGCQALMIERLRAIGFTVEPMDFGDTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GHGE-TLAFAGHTDVVPAGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + +Y N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQYPNHRGRLAFLITSDEEASAKNGTVKVVETLMARNERLDYCLVGEPSSTEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P+L +L NI +D GN  F PT+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMLAELVNIEWDKGNEFFPPTSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            +  G  S NVIP  + + FN RF+    ++ +K  + + L K      +L + + +   
Sbjct: 235 NVQSGTGSNNVIPGDMFVQFNFRFSTELTDEMIKSRVIALLEK-----YQLRYRLEWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTGRGKLVDAVVNAIEHYNEIKPQLLTNGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRVMEQL 373


>gi|16761400|ref|NP_457017.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29140903|ref|NP_804245.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|213053079|ref|ZP_03345957.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213425363|ref|ZP_03358113.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213649879|ref|ZP_03379932.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213851969|ref|ZP_03381501.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|289828740|ref|ZP_06546530.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|81513418|sp|Q8Z4S2|DAPE_SALTI RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|25320458|pir||AG0816 succinyl-diaminopimelate desuccinylase [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16503700|emb|CAD02683.1| succinyl-diaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29136528|gb|AAO68094.1| succinyldiaminopimelate desuccinylase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
          Length = 375

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 153/385 (39%), Positives = 220/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF+IE  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDVGCQALMIERLRKIGFTIEHMDFGDTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GRGE-TLAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ +  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   I+GD +K
Sbjct: 115 VAQHPHHRGRLAFLITSDEEASAKNGTVKVVEALMARNERLDYCLVGEPSSTEIVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDRGNDFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +KE + + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKERVHALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|49088452|gb|AAT51571.1| PA1162 [synthetic construct]
          Length = 384

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 153/384 (39%), Positives = 213/384 (55%), Gaps = 14/384 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            LE   +LI+ PSVTP D     +++  L+  GF++E    +      V N +AR G + 
Sbjct: 11  TLELACELIRRPSVTPLDADCQALMMRRLEAAGFALEPMRIEE-----VDNFWARRGGDG 65

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEG-KIYGRGIVDMKGSIACFIAAVARFIPK 123
           P L FAGH DVVP G    W + PF A I +   + GRG  DMKGS+A  I AV RF+  
Sbjct: 66  PVLCFAGHTDVVPTGPLQAWQHQPFDALIDDQGMLCGRGAADMKGSLASMIVAVERFVAD 125

Query: 124 YK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
           +  + G+I+ LIT DEEGPA +GTK ++  +  +GE+ D CIVGEP+   ++GD +K GR
Sbjct: 126 HPEHKGAIAFLITSDEEGPAHHGTKAVVERLAARGERLDWCIVGEPSSTSLVGDVVKNGR 185

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSL  ++TI G QG+VAYPHL +NPI    P L +L    +D GN  F PT+ +++ ++
Sbjct: 186 RGSLGAKLTIRGVQGYVAYPHLAKNPIHLAAPALAELAAEHWDDGNAFFPPTSFQVSNLN 245

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
            G  + NVIP ++   FN RF+     + L++ + + L K   +       V ++    P
Sbjct: 246 SGTGATNVIPGELTALFNFRFSTESTVEGLQKRVEAILDKHGLD-----WHVEWALSGLP 300

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMHALN 361
            FLT   +L   ++ SI   TG     STSGGTSD RFI      V+E G V  T+H +N
Sbjct: 301 -FLTEPGELLDAVAASIRAVTGRETQPSTSGGTSDGRFIATMGTQVVELGPVNATIHQVN 359

Query: 362 ENASLQDLEDLTCIYENFLQNWFI 385
           E     DLE LT IY   L     
Sbjct: 360 ERVLASDLELLTEIYYQTLVRLLA 383


>gi|294635444|ref|ZP_06713932.1| succinyl-diaminopimelate desuccinylase [Edwardsiella tarda ATCC
           23685]
 gi|291091177|gb|EFE23738.1| succinyl-diaminopimelate desuccinylase [Edwardsiella tarda ATCC
           23685]
          Length = 377

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 148/383 (38%), Positives = 220/383 (57%), Gaps = 13/383 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L    QLI+CPS++P D G   IL+  L+ L F IE             NL+A  G E 
Sbjct: 6   VLALAQQLIRCPSLSPDDAGCQEILMARLRALDFHIEAMPHGETR-----NLWAWRGGEG 60

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P L FAGH DVVPPGD   W +PPF+ T+ +G +YGRG  DMKGS+A  I A  RF+  +
Sbjct: 61  PVLAFAGHTDVVPPGDERQWRHPPFTPTLEDGLLYGRGAADMKGSLAAMIVAAERFVAAH 120

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               G ++ LIT DEE  A +GT +++  +  +GE+ D C+VGEP+    +GD +K GRR
Sbjct: 121 PTHAGRLAFLITSDEEASARDGTVRVVETLMARGERLDYCLVGEPSSEQRLGDVVKNGRR 180

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++ ++T+HG QGHVAYPHL +NP+    P+L +L  I +D GN  F PT+++I  +  
Sbjct: 181 GSITADLTVHGIQGHVAYPHLADNPVHRAAPMLAELVAIEWDRGNDFFPPTSLQIANLAA 240

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  S NVIP ++ + FN+RF+   + +++++ + + L         L +T+++S    P 
Sbjct: 241 GTGSNNVIPGELYVQFNLRFSTESSVESIQQRVTALL-----ERHGLRYTLNWSLSGLP- 294

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
           FLT    L   +  ++    G  P L T+GGTSD RFI      V+E G +  T+H ++E
Sbjct: 295 FLTPGGALVEAVVDAVNCYAGQAPRLLTTGGTSDGRFIARMGAQVVELGPLNATIHKVDE 354

Query: 363 NASLQDLEDLTCIYENFLQNWFI 385
             S  DL+ L  +Y+  ++    
Sbjct: 355 CVSAADLQRLCRMYQRIMERLLA 377


>gi|156932975|ref|YP_001436891.1| succinyl-diaminopimelate desuccinylase [Cronobacter sakazakii ATCC
           BAA-894]
 gi|238064785|sp|A7ML10|DAPE_ENTS8 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|156531229|gb|ABU76055.1| hypothetical protein ESA_00778 [Cronobacter sakazakii ATCC BAA-894]
          Length = 375

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 150/385 (38%), Positives = 222/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +L+  L+ +GF++E  +          N +A  
Sbjct: 1   MSCPVIELTQQLIRRPSLSPDDAGCQALLIERLQAVGFTVEPMNIGDTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT    L FAGH DVVP GD   W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GTGE-TLAFAGHTDVVPAGDVERWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ +  G ++ LIT DEE  A NGT K++  +  +GE+ D C+VGEP+ + ++GD +K
Sbjct: 115 VAQHPHHRGRLAFLITSDEEASATNGTVKVVEALMARGERLDYCLVGEPSSSEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P+L++L  I +D GN  F PT+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMLNELVGIEWDRGNEFFPPTSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP  + + FN RF+    ++ +K+ + + L K      +L +T+ +   
Sbjct: 235 NIQAGTGSNNVIPGDLHVQFNFRFSTELTDEMIKQRVVALLEK-----YQLRYTLDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  ++++     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVHHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE     DL+ L  +Y+  ++  
Sbjct: 349 KINECVKASDLQLLARMYQRIMEQL 373


>gi|119505659|ref|ZP_01627729.1| succinyl-diaminopimelate desuccinylase [marine gamma
           proteobacterium HTCC2080]
 gi|119458471|gb|EAW39576.1| succinyl-diaminopimelate desuccinylase [marine gamma
           proteobacterium HTCC2080]
          Length = 383

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 145/383 (37%), Positives = 201/383 (52%), Gaps = 13/383 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            +    QLI+C SVTP D G   I++  L   GF+ E   F       V N +A  G   
Sbjct: 10  AVALTRQLIQCSSVTPDDAGCQEIMMQRLTAAGFTCEPMRFGD-----VDNFWATRGEGE 64

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
             L+FAGH DVVPPG  + W+ PPF+ T  +G +YGRG  DMK S+A    A   F  +Y
Sbjct: 65  STLVFAGHTDVVPPGPDSAWSTPPFTPTDRDGVLYGRGAADMKASLAAMTVAAEAFAKQY 124

Query: 125 -KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
             + G +  LIT DEEGPA +GT K++  +  +GE+ D C+VGEP+ +  +GD IK GRR
Sbjct: 125 SDHSGRVGFLITADEEGPATDGTVKVVEALIARGERLDWCVVGEPSSSKSLGDVIKNGRR 184

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++G ITI GKQGH+AYP   +NPI      L  L    +D GN  F PT ++   I  
Sbjct: 185 GSINGVITIRGKQGHIAYPQFADNPIHSAFLALDALAKEPWDEGNAFFEPTRLQFGNIQA 244

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NVIP  +   FN+RF+   +  T++      L   + +       + +     P 
Sbjct: 245 GTGATNVIPGSLSAQFNVRFSTETDATTIRSRCEQILSAHVAD-----FDIEWRLSGEP- 298

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
           FLT    L   ++ SI   TG  P LST GGTSD RFI      ++E G +  ++H ++E
Sbjct: 299 FLTKPGALVDAVTASIEAITGTSPTLSTGGGTSDGRFIAKTGTQIVELGPINASIHQIDE 358

Query: 363 NASLQDLEDLTCIYENFLQNWFI 385
           +  L D+  LT IY   +     
Sbjct: 359 HILLSDIPRLTAIYYGIMTRLLA 381


>gi|114047616|ref|YP_738166.1| succinyl-diaminopimelate desuccinylase [Shewanella sp. MR-7]
 gi|123030587|sp|Q0HUU6|DAPE_SHESR RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|113889058|gb|ABI43109.1| succinyldiaminopimelate desuccinylase [Shewanella sp. MR-7]
          Length = 381

 Score =  241 bits (614), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 152/380 (40%), Positives = 207/380 (54%), Gaps = 13/380 (3%)

Query: 7   EHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPH 66
           E   +LI  PSVTP D G   ++   L  +GF+IE   F+        N++AR G E P 
Sbjct: 12  ELTKELIARPSVTPLDEGCQTLMAERLAAIGFNIEPMVFED-----TTNMWARRGNEGPV 66

Query: 67  LMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKN 126
             FAGH DVVP GD + W  PPF  TI +G +YGRG  DMKGS+A  I A  RF+ K+ N
Sbjct: 67  FCFAGHTDVVPAGDLSRWHTPPFEPTIIDGYLYGRGAADMKGSLAAMIVATERFVAKHPN 126

Query: 127 F-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGS 185
             GSI+ LIT DEEGP INGT +++  +E + EK    +VGEP+    +GD +K GRRGS
Sbjct: 127 HPGSIAFLITSDEEGPFINGTTRVIDTLEARNEKITWALVGEPSSTLKLGDVVKNGRRGS 186

Query: 186 LSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGN 245
           L+  +T+ G QGHVAYPHL +NPI    P L +L+   +D GN  F PT+M+I  I+ G 
Sbjct: 187 LTANLTVKGIQGHVAYPHLADNPIHKAAPFLAELSQTHWDNGNEFFPPTSMQIANINGGT 246

Query: 246 PSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFL 305
            + NVIP  +++ FN R++     + L E + + L     +     + + ++    P   
Sbjct: 247 GASNVIPGTLEVMFNFRYSTEVTAEILIERVEALLTAHELD-----YDISWTFNGLPFLT 301

Query: 306 THDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNENA 364
                L      +I   TG      T+GGTSD RFI      V+E G V  T+H +NE  
Sbjct: 302 GE-GPLLDATRHAIRQITGYDTDPQTTGGTSDGRFIAPTGAKVLELGPVNATIHKVNECV 360

Query: 365 SLQDLEDLTCIYENFLQNWF 384
            + DLE L   YE  L+   
Sbjct: 361 KIDDLEQLALCYEVILEQLL 380


>gi|260772309|ref|ZP_05881225.1| N-succinyl-L,L-diaminopimelate desuccinylase [Vibrio metschnikovii
           CIP 69.14]
 gi|260611448|gb|EEX36651.1| N-succinyl-L,L-diaminopimelate desuccinylase [Vibrio metschnikovii
           CIP 69.14]
          Length = 378

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 157/382 (41%), Positives = 213/382 (55%), Gaps = 13/382 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L     LI   SVTP D G   +++  L  LGF+IE   F+        N +AR GTE 
Sbjct: 6   VLALAKDLISRESVTPNDAGCQQVMIERLIALGFNIEPMIFED-----TTNFWARKGTEG 60

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P  +FAGH DVVP G    W  PPF  T+ +G ++GRG  DMKGS+AC I AV RF+ K+
Sbjct: 61  PLFVFAGHTDVVPAGPLFQWHTPPFEPTVIDGYLHGRGAADMKGSLACMIVAVERFLAKH 120

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
            N  GSI  LIT DEEGP INGT K++  +  + E  D CIVGEP+    +GD +K GRR
Sbjct: 121 PNHKGSIGFLITSDEEGPFINGTTKVVDTLMARNELIDMCIVGEPSSTLKVGDVVKNGRR 180

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++G++TI G QGHVAYPHL  NP+   +P L +L    +D GN  F PT+ +I  +  
Sbjct: 181 GSITGDLTIKGTQGHVAYPHLASNPVHQALPALAELAATTWDNGNAYFPPTSFQIPNLQA 240

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NVIP +  + FN RF+    E+ +K  + S L     +   L + + ++    P 
Sbjct: 241 GTGASNVIPGEFSVQFNFRFSTELTEQEIKRRVHSVL-----DAHGLDYELKWTLSGDPF 295

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
                  L   +  ++       P L T+GGTSD RFI      V+E G V  T+H +NE
Sbjct: 296 LTDAGS-LLDAVVCAVQEVNHQQPQLLTTGGTSDGRFIAKMGAQVVELGPVNATIHKVNE 354

Query: 363 NASLQDLEDLTCIYENFLQNWF 384
             S+ DLE LT +Y+N L++ F
Sbjct: 355 CVSIADLEKLTDMYQNVLEHLF 376


>gi|261496684|ref|ZP_05993063.1| asparaginase [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261307653|gb|EEY08977.1| asparaginase [Mannheimia haemolytica serotype A2 str. OVINE]
          Length = 382

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 143/392 (36%), Positives = 209/392 (53%), Gaps = 17/392 (4%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  + +     LI+  S++PQD G    +   L+  GF+IE   F         NL+A  
Sbjct: 1   MKNEIISLAQNLIRRDSISPQDKGCQQEIAQRLEKRGFNIEWLPFGD-----TLNLWATH 55

Query: 61  GTE----APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAA 116
           G+E     P ++FAGH DVVP GD + W YPPFSA I +G +YGRG  DMKGS++  + A
Sbjct: 56  GSENGKTEPCIVFAGHTDVVPVGDESQWAYPPFSAEIVDGMLYGRGAADMKGSLSALVVA 115

Query: 117 VARFIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIG 175
              F+  + N  G ++LLIT DEE  A +GT K++  +  + E     +VGEP+ + + G
Sbjct: 116 AETFVQHHPNHKGKVALLITSDEEAAAKDGTVKVVETLMARNEAVHYAVVGEPSSSKVFG 175

Query: 176 DTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTN 235
           D IK GRRGS++ ++ I G QGHVAYPHL ENP+   +  L  LT   +D GN  F PT+
Sbjct: 176 DVIKNGRRGSITADLYIEGIQGHVAYPHLAENPVHTSLGFLTDLTTYQWDNGNEFFPPTS 235

Query: 236 MEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVH 295
           ++I  I  G  S NVIP ++ + FN+R+     ++ +K ++   L K         + + 
Sbjct: 236 LQIANIKAGTGSNNVIPGELYIQFNLRYCTEVTDEIIKAKVTEMLEKQGLK-----YRIS 290

Query: 296 FSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVG 354
           ++    P    +  KL     +++ N     P L T GGTSD RFI      V+EFG + 
Sbjct: 291 WNLSGKPFLAGN-GKLVEAALQAVENVAKITPRLDTGGGTSDGRFIALMGAEVVEFGPLN 349

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNWFIT 386
            T+H +NE  S+ +L     IY   L+    T
Sbjct: 350 TTIHKVNECVSVDNLAHCGEIYYQILEKLLAT 381


>gi|89900829|ref|YP_523300.1| succinyl-diaminopimelate desuccinylase [Rhodoferax ferrireducens
           T118]
 gi|122479227|sp|Q21WT4|DAPE_RHOFD RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|89345566|gb|ABD69769.1| succinyldiaminopimelate desuccinylase [Rhodoferax ferrireducens
           T118]
          Length = 391

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 152/391 (38%), Positives = 216/391 (55%), Gaps = 17/391 (4%)

Query: 3   PDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT 62
           P  L    QLI  PS+TP D G   I+   L  LGFS E       +   V NL+A+   
Sbjct: 2   PKTLHLAEQLIARPSLTPDDAGCQQIIAERLAPLGFSCETITSGPADF-RVTNLWAKRAA 60

Query: 63  EA--------PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFI 114
                       ++FAGH D+VP G    W   PF+ T  +GK+YGRG  DMK S+A F+
Sbjct: 61  APVKSAQHTTKLVVFAGHTDIVPSGPVQQWRCHPFTPTQFDGKLYGRGAADMKTSLAAFV 120

Query: 115 AAVARFIPKYKNFG-SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHI 173
            AV  F+    +   +I  L+T DEEGPA++GT K+   ++ +GE+ D CIVGEPT    
Sbjct: 121 VAVEEFLTAQPDTALAIGFLLTSDEEGPALDGTVKVCEALQARGERIDYCIVGEPTSLER 180

Query: 174 IGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSP 233
            GD IK GRRG+LS  +T+ G QGH+AYPHL +NPI  + P L +L  + +D GN  F P
Sbjct: 181 TGDMIKNGRRGTLSARLTVKGVQGHIAYPHLAKNPIHLVAPALAELVGVEWDRGNAFFPP 240

Query: 234 TNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHT 293
           T+ +I+ I  G  + NVIP  V + FN RF+     ++L+  + + L +   +     + 
Sbjct: 241 TSWQISNIHSGTGASNVIPGAVVIDFNFRFSTESTPESLQTRLAAVLERHELD-----YE 295

Query: 294 VHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGL 352
           + ++   +P  LT    L   +  +I   TG   +LST+GGTSD RFI   CP VIEFG 
Sbjct: 296 LAWTLGGTPF-LTEPGTLVDAVVDAIKQETGLTTVLSTTGGTSDGRFIARICPQVIEFGP 354

Query: 353 VGRTMHALNENASLQDLEDLTCIYENFLQNW 383
              ++H ++E+ ++ D+E LT IY   L+N 
Sbjct: 355 PNASIHKIDEHINVADIEPLTNIYRRVLENL 385


>gi|312796232|ref|YP_004029154.1| succinyl-diaminopimelate desuccinylase [Burkholderia rhizoxinica
           HKI 454]
 gi|312168007|emb|CBW75010.1| Succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) [Burkholderia
           rhizoxinica HKI 454]
          Length = 379

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 154/385 (40%), Positives = 213/385 (55%), Gaps = 17/385 (4%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYA-RFGTE 63
            L     LI   SVTP+D G   ++   L  LGF+ E           V NL+A + G +
Sbjct: 4   TLALTEALIGRASVTPEDAGCQALMAERLVALGFTCETI-----AEGGVTNLWALKRGAD 58

Query: 64  APH---LMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
            P    L FAGH DVVP G    W   PF     +G++YGRG  DMK S+A F+ A   F
Sbjct: 59  GPAGKLLAFAGHTDVVPTGPLEQWRSDPFVPVRRDGRLYGRGAADMKASLAAFVVAAEEF 118

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  +    GSI LLIT DEEGPA  GT K++  +E +GE+ D C+VGEPT +   GDT+K
Sbjct: 119 VAAHPQHRGSIGLLITSDEEGPARYGTVKVVERLEARGERLDYCVVGEPTSSERFGDTVK 178

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSLSG +T+ G QGH+AYPHL +NP+  L P L +L  + +D GN  F PT  +I+
Sbjct: 179 NGRRGSLSGTLTVRGIQGHIAYPHLAKNPVHLLAPALAELVRVAWDQGNEYFPPTTWQIS 238

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            +  G  + N+IP    + FN RF+       LK  + + L     +   L +T+ ++  
Sbjct: 239 NLHAGTGATNIIPGSASIDFNFRFSTATTPDELKARVHAIL-----DAHGLDYTLTWNLS 293

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMH 358
             P FLT   +L++ L ++I   TG  P+LST+GGTSD RFI   C  VIEFG    ++H
Sbjct: 294 GMP-FLTPRGELSNALEQAIEAETGIRPVLSTTGGTSDGRFIARICKQVIEFGPCNASIH 352

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            ++E+  L  +E L  +Y   L+  
Sbjct: 353 KVDEHIELAHIEPLKNVYRGVLERL 377


>gi|325921719|ref|ZP_08183548.1| succinyldiaminopimelate desuccinylase [Xanthomonas gardneri ATCC
           19865]
 gi|325547796|gb|EGD18821.1| succinyldiaminopimelate desuccinylase [Xanthomonas gardneri ATCC
           19865]
          Length = 376

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 138/385 (35%), Positives = 211/385 (54%), Gaps = 13/385 (3%)

Query: 3   PDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT 62
            D ++   +LI  PSVTP D G   ++   L   GF+IE           V NL+A  G+
Sbjct: 2   SDIVDLTCELISRPSVTPDDAGCQELIAQRLARAGFAIEHL-----RLGAVDNLWATHGS 56

Query: 63  EAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIP 122
            AP L+  GH DVVPPG    WT  PF   I +G +YGRG  DMK  +A F+ A  +F+ 
Sbjct: 57  GAPVLVLLGHTDVVPPGPREAWTSDPFDPQIRDGVLYGRGAADMKSGVAAFVVAAEQFVA 116

Query: 123 KYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
            +    G+++LL+T DEEG AI+G +++     ++G+  D CI GEP+    +GD +++G
Sbjct: 117 AHPQHTGTLALLLTSDEEGNAIDGVRRVAELFRERGQAIDWCITGEPSSTERLGDLLRVG 176

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSLSG +T+ G QGHVAYPH   NPI    P L +L    +D G  +F PT+++I+ I
Sbjct: 177 RRGSLSGTLTVKGVQGHVAYPHKARNPIHLAAPALAELVARRWDEGFESFPPTSLQISNI 236

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
             G  + NVIP +++++FN+R+   W+   L+ EI + L +         +++ +     
Sbjct: 237 HAGTGANNVIPGELQVAFNLRYTPHWDAPRLEAEIAAVLDRHALE-----YSLRWHRSGE 291

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHAL 360
           P +     +L S+  + +    G  P  ST GGTSDARFI       IE G V  ++H +
Sbjct: 292 PFYTPE-GRLRSVAREVLGQFAGAPPEESTGGGTSDARFIAPLGAQCIEVGPVNASIHQV 350

Query: 361 NENASLQDLEDLTCIYENFLQNWFI 385
           +E+  + DL+ L  +Y   ++   +
Sbjct: 351 DEHVRVADLDALPTLYRTLIERLLV 375


>gi|224825859|ref|ZP_03698963.1| succinyl-diaminopimelate desuccinylase [Lutiella nitroferrum 2002]
 gi|224602083|gb|EEG08262.1| succinyl-diaminopimelate desuccinylase [Lutiella nitroferrum 2002]
          Length = 375

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 162/387 (41%), Positives = 232/387 (59%), Gaps = 14/387 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT   +    +LI+  SVTP D G    ++  L+ +GF++E   +       V N +AR 
Sbjct: 1   MTNTLM-LTEELIRLDSVTPNDAGCQERMIARLEAVGFTVERMRYGD-----VDNFWARR 54

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT  P + FAGH DVVP G  + W   PF  TI  G ++GRG  DMK S+A FI ++ RF
Sbjct: 55  GTSGPVVCFAGHTDVVPTGPLDKWDSHPFEPTIRNGYLFGRGAADMKASLAAFITSIERF 114

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++  + GSI+LLIT DEEG AI+GT +++  +E +GE  D CIVGEPT NH++GDTIK
Sbjct: 115 VAQHPGHPGSIALLITSDEEGSAIDGTVRVVDALEARGELIDYCIVGEPTSNHVLGDTIK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSLSG + +HG QGH+AYPHL +NP+  + P L +L    +D GN  F PT+ +++
Sbjct: 175 NGRRGSLSGHLIVHGIQGHIAYPHLAKNPVHLIAPALAELAAEEWDQGNHHFPPTSWQVS 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + N+IP   ++ FN RF+     +TLK+ +   L     +   L++ +H++  
Sbjct: 235 NINAGTGATNIIPGSCEVKFNFRFSTEHTAETLKDRVHHIL-----DAHGLAYELHWTLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMH 358
            +P FLT +  LT  L +SI    G    LST+GGTSD RFIK     + EFG V  ++H
Sbjct: 290 GNP-FLTEEGTLTRALERSIKQVMGVDAELSTTGGTSDGRFIKRIARELAEFGPVNASIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFI 385
            LNE   +  +E L+ IYE  L+N  +
Sbjct: 349 KLNECVEVHAIERLSDIYEAALKNLLL 375


>gi|331653893|ref|ZP_08354894.1| succinyl-diaminopimelate desuccinylase [Escherichia coli M718]
 gi|331048742|gb|EGI20818.1| succinyl-diaminopimelate desuccinylase [Escherichia coli M718]
          Length = 375

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 152/385 (39%), Positives = 220/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI  PS++P D G   +L+  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELTQQLIHRPSLSPDDAGCQALLIERLQAIGFTVERMDFADTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVPPGD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GQGE-TLAFAGHTDVVPPGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++ N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQHPNHTGRLAFLITSDEEASAHNGTVKVVEALMARNERLDYCLVGEPSSIEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P L++L  I +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDQGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    ++ +K ++ + L K      +L +TV +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDEMIKAQVLALLEK-----HQLRYTVDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRIMEQL 373


>gi|238895931|ref|YP_002920667.1| succinyl-diaminopimelate desuccinylase [Klebsiella pneumoniae
           NTUH-K2044]
 gi|238548249|dbj|BAH64600.1| succinyl-diaminopimelate desuccinylase [Klebsiella pneumoniae
           subsp. pneumoniae NTUH-K2044]
          Length = 375

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 153/385 (39%), Positives = 220/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF+IE  DF         N +A  
Sbjct: 1   MSCPVIELAQQLIRRPSLSPDDAGCQALMIERLRAIGFTIEPMDFGDTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GHGE-TLAFAGHTDVVPAGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + +Y N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQYPNHRGRLAFLITSDEEASAKNGTVKVVETLMARNERLDYCLVGEPSSTEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P+L +L NI +D GN  F PT+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMLAELVNIEWDKGNEFFPPTSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            +  G  S NVIP  + + FN RF+    ++ +K  + + L K      +L ++V +   
Sbjct: 235 NVQSGTGSNNVIPGDMFVQFNFRFSTELTDEMIKSRVIALLEK-----YQLRYSVEWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTGRGKLVDAVVNAIEHYNEIKPQLLTNGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRVMEQL 373


>gi|119469290|ref|ZP_01612229.1| succinyl-diaminopimelate desuccinylase [Alteromonadales bacterium
           TW-7]
 gi|119447154|gb|EAW28423.1| succinyl-diaminopimelate desuccinylase [Alteromonadales bacterium
           TW-7]
          Length = 375

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 156/384 (40%), Positives = 217/384 (56%), Gaps = 13/384 (3%)

Query: 3   PDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT 62
            + +     LI+  SVTP+D G   ++   L+ +GF+IE   F         N +AR G 
Sbjct: 2   NEVIALAQALIQRESVTPEDAGCQQMMNERLEAIGFNIESLFFTD-----TLNTWARKGD 56

Query: 63  EAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIP 122
           ++PH  FAGH DVVP G   +W +PPFS  +  G ++GRG  DMKGS+A  I A  RFI 
Sbjct: 57  QSPHFCFAGHTDVVPTGPAKNWQHPPFSGLVENGLLHGRGAADMKGSLAAMIVATERFIT 116

Query: 123 KYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
           KY N  GSIS LIT DEEGP INGT +++  +E +GEK D C+VGEP+   ++GD +K G
Sbjct: 117 KYPNHKGSISFLITSDEEGPFINGTTRVIDTLESRGEKIDMCLVGEPSSRDVLGDVVKNG 176

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSL+G + + G QGHVAYPHL +NPI      L +L+   +D GN  F  T+ +I+ I
Sbjct: 177 RRGSLTGFVKVKGIQGHVAYPHLAQNPIHLATEALTELSQTQWDKGNDFFPATSFQISNI 236

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
           + G  + NVIP ++ + FN RF+     + L++ +   L K   N     + +++     
Sbjct: 237 NGGTGAGNVIPGELDVQFNFRFSTEVTHQQLQQRVIDILQKHNLN-----YELNWIVNGL 291

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHAL 360
           P F+T    L      +I + TG +  L T+GGTSD RFI      VIE G    T+H +
Sbjct: 292 P-FITEHGPLVDATVNAIESVTGLVTNLETTGGTSDGRFIAQTGAKVIELGPRNATIHKV 350

Query: 361 NENASLQDLEDLTCIYENFLQNWF 384
           +E  S  DL  LT IYE  L+   
Sbjct: 351 DECVSTDDLIKLTDIYEQILEQLL 374


>gi|209695800|ref|YP_002263730.1| succinyl-diaminopimelate desuccinylase [Aliivibrio salmonicida
           LFI1238]
 gi|238055205|sp|B6EJS8|DAPE_ALISL RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|208009753|emb|CAQ80059.1| succinyl-diaminopimelate desuccinylase [Aliivibrio salmonicida
           LFI1238]
          Length = 377

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 153/383 (39%), Positives = 210/383 (54%), Gaps = 13/383 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L     L+   SVTP+D G   +++  LK LGF+IE   F+        N +AR GTEA
Sbjct: 6   TLTLAKDLLSRQSVTPEDAGCQELMIKRLKALGFTIEIMVFED-----TTNFWARRGTEA 60

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P   FAGH DVVP G    W   PF  TI +G +Y RG  DMKGS+AC I AV RFI ++
Sbjct: 61  PLFTFAGHTDVVPTGSLTQWNTDPFEPTIIDGMLYARGAADMKGSLACMIVAVERFISEH 120

Query: 125 K-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
             + GS+S LIT DEEGP INGT +++  ++++ E  D CIVGEP+    +GD +K GRR
Sbjct: 121 PEHKGSLSFLITSDEEGPFINGTTRVVDTLKERNEIIDMCIVGEPSSTQYVGDVVKNGRR 180

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL+G +T+ G QGHVAYPH+  NPI   +  L +LT   +D GN  F PT+ +I  ++ 
Sbjct: 181 GSLTGNLTVKGIQGHVAYPHIARNPIHQSMAALLELTMTEWDLGNAYFPPTSFQIPNMNS 240

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NVIP   ++ FN RF+     + L++ +   L K         + + +     P 
Sbjct: 241 GTGASNVIPGTAEIMFNFRFSTESTVEGLQQRVIELLDKHNLE-----YDLDWIINGLPF 295

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
                  L + +  ++       P L T+GGTSD RFI      VIE G V  T+H +NE
Sbjct: 296 LTD-TGDLLTAVVDAVATVNQQKPELLTTGGTSDGRFIAQMGSQVIELGPVNATIHKVNE 354

Query: 363 NASLQDLEDLTCIYENFLQNWFI 385
              + DLE LT +Y+  L N   
Sbjct: 355 CVKVDDLEKLTDMYQEVLNNLLA 377


>gi|238064828|sp|Q5FPX5|DAPE_GLUOX RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 381

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 173/380 (45%), Positives = 226/380 (59%), Gaps = 9/380 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +     L++C SVTP DGGA  +L   L+ +GF      F   +     NLYAR G  
Sbjct: 9   DPVALARDLLRCQSVTPADGGAQALLAGVLEGMGFETFHLPFGPADVP-TPNLYARLGKG 67

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            P L FAGH DVVPPG+   W + PF+A I   ++YGRGI DMKG +ACF+AAVAR + +
Sbjct: 68  HPALCFAGHTDVVPPGE--GWAHDPFAAVIEGDRLYGRGIADMKGGVACFVAAVARRLEQ 125

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               GS+SLLITGDEEGPA  GTK ++ W+ ++GE  D C++GEPT    +GD IKIGRR
Sbjct: 126 GPLKGSVSLLITGDEEGPAHFGTKPVIEWLAERGELPDFCVLGEPTNPQALGDVIKIGRR 185

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++  +T+HG QGHVAYPHL +NP+  L+    +LT    D G+  F P+++++T+IDV
Sbjct: 186 GSMNAVVTVHGTQGHVAYPHLADNPVHRLLAAFSELTARELDAGSEWFDPSSLQVTSIDV 245

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GN + N+IP       NIRFNDL     L   I   + +                     
Sbjct: 246 GNGATNIIPGSAVGRLNIRFNDLHTGAALTAWIEDVVRRHAPQADVQVSI------SGEA 299

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           FLT      + LS+++ + TG  P L T GGTSDARFI  YC V EFGLVG TMH  +EN
Sbjct: 300 FLTQPGDAVTCLSEAVRSVTGRTPRLDTGGGTSDARFISQYCEVAEFGLVGATMHKRDEN 359

Query: 364 ASLQDLEDLTCIYENFLQNW 383
             L  LEDLT IY  F++ +
Sbjct: 360 VELGTLEDLTRIYLAFMEGY 379


>gi|330813517|ref|YP_004357756.1| N-succinyl-L,L-diaminopimelate desuccinylase [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327486612|gb|AEA81017.1| N-succinyl-L,L-diaminopimelate desuccinylase [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 386

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 181/364 (49%), Positives = 232/364 (63%), Gaps = 3/364 (0%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           L    +LIK PSVTP D GA  ++   LK LGF     +F+ KNT  +KNLYAR GT +P
Sbjct: 8   LSFTKELIKIPSVTPIDAGAIDLVTKRLKSLGFKCTILNFKDKNTPPIKNLYARLGTSSP 67

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI-PKY 124
           +  FAGH DVVP G+   W   PFS  +  GKIYGRG  DMKG IACFIAAV+ FI  + 
Sbjct: 68  NFCFAGHTDVVPTGNAKSWDAGPFSGIVKNGKIYGRGASDMKGGIACFIAAVSEFIKDQK 127

Query: 125 KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
           K  GSIS +ITGDEEG AINGTKK++++++KK EK D CIVGEP+   ++G  +KIGRRG
Sbjct: 128 KFKGSISFIITGDEEGVAINGTKKVVNYLKKKKEKIDFCIVGEPSNRKVLGQMMKIGRRG 187

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           S++  +T+ G QGHVAYPH   NP   LI +L +L +   D G   F P+N+EIT I   
Sbjct: 188 SITTHLTLSGIQGHVAYPHEACNPSTPLIKILDKLKSTKLDNGTNNFQPSNLEITKIGTD 247

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
           + + NVIPA    +FNIRFN+  N  +LK++I S +++ I    K    V FS   +   
Sbjct: 248 SHADNVIPATSSATFNIRFNNKHNHSSLKKKI-STIVQTIAKKYKCKPIVKFSETGTAFI 306

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNENA 364
                +   ++S+ I   T   P+LSTSGGTSDARFIKD  P +EFGLVG TMH +NE  
Sbjct: 307 TKP-GETVRMMSQVIKKITNKKPVLSTSGGTSDARFIKDIAPCVEFGLVGNTMHKINECV 365

Query: 365 SLQD 368
           S+ D
Sbjct: 366 SVND 369


>gi|307130027|ref|YP_003882043.1| N-succinyl-L,L-diaminopimelate desuccinylase [Dickeya dadantii
           3937]
 gi|306527556|gb|ADM97486.1| N-succinyl-L,L-diaminopimelate desuccinylase [Dickeya dadantii
           3937]
          Length = 375

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 145/385 (37%), Positives = 221/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLIK PS++P D G   +++  L+ +GF +E+ D          N +A  
Sbjct: 1   MSCPVIELAQQLIKRPSLSPDDAGCQALMIERLQAIGFIVEKLDVDDTQ-----NFWACR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVP G+ + W  PPF   I +G +YGRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGKTLAFAGHTDVVPVGNESQWQTPPFEPAIRDGMLYGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  +  + G ++ LIT DEE  A+NGT K++  +  + E+ D C+VGEP+    +GD +K
Sbjct: 115 VAAHPNHQGRLAFLITSDEEASAVNGTVKVVETLMARQERLDYCLVGEPSSTDRVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++  + IHG QGHVAYPHL +NP+   IP L++L    +D GN  F PT+M+I 
Sbjct: 175 NGRRGSITANLRIHGVQGHVAYPHLADNPVHRAIPALNELVATVWDQGNEFFPPTSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  S NVIP  + + FN RF+    ++ +K+++++ L +   N     +T+ +   
Sbjct: 235 NINAGTGSNNVIPGDLDVQFNFRFSTELTDELIKQQVKALLDRHQLN-----YTLEWRLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   +L   +  ++ + +   P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GHP-FLTSRGELVDAVVNAVEHYSEITPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  S  DL+ L+ +Y+  ++  
Sbjct: 349 KVNECVSAADLQLLSRMYQRIMEQL 373


>gi|206578713|ref|YP_002237191.1| succinyl-diaminopimelate desuccinylase [Klebsiella pneumoniae 342]
 gi|288934130|ref|YP_003438189.1| succinyl-diaminopimelate desuccinylase [Klebsiella variicola At-22]
 gi|238064757|sp|B5XVN4|DAPE_KLEP3 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|206567771|gb|ACI09547.1| succinyl-diaminopimelate desuccinylase [Klebsiella pneumoniae 342]
 gi|288888859|gb|ADC57177.1| succinyl-diaminopimelate desuccinylase [Klebsiella variicola At-22]
          Length = 375

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 153/385 (39%), Positives = 220/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELAQQLIRRPSLSPDDAGCQALMIERLRAIGFTVEPMDFGDTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GHGE-TLAFAGHTDVVPAGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + +Y N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQYPNHRGRLAFLITSDEEASAKNGTVKVVETLMARNERLDYCLVGEPSSTEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P+L +L NI +D GN  F PT+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMLAELVNIEWDKGNEFFPPTSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            +  G  S NVIP  + + FN RF+    ++ +K  + S L K      +L ++V +   
Sbjct: 235 NVQSGTGSNNVIPGDMFVQFNFRFSTELTDEMIKARVVSLLEK-----YQLRYSVEWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTGRGKLVDAVVSAIEHYNEIKPQLLTNGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRVMEQL 373


>gi|15596359|ref|NP_249853.1| succinyl-diaminopimelate desuccinylase [Pseudomonas aeruginosa
           PAO1]
 gi|218892874|ref|YP_002441743.1| succinyl-diaminopimelate desuccinylase [Pseudomonas aeruginosa
           LESB58]
 gi|254234296|ref|ZP_04927619.1| succinyl-diaminopimelate desuccinylase [Pseudomonas aeruginosa
           C3719]
 gi|254239532|ref|ZP_04932854.1| succinyl-diaminopimelate desuccinylase [Pseudomonas aeruginosa
           2192]
 gi|81541563|sp|Q9I4H5|DAPE_PSEAE RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|238064774|sp|B7UX27|DAPE_PSEA8 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|9947085|gb|AAG04551.1|AE004546_6 succinyl-diaminopimelate desuccinylase [Pseudomonas aeruginosa
           PAO1]
 gi|126166227|gb|EAZ51738.1| succinyl-diaminopimelate desuccinylase [Pseudomonas aeruginosa
           C3719]
 gi|126192910|gb|EAZ56973.1| succinyl-diaminopimelate desuccinylase [Pseudomonas aeruginosa
           2192]
 gi|218773102|emb|CAW28914.1| succinyl-diaminopimelate desuccinylase [Pseudomonas aeruginosa
           LESB58]
          Length = 383

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 154/384 (40%), Positives = 213/384 (55%), Gaps = 14/384 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            LE   +LI+ PSVTP D     +++  L+  GF++E    +      V N +AR G + 
Sbjct: 11  TLELACELIRRPSVTPLDADCQALMMRRLEAAGFALEPMRIEE-----VDNFWARRGGDG 65

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEG-KIYGRGIVDMKGSIACFIAAVARFIPK 123
           P L FAGH DVVP G    W + PF A I +   + GRG  DMKGS+A  I AV RF+  
Sbjct: 66  PVLCFAGHTDVVPTGPLQAWQHQPFDALIDDQGMLCGRGAADMKGSLASMIVAVERFVAD 125

Query: 124 YK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
           +  + G+I+ LIT DEEGPA +GTK ++  +  +GE+ D CIVGEP+   ++GD +K GR
Sbjct: 126 HPEHKGAIAFLITSDEEGPAHHGTKAVVERLAARGERLDWCIVGEPSSTSLVGDVVKNGR 185

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSL  ++TI G QGHVAYPHL +NPI    P L +L    +D GN  F PT+ +++ ++
Sbjct: 186 RGSLGAKLTIRGVQGHVAYPHLAKNPIHLAAPALAELAAEHWDDGNAFFPPTSFQVSNLN 245

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
            G  + NVIP ++   FN RF+     + L++ + + L K   +       V ++    P
Sbjct: 246 SGTGATNVIPGELTALFNFRFSTESTVEGLQKRVEAILDKHGLD-----WHVEWALSGLP 300

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMHALN 361
            FLT   +L   ++ SI   TG     STSGGTSD RFI      V+E G V  T+H +N
Sbjct: 301 -FLTEPGELLDAVAASIRAVTGRETQPSTSGGTSDGRFIATMGTQVVELGPVNATIHQVN 359

Query: 362 ENASLQDLEDLTCIYENFLQNWFI 385
           E     DLE LT IY   L     
Sbjct: 360 ERVLASDLELLTEIYYQTLVRLLA 383


>gi|238064830|sp|Q8XZK5|DAPE_RALSO RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 383

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 158/389 (40%), Positives = 216/389 (55%), Gaps = 14/389 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYA-- 58
           M+P  L     LI+  SVTP+D G   +L+  L   GF  E       +   V NL+A  
Sbjct: 1   MSP-TLALTEDLIRRRSVTPEDKGCQDVLIERLSAAGFQCETVVSGPDHF-RVTNLWAVK 58

Query: 59  --RFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAA 116
             R GT+   L+FAGH DVVP G    W   PF  T  +GK+YGRG  DMK SIA F+ A
Sbjct: 59  RGRAGTDGKLLVFAGHTDVVPTGPVEQWRSDPFEPTHRDGKLYGRGAADMKTSIAGFVVA 118

Query: 117 VARFIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIG 175
              F+  + +  GSI  LIT DEEGPA +GT K+   +  +GE+ D C+VGEPT    +G
Sbjct: 119 AEEFVAVHPDHAGSIGFLITSDEEGPAHDGTIKVCDLLRTRGERLDYCVVGEPTSVSTLG 178

Query: 176 DTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTN 235
           D +K GRRGSLSG++T++G QGH+AYPHL +NPI   +P L  L    +D GN  F PT 
Sbjct: 179 DMVKNGRRGSLSGKLTVNGVQGHIAYPHLAKNPIHLAVPALTALAAEQWDDGNAYFPPTT 238

Query: 236 MEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVH 295
            +++ I  G  + NVIP  V + FN RF+     + LK  + + L     +   L +T+ 
Sbjct: 239 WQMSNIHGGTGATNVIPGHVIIDFNFRFSTASTPEGLKSRVHAIL-----DAHGLDYTLA 293

Query: 296 FSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVG 354
           ++    P FLT   +L+  LS +I    G    LST+GGTSD RFI   CP VIEFG   
Sbjct: 294 WTLGGEP-FLTERGELSEALSSAIGAECGVATELSTTGGTSDGRFIAKLCPQVIEFGPPN 352

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNW 383
            ++H ++E+  +  +E L  +Y   L+  
Sbjct: 353 ASIHKIDEHVDVAFIEPLKNVYRRVLETL 381


>gi|238064722|sp|B3PBB9|DAPE_CELJU RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
          Length = 382

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 157/381 (41%), Positives = 213/381 (55%), Gaps = 13/381 (3%)

Query: 7   EHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPH 66
           +    LI+C SVTP+D G   +++  L+ +GF  E   F       V N +A  G + P 
Sbjct: 13  QLAHDLIRCRSVTPEDDGCQELMIRRLEAIGFKTERLRFGE-----VDNFWAIRGGDGPI 67

Query: 67  LMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKN 126
           L FAGH DVVP G   HW  PPF  TI +G ++GRG  DMKGS+A  + A   F+ ++ N
Sbjct: 68  LAFAGHTDVVPTGPETHWNNPPFEPTIIDGMLHGRGAADMKGSLASMVVACENFVARHPN 127

Query: 127 F-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGS 185
             G I+ LIT DEEGP+INGT K++ W+E +  K   CIVGEP+    +GD IK GRRGS
Sbjct: 128 HKGRIAFLITSDEEGPSINGTVKVVEWLEARHTKMTWCIVGEPSSTTRVGDVIKNGRRGS 187

Query: 186 LSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGN 245
           L G + + G QGHVAYPHL +NPI  L P L +L    +D GN  F  T+ +++ I+ G 
Sbjct: 188 LGGVLKVKGIQGHVAYPHLADNPIHTLAPALAELAAEHWDNGNEFFPATSFQVSNINGGT 247

Query: 246 PSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFL 305
            + NVIP +V + FN RF+    +  L+E  ++ L K         + + +     P FL
Sbjct: 248 GATNVIPGEVTVVFNFRFSTELTDAILRERTQAILDKHELK-----YELEWILSGQP-FL 301

Query: 306 THDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNENA 364
           T    L + +  +I   TG    LSTSGGTSD RFI      V+E G +  T+H +NE  
Sbjct: 302 TPRGDLVNAVVDAINTATGLDAELSTSGGTSDGRFIAPTGAQVVELGPINATIHKVNECI 361

Query: 365 SLQDLEDLTCIYENFLQNWFI 385
           S +DL  LT IYE  L+    
Sbjct: 362 SAEDLNKLTAIYERTLEILLA 382


>gi|251790556|ref|YP_003005277.1| succinyl-diaminopimelate desuccinylase [Dickeya zeae Ech1591]
 gi|247539177|gb|ACT07798.1| succinyl-diaminopimelate desuccinylase [Dickeya zeae Ech1591]
          Length = 375

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 150/385 (38%), Positives = 228/385 (59%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLIKCPS++P D G   +++  L+ +GF IE  DF         N +A  
Sbjct: 1   MSCPVIELAQQLIKCPSLSPDDAGCQALMIERLQAIGFVIETMDFGDTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVP G+ + W  PPF  TI +G +YGRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGKTLAFAGHTDVVPAGNPSQWQTPPFEPTIRDGVLYGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  +  + G ++ LIT DEE  A+NGT K++  +  + E+ D C+VGEP+    +GD +K
Sbjct: 115 VAAHPNHQGRLAFLITSDEEASAVNGTVKVVEALMARQERLDYCLVGEPSSTERVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++  + IHG QGHVAYPHL +NP+  +IP LHQL +  +D GN  F PT+M+I 
Sbjct: 175 NGRRGSITANLRIHGVQGHVAYPHLADNPVHRVIPALHQLVDTVWDQGNEFFPPTSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  S NVIP ++ + FN RF+    ++ +K+++++ L     +  +L++T+ +   
Sbjct: 235 NINAGTGSNNVIPGELSVQFNFRFSTELTDELIKQQVKALL-----DSHQLNYTLEWQLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   +L   +  ++ + +   P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GHP-FLTGRGELVDAVVNAVEHYSEITPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            ++E  S  DL+ L+ +Y+  ++  
Sbjct: 349 KVDECVSAADLQLLSRMYQRIMEQL 373


>gi|290508334|ref|ZP_06547705.1| succinyl-diaminopimelate desuccinylase [Klebsiella sp. 1_1_55]
 gi|289777728|gb|EFD85725.1| succinyl-diaminopimelate desuccinylase [Klebsiella sp. 1_1_55]
          Length = 375

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 153/385 (39%), Positives = 220/385 (57%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLI+ PS++P D G   +++  L+ +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELAQQLIRRPSLSPDDAGCQALMIERLRAIGFTVEPMDFGDTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G     L FAGH DVVP GD + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GHGE-TLAFAGHTDVVPAGDADRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + +Y N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   ++GD +K
Sbjct: 115 VAQYPNHRGRLAFLITSDEEASAKNGTVKVVETLMARNERLDYCLVGEPSSTEVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYPHL +NP+    P+L +L NI +D GN  F PT+M+I 
Sbjct: 175 NGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMLAELVNIEWDKGNEFFPPTSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            +  G  S NVIP  + + FN RF+    ++ +K  + S L K      +L ++V +   
Sbjct: 235 NVQSGTGSNNVIPGDMFVQFNFRFSTELTDEMIKARVVSLLEK-----YQLRYSVEWWFS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   KL   +  +I +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTGRGKLVDAVVSAIEHYNEIKPQLLTNGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L  +Y+  ++  
Sbjct: 349 KINECVNAADLQLLARMYQRVMEQL 373


>gi|291613906|ref|YP_003524063.1| succinyl-diaminopimelate desuccinylase [Sideroxydans lithotrophicus
           ES-1]
 gi|291584018|gb|ADE11676.1| succinyl-diaminopimelate desuccinylase [Sideroxydans lithotrophicus
           ES-1]
          Length = 376

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 162/384 (42%), Positives = 223/384 (58%), Gaps = 13/384 (3%)

Query: 3   PDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT 62
            D LE   QLI   S+TP D G   I+   L  L FS+E+        S V NL+AR G 
Sbjct: 2   SDTLELTKQLIARHSLTPMDDGCIDIIGARLAPLDFSLEKM-----RHSEVDNLWARRGD 56

Query: 63  EAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIP 122
            +P + FAGH DVVP G  N W   PF+ T+ +G +YGRG  DMKGS+A F+ A+ +F+ 
Sbjct: 57  ASPLVCFAGHTDVVPTGPVNKWDSDPFTPTVRDGMLYGRGAADMKGSLAAFVTAIEKFVA 116

Query: 123 KYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
           ++  + GSI+LL+T DEEG A++GT +++  ++++ EK D CIVGEPT     GDTIK G
Sbjct: 117 EHPRHRGSIALLLTSDEEGIAVDGTVRVVEALQERDEKLDYCIVGEPTSVTKTGDTIKNG 176

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGSLSG +T+ G QGH+AYPHL +NPI  + P + +L    +D GN  F PT+ +I+ I
Sbjct: 177 RRGSLSGTLTVKGVQGHIAYPHLVKNPIHMVAPTIAELAATEWDKGNEYFPPTSWQISNI 236

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
             G  + NV+P  V++ FN RF+       LK ++ S L K         + + +     
Sbjct: 237 HGGTGATNVVPGTVEILFNFRFSTASTVDGLKTKVHSILDKHGLE-----YDLAWELSGK 291

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMHAL 360
           P +LT    L   ++ +I    G    LSTSGGTSD RFI D CP VIE G +  T+H L
Sbjct: 292 P-YLTPRGGLVDAVAAAIKQVQGLETELSTSGGTSDGRFIADICPQVIELGPLNATIHKL 350

Query: 361 NENASLQDLEDLTCIYENFLQNWF 384
           NE  ++ DL+ L+ IY   L    
Sbjct: 351 NECVAVDDLDALSEIYYLTLVKLL 374


>gi|33151825|ref|NP_873178.1| succinyl-diaminopimelate desuccinylase [Haemophilus ducreyi
           35000HP]
 gi|81423718|sp|Q7VNB3|DAPE_HAEDU RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|33148046|gb|AAP95567.1| succinyl-diaminopimelate desuccinylase [Haemophilus ducreyi
           35000HP]
          Length = 376

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 156/386 (40%), Positives = 225/386 (58%), Gaps = 13/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M  + +E   QLI+ PS++PQD G   I+   L  +GF++E   F         NL+A  
Sbjct: 1   MKHNIIELAQQLIRNPSISPQDKGCQQIISQRLAAVGFTLEWMPFGD-----TLNLWATH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G   P ++FAGH D+VP GD   W YPPFSA I +  ++GRG  DMKGS+A  + A   F
Sbjct: 56  GNGDPCIVFAGHTDIVPTGDPAQWQYPPFSAIIVDEMLHGRGAADMKGSLAALVIAAENF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + KY N  G I+LLIT DEE  A +GT K++  +  + EK D  ++GEP+C+  +GD IK
Sbjct: 116 VRKYPNHSGKIALLITSDEEATAKDGTAKVVETLMARHEKIDYAVIGEPSCSKYLGDIIK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++ E+ I G QGHVAYPHL +NPI   +  L++LT   +D GNT F PT+++I 
Sbjct: 176 NGRRGSITAELYIEGVQGHVAYPHLAQNPIHTSLAFLNELTTYQWDNGNTFFPPTSLQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  + NVIP ++ + FN+R+    N++ +K+ + + L K       L + +H+   
Sbjct: 236 NIKAGTGNNNVIPGELYLQFNLRYCTEINDQIIKQTVATMLAK-----YGLQYRIHWHLS 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
             P FL+ + KL +   +++ N T + P L TSGGTSD RFI      V+EFG +  T+H
Sbjct: 291 GKP-FLSSEGKLVNATIQAVENITKHTPRLDTSGGTSDGRFIALMGAEVVEFGPLNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            +NE  S +DL     IY   L+   
Sbjct: 350 KVNECVSTEDLAKCGQIYYQILEQLL 375


>gi|58040263|ref|YP_192227.1| succinyl-diaminopimelate desuccinylase [Gluconobacter oxydans 621H]
 gi|58002677|gb|AAW61571.1| Succinyl-diaminopimelate desuccinylase [Gluconobacter oxydans 621H]
          Length = 401

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 173/380 (45%), Positives = 226/380 (59%), Gaps = 9/380 (2%)

Query: 4   DCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           D +     L++C SVTP DGGA  +L   L+ +GF      F   +     NLYAR G  
Sbjct: 29  DPVALARDLLRCQSVTPADGGAQALLAGVLEGMGFETFHLPFGPADVP-TPNLYARLGKG 87

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
            P L FAGH DVVPPG+   W + PF+A I   ++YGRGI DMKG +ACF+AAVAR + +
Sbjct: 88  HPALCFAGHTDVVPPGE--GWAHDPFAAVIEGDRLYGRGIADMKGGVACFVAAVARRLEQ 145

Query: 124 YKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               GS+SLLITGDEEGPA  GTK ++ W+ ++GE  D C++GEPT    +GD IKIGRR
Sbjct: 146 GPLKGSVSLLITGDEEGPAHFGTKPVIEWLAERGELPDFCVLGEPTNPQALGDVIKIGRR 205

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++  +T+HG QGHVAYPHL +NP+  L+    +LT    D G+  F P+++++T+IDV
Sbjct: 206 GSMNAVVTVHGTQGHVAYPHLADNPVHRLLAAFSELTARELDAGSEWFDPSSLQVTSIDV 265

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GN + N+IP       NIRFNDL     L   I   + +                     
Sbjct: 266 GNGATNIIPGSAVGRLNIRFNDLHTGAALTAWIEDVVRRHAPQADVQVSI------SGEA 319

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           FLT      + LS+++ + TG  P L T GGTSDARFI  YC V EFGLVG TMH  +EN
Sbjct: 320 FLTQPGDAVTCLSEAVRSVTGRTPRLDTGGGTSDARFISQYCEVAEFGLVGATMHKRDEN 379

Query: 364 ASLQDLEDLTCIYENFLQNW 383
             L  LEDLT IY  F++ +
Sbjct: 380 VELGTLEDLTRIYLAFMEGY 399


>gi|107100611|ref|ZP_01364529.1| hypothetical protein PaerPA_01001637 [Pseudomonas aeruginosa PACS2]
          Length = 383

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 154/384 (40%), Positives = 213/384 (55%), Gaps = 14/384 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            LE   +LI+ PSVTP D     +++  L+  GF++E    +      V N +AR G + 
Sbjct: 11  TLELACELIRRPSVTPLDADCQALMMRRLEAAGFALEPMRIEE-----VDNFWARRGGDG 65

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEG-KIYGRGIVDMKGSIACFIAAVARFIPK 123
           P L FAGH DVVP G    W + PF A I +   + GRG  DMKGS+A  I AV RF+  
Sbjct: 66  PVLCFAGHTDVVPTGPLQAWQHQPFDALIDDQGMLCGRGAADMKGSLASMIVAVERFVAD 125

Query: 124 YK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
           +  + G+I+ LIT DEEGPA +GTK ++  +  +GE+ D CIVGEP+   ++GD +K GR
Sbjct: 126 HPEHKGAIAFLITSDEEGPAHHGTKAVVERLAARGERLDWCIVGEPSSTSLVGDVVKNGR 185

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSL  ++TI G QGHVAYPHL +NPI    P L +L    +D GN  F PT+ +++ ++
Sbjct: 186 RGSLGAKLTIRGVQGHVAYPHLAKNPIHLAAPALAELAVEHWDDGNAFFPPTSFQVSNLN 245

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
            G  + NVIP ++   FN RF+     + L++ + + L K   +       V ++    P
Sbjct: 246 SGTGATNVIPGELTALFNFRFSTESTVEGLQKRVEAILDKHGLD-----WHVEWALSGLP 300

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMHALN 361
            FLT   +L   ++ SI   TG     STSGGTSD RFI      V+E G V  T+H +N
Sbjct: 301 -FLTEPGELLDAVAASIRAVTGRETRPSTSGGTSDGRFIATMGTQVVELGPVNATIHQVN 359

Query: 362 ENASLQDLEDLTCIYENFLQNWFI 385
           E     DLE LT IY   L     
Sbjct: 360 ERVLASDLELLTEIYYQTLVRLLA 383


>gi|297171151|gb|ADI22161.1| acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase
           and related deacylases [uncultured gamma proteobacterium
           HF0200_24F15]
          Length = 382

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 163/386 (42%), Positives = 224/386 (58%), Gaps = 13/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           +    L+    LI+  SVTP+DGG   ++   LK  GF  E  DF       V N++ R 
Sbjct: 7   IEKSTLKLAQNLIRRASVTPEDGGCQQLISEALKPFGFVSESFDF-----GGVHNIWLRR 61

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT  P ++FAGH DVVP G    W +PPFSA +++G ++GRG  DMKGSIA  + A  RF
Sbjct: 62  GTGNPLIVFAGHTDVVPTGSLERWRFPPFSAIVSQGLLHGRGAADMKGSIAAMVTACQRF 121

Query: 121 -IPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
                 + GSI  LIT DEEGPAINGTK +++ ++K+GE +  CIVGEPT    IGDTIK
Sbjct: 122 AATNQNHTGSIGFLITSDEEGPAINGTKHVITELQKRGESFKWCIVGEPTSRKRIGDTIK 181

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+G + + G QGHVAYPHL  NPI    PL+  LTN  +D+GN  F PT ++I+
Sbjct: 182 NGRRGSLNGTLNLRGIQGHVAYPHLARNPIHHAAPLIVALTNHEWDSGNEDFPPTTLQIS 241

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G+ + NVIP ++++ FN RF+       L+++ +    +   +            P
Sbjct: 242 NIRGGSGATNVIPDEIEIIFNFRFSPESTVPELQDKFQDICKEQTNDFTIDWQ------P 295

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMH 358
            SP++ T   +L  +  K I   TG  P L+T GGTSD RFI      VIE G + RT+H
Sbjct: 296 ASPMYHTPAAELVKVARKIIRAKTGIKPTLATDGGTSDGRFISGTGAQVIELGPINRTIH 355

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
           + +E+  + DL  L+ IYE+ L +  
Sbjct: 356 SSDEHVRVSDLGLLSEIYEDILTDLL 381


>gi|117920357|ref|YP_869549.1| succinyl-diaminopimelate desuccinylase [Shewanella sp. ANA-3]
 gi|238055223|sp|A0KWH4|DAPE_SHESA RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|117612689|gb|ABK48143.1| succinyldiaminopimelate desuccinylase [Shewanella sp. ANA-3]
          Length = 381

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 152/380 (40%), Positives = 207/380 (54%), Gaps = 13/380 (3%)

Query: 7   EHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPH 66
           E   +LI  PSVTP D G   ++   L  +GF+IE   F+        N++AR G E P 
Sbjct: 12  ELTKELIARPSVTPLDEGCQTLMAERLAAIGFNIEPMVFED-----TTNMWARRGNEGPV 66

Query: 67  LMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKN 126
             FAGH DVVP GD + W  PPF  TI +G +YGRG  DMKGS+A  I A  RF+ K+ N
Sbjct: 67  FCFAGHTDVVPAGDLSRWHTPPFEPTIIDGYLYGRGAADMKGSLAAMIVATERFVAKHPN 126

Query: 127 F-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGS 185
             GSI+ LIT DEEGP INGT +++  +E + EK    +VGEP+    +GD +K GRRGS
Sbjct: 127 HPGSIAFLITSDEEGPFINGTTRVIDTLEARNEKITWTLVGEPSSTLKLGDVVKNGRRGS 186

Query: 186 LSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGN 245
           L+  +T+ G QGHVAYPHL +NPI    P L +L+   +D GN  F PT+M+I  I+ G 
Sbjct: 187 LTANLTVKGIQGHVAYPHLADNPIHKAAPFLAELSQTHWDNGNEFFPPTSMQIANINGGT 246

Query: 246 PSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFL 305
            + NVIP  +++ FN R++     + L E + + L     +     + + ++    P   
Sbjct: 247 GASNVIPGTLEVMFNFRYSTEVTAEILIERVEALLTAHELD-----YDISWTFNGLPFLT 301

Query: 306 THDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNENA 364
                L      +I   TG      T+GGTSD RFI      V+E G V  T+H +NE  
Sbjct: 302 GE-GPLLDATRHAIRQITGYDTDPQTTGGTSDGRFIAPTGAKVLELGPVNATIHKVNECV 360

Query: 365 SLQDLEDLTCIYENFLQNWF 384
            + DLE L   YE  L+   
Sbjct: 361 KIDDLEQLALCYEVILEQLL 380


>gi|145299806|ref|YP_001142647.1| succinyl-diaminopimelate desuccinylase [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|238055201|sp|A4SPS7|DAPE_AERS4 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|142852578|gb|ABO90899.1| succinyl-diaminopimelate desuccinylase [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 375

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 153/385 (39%), Positives = 215/385 (55%), Gaps = 13/385 (3%)

Query: 3   PDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT 62
            D +     LI+ PSVTPQD G   ++   L  LGF IE   F+        NL+AR G+
Sbjct: 2   SDVIALAKDLIRRPSVTPQDEGCQTLMSERLARLGFVIEPMVFED-----TTNLWARRGS 56

Query: 63  EAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIP 122
           E P   FAGH DVVP G    W  PPF  TI +G +YGRG  DMKGS+A  + AV RF+ 
Sbjct: 57  EGPLFCFAGHTDVVPAGPLEKWHTPPFEPTIQDGVLYGRGAADMKGSLAAMVVAVERFVA 116

Query: 123 KYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIG 181
           ++ +  GSI+ LIT DEEGP INGT +++  +E + EK   CIVGEP+  H++GD +K G
Sbjct: 117 EHPDHKGSIAFLITSDEEGPFINGTVRVIDTLEARNEKIRWCIVGEPSSTHVVGDVVKNG 176

Query: 182 RRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTI 241
           RRGS++G++ + G QGHVAYPHL +NPI    P L +L    +D GN  F PT+ +I  I
Sbjct: 177 RRGSITGDLLVRGVQGHVAYPHLADNPIHKAAPALTELAATVWDEGNAYFPPTSFQIANI 236

Query: 242 DVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVS 301
             G  + NVIP ++++ FN RF+    +  ++E +++ L K   +     + + ++    
Sbjct: 237 QAGTGASNVIPGELQVQFNFRFSTQLTDMDIRERVQALLDKHGLD-----YELTWTLSGQ 291

Query: 302 PVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHAL 360
           P        L      ++    G  P L T+GGTSD RFI      VIE G V  T+H +
Sbjct: 292 PFLTD-TGALLEATVAAVAAVNGQQPALLTTGGTSDGRFIAPTGAEVIELGPVNATIHKV 350

Query: 361 NENASLQDLEDLTCIYENFLQNWFI 385
           NE    +DL+ L  +Y+  L+    
Sbjct: 351 NECVKAEDLDLLAEMYQGVLERLLA 375


>gi|113868048|ref|YP_726537.1| succinyl-diaminopimelate desuccinylase [Ralstonia eutropha H16]
 gi|123032954|sp|Q0KA02|DAPE_RALEH RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|113526824|emb|CAJ93169.1| Succinyl-diaminopimelate desuccinylase (DapE peptidase) [Ralstonia
           eutropha H16]
          Length = 383

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 157/389 (40%), Positives = 215/389 (55%), Gaps = 14/389 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYA-- 58
           MT   L     LI+  SVTP D G   IL   LK LGF  E       +   V NL+A  
Sbjct: 1   MTA-TLALTEDLIRRRSVTPADEGCQAILETRLKALGFDCEALVSGPDDF-RVTNLWAVR 58

Query: 59  --RFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAA 116
               G +   L+FAGH DVVP G    W   PF+ T  +GK+YGRG  DMK SIA F+ A
Sbjct: 59  RGTQGKDGKLLVFAGHTDVVPTGPLEQWHSDPFAPTHRDGKLYGRGAADMKTSIAGFVVA 118

Query: 117 VARFIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIG 175
           V  F+  +  + GSI+ LIT DEEGPA +GT K++  +  +GE+ D C++GEPT    +G
Sbjct: 119 VEEFVKAHPAHAGSIAFLITSDEEGPAHDGTIKVVEALSARGERLDYCVIGEPTSVDTLG 178

Query: 176 DTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTN 235
           D +K GRRGSLSG++T+ G Q H+AYPHL  NPI    P L +L    +D GN  F PT+
Sbjct: 179 DMVKNGRRGSLSGKLTVKGIQCHIAYPHLGRNPIHEAAPALAELAAEVWDQGNEYFPPTS 238

Query: 236 MEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVH 295
            +++ I  G  + NVIP  V + FN RF+     + LK  + + L +         + + 
Sbjct: 239 WQMSNIHGGTGATNVIPGHVTIDFNFRFSTASTPEGLKARVHAILDRHQLE-----YALD 293

Query: 296 FSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVG 354
           ++    P FLT   +L+  LS +I   TG    LST+GGTSD RFI   CP VIEFG   
Sbjct: 294 WTLGGEP-FLTPRGELSDALSSAIEAETGVKTELSTTGGTSDGRFIAKICPQVIEFGPPN 352

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNW 383
            ++H ++E+  ++ +E L  +Y   L+  
Sbjct: 353 ASIHKIDEHVEVRFIEPLKNVYRGVLERL 381


>gi|17546109|ref|NP_519511.1| succinyl-diaminopimelate desuccinylase [Ralstonia solanacearum
           GMI1000]
 gi|17428405|emb|CAD15092.1| probable succinyl-diaminopimelate desuccinylase protein [Ralstonia
           solanacearum GMI1000]
          Length = 386

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 158/389 (40%), Positives = 216/389 (55%), Gaps = 14/389 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYA-- 58
           M+P  L     LI+  SVTP+D G   +L+  L   GF  E       +   V NL+A  
Sbjct: 4   MSP-TLALTEDLIRRRSVTPEDKGCQDVLIERLSAAGFQCETVVSGPDHF-RVTNLWAVK 61

Query: 59  --RFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAA 116
             R GT+   L+FAGH DVVP G    W   PF  T  +GK+YGRG  DMK SIA F+ A
Sbjct: 62  RGRAGTDGKLLVFAGHTDVVPTGPVEQWRSDPFEPTHRDGKLYGRGAADMKTSIAGFVVA 121

Query: 117 VARFIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIG 175
              F+  + +  GSI  LIT DEEGPA +GT K+   +  +GE+ D C+VGEPT    +G
Sbjct: 122 AEEFVAVHPDHAGSIGFLITSDEEGPAHDGTIKVCDLLRTRGERLDYCVVGEPTSVSTLG 181

Query: 176 DTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTN 235
           D +K GRRGSLSG++T++G QGH+AYPHL +NPI   +P L  L    +D GN  F PT 
Sbjct: 182 DMVKNGRRGSLSGKLTVNGVQGHIAYPHLAKNPIHLAVPALTALAAEQWDDGNAYFPPTT 241

Query: 236 MEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVH 295
            +++ I  G  + NVIP  V + FN RF+     + LK  + + L     +   L +T+ 
Sbjct: 242 WQMSNIHGGTGATNVIPGHVIIDFNFRFSTASTPEGLKSRVHAIL-----DAHGLDYTLA 296

Query: 296 FSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVG 354
           ++    P FLT   +L+  LS +I    G    LST+GGTSD RFI   CP VIEFG   
Sbjct: 297 WTLGGEP-FLTERGELSEALSSAIGAECGVATELSTTGGTSDGRFIAKLCPQVIEFGPPN 355

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNW 383
            ++H ++E+  +  +E L  +Y   L+  
Sbjct: 356 ASIHKIDEHVDVAFIEPLKNVYRRVLETL 384


>gi|39655033|pdb|1VGY|A Chain A, Crystal Structure Of Succinyl Diaminopimelate
           Desuccinylase
 gi|39655034|pdb|1VGY|B Chain B, Crystal Structure Of Succinyl Diaminopimelate
           Desuccinylase
          Length = 393

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 164/385 (42%), Positives = 220/385 (57%), Gaps = 13/385 (3%)

Query: 6   LEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAP 65
           LE   +LI  PSVTP D     +    L  +GF+ EE  F        KN++ R GT+AP
Sbjct: 9   LELAKELISRPSVTPDDRDCQKLXAERLHKIGFAAEEXHF-----GNTKNIWLRRGTKAP 63

Query: 66  HLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYK 125
            + FAGH DVVP G    W  PPF     +G++YGRG  D K SIACF+ A  RF+ K+ 
Sbjct: 64  VVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADXKTSIACFVTACERFVAKHP 123

Query: 126 -NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRG 184
            + GSI+LLIT DEEG A++GT K++  ++ + E  D CIVGEPT    +GD IK GRRG
Sbjct: 124 NHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDXIKNGRRG 183

Query: 185 SLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVG 244
           SLSG +T+ GKQGH+AYPHL  NP+    P L +LT   +D GN  F PT+ +I+ I+ G
Sbjct: 184 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 243

Query: 245 NPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVF 304
             + NVIP ++ + FN RF+    E  LK+ + + L K       + + + +S    P F
Sbjct: 244 TGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDK-----HGVQYDLQWSCSGQP-F 297

Query: 305 LTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMHALNEN 363
           LT   KLT +   +I  T G    LST+GGTSD RFIK     +IE G    T+H +NEN
Sbjct: 298 LTQAGKLTDVARAAIAETCGIEAELSTTGGTSDGRFIKAXAQELIELGPSNATIHQINEN 357

Query: 364 ASLQDLEDLTCIYENFLQNWFITPS 388
             L D+  L+ +YE  L       +
Sbjct: 358 VRLNDIPKLSAVYEGILVRLLAGNA 382


>gi|170742363|ref|YP_001771018.1| succinyl-diaminopimelate desuccinylase [Methylobacterium sp. 4-46]
 gi|238064793|sp|B0UP37|DAPE_METS4 RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|168196637|gb|ACA18584.1| succinyl-diaminopimelate desuccinylase [Methylobacterium sp. 4-46]
          Length = 396

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 191/385 (49%), Positives = 243/385 (63%), Gaps = 4/385 (1%)

Query: 2   TPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFG 61
           TP  L     LI+CPSVTP++GGA   L   L   GFS+E   F    T  V+NLYAR G
Sbjct: 4   TPSPLALAQGLIRCPSVTPEEGGALAYLAGLLAAAGFSVERPVFSAPGTPDVENLYARIG 63

Query: 62  TEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI 121
            + P L+ AGH DVVPPG+   W + PF+  +  G+++GRG VDMKG IAC  AA   F+
Sbjct: 64  ADGPCLLLAGHTDVVPPGEPALWRHDPFAGVVEGGELHGRGAVDMKGGIACLAAASLAFL 123

Query: 122 PKYK--NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
            +      GSI+ L+TGDEEGPA+NGT K+L+W   +GE++D CI+ EPT    +GD IK
Sbjct: 124 AERGPAFGGSIAFLVTGDEEGPAVNGTVKLLAWARARGERFDHCILAEPTNPDALGDMIK 183

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
           IGRRGSL+  +T+ G QGHVAYPH  ENPI GLI L   L     D G   F  +N+E T
Sbjct: 184 IGRRGSLTATLTVLGAQGHVAYPHRAENPIPGLIRLAGALLAAPLDEGTAHFDASNLEFT 243

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
           TIDVGNP+ NVIPAQ +   NIRFNDLWN  +L+ E+R RL     N  +    V  ++ 
Sbjct: 244 TIDVGNPASNVIPAQARAVLNIRFNDLWNPASLEAELRRRLDAAAGNAVRYRLDVQPTNA 303

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHA 359
           V   FLT       L++ +I   TG  P LST+GGTSDARFIK+ CPVIEFGLVG+TMH 
Sbjct: 304 V--AFLTQPDAFVDLVTAAIEAETGRRPALSTTGGTSDARFIKEACPVIEFGLVGQTMHQ 361

Query: 360 LNENASLQDLEDLTCIYENFLQNWF 384
           ++E  ++ DL+ L  I+   L  +F
Sbjct: 362 VDERVAVADLDRLAAIFRRILDAYF 386


>gi|91793170|ref|YP_562821.1| succinyl-diaminopimelate desuccinylase [Shewanella denitrificans
           OS217]
 gi|123166131|sp|Q12N78|DAPE_SHEDO RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|91715172|gb|ABE55098.1| succinyldiaminopimelate desuccinylase [Shewanella denitrificans
           OS217]
          Length = 376

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 156/386 (40%), Positives = 213/386 (55%), Gaps = 13/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+ D  +  + LI  PSVTP D G   ++   L   GF++E   F+        NL+AR 
Sbjct: 1   MSTDVTQLAMALIARPSVTPLDEGCQTLMGKHLSAAGFTLEPMVFED-----TTNLWARR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT+AP   FAGH DVVP GD   W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  GTQAPVFCFAGHTDVVPIGDLARWHTPPFEPTIIDGYLHGRGAADMKGSLAAMLVATERF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + K+ +  GSI+ LIT DEEGP INGT +++  +E + EK    +VGEP+  + +GD +K
Sbjct: 116 VAKHPHHNGSIAYLITSDEEGPFINGTTRVIDTLEARNEKITWALVGEPSSTYKLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+G +T++G QGHVAYPHL +NPI    P L +L  + +D GN  F PT+ +I 
Sbjct: 176 NGRRGSLTGNLTVNGVQGHVAYPHLADNPIHKAAPALTELAQMHWDNGNEFFPPTSFQIA 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NVIP  +++ FN R++       L   +   L     +   L + + +   
Sbjct: 236 NINGGTGASNVIPGNLEVMFNFRYSTEVTADELIARVLGIL-----DAHGLDYDISWVFN 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT D  L      +I   TG      T+GGTSD RFI      VIE G V  T+H
Sbjct: 291 GLP-FLTGDGPLLEATKSAIREVTGYDTDPQTTGGTSDGRFIAPTGAQVIELGPVNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            +NE   + DLE L   YE  L+   
Sbjct: 350 KVNECVKIADLEQLALCYEKLLEKLL 375


>gi|192362295|ref|YP_001981587.1| succinyl-diaminopimelate desuccinylase [Cellvibrio japonicus
           Ueda107]
 gi|190688460|gb|ACE86138.1| succinyl-diaminopimelate desuccinylase [Cellvibrio japonicus
           Ueda107]
          Length = 386

 Score =  240 bits (611), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 157/381 (41%), Positives = 213/381 (55%), Gaps = 13/381 (3%)

Query: 7   EHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPH 66
           +    LI+C SVTP+D G   +++  L+ +GF  E   F       V N +A  G + P 
Sbjct: 17  QLAHDLIRCRSVTPEDDGCQELMIRRLEAIGFKTERLRFGE-----VDNFWAIRGGDGPI 71

Query: 67  LMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKN 126
           L FAGH DVVP G   HW  PPF  TI +G ++GRG  DMKGS+A  + A   F+ ++ N
Sbjct: 72  LAFAGHTDVVPTGPETHWNNPPFEPTIIDGMLHGRGAADMKGSLASMVVACENFVARHPN 131

Query: 127 F-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGS 185
             G I+ LIT DEEGP+INGT K++ W+E +  K   CIVGEP+    +GD IK GRRGS
Sbjct: 132 HKGRIAFLITSDEEGPSINGTVKVVEWLEARHTKMTWCIVGEPSSTTRVGDVIKNGRRGS 191

Query: 186 LSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGN 245
           L G + + G QGHVAYPHL +NPI  L P L +L    +D GN  F  T+ +++ I+ G 
Sbjct: 192 LGGVLKVKGIQGHVAYPHLADNPIHTLAPALAELAAEHWDNGNEFFPATSFQVSNINGGT 251

Query: 246 PSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFL 305
            + NVIP +V + FN RF+    +  L+E  ++ L K         + + +     P FL
Sbjct: 252 GATNVIPGEVTVVFNFRFSTELTDAILRERTQAILDKHELK-----YELEWILSGQP-FL 305

Query: 306 THDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNENA 364
           T    L + +  +I   TG    LSTSGGTSD RFI      V+E G +  T+H +NE  
Sbjct: 306 TPRGDLVNAVVDAINTATGLDAELSTSGGTSDGRFIAPTGAQVVELGPINATIHKVNECI 365

Query: 365 SLQDLEDLTCIYENFLQNWFI 385
           S +DL  LT IYE  L+    
Sbjct: 366 SAEDLNKLTAIYERTLEILLA 386


>gi|89073183|ref|ZP_01159722.1| putative succinyl-diaminopimelate desuccinylase [Photobacterium sp.
           SKA34]
 gi|89051136|gb|EAR56593.1| putative succinyl-diaminopimelate desuccinylase [Photobacterium sp.
           SKA34]
          Length = 376

 Score =  240 bits (611), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 156/379 (41%), Positives = 217/379 (57%), Gaps = 13/379 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            +     L+  PSVTP+D G   +++  L+ LGF IE   F+        NL+AR GT+A
Sbjct: 6   VIALAKDLMSRPSVTPEDAGCQDVMIARLEQLGFIIETMVFED-----TTNLWARRGTQA 60

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P  +FAGH DVVP G    W  PPF  TI +G ++GRG  DMKGS+AC I A+ RFI + 
Sbjct: 61  PLFVFAGHTDVVPSGPLEQWHTPPFEPTIIDGYLHGRGAADMKGSLACMIVAIERFIAEN 120

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
            +  GSI+LLIT DEEGP INGT +++  +E + EK D CIVGEP+  H +GD +K GRR
Sbjct: 121 PDHKGSIALLITSDEEGPFINGTTRVIDTLEARNEKIDMCIVGEPSSTHHVGDVVKNGRR 180

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++G++T+ G QGHVAYPHL  NPI   +P L +L    +D GN  F PT+ +I  +  
Sbjct: 181 GSITGDLTVKGIQGHVAYPHLANNPIHKALPALAELAATTWDNGNAYFPPTSFQIPNVAA 240

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NVIP + ++ FN RF+    +  +K  + S L     +   L + + ++    P 
Sbjct: 241 GTGASNVIPGEFEVQFNFRFSTELTDAEIKRRVHSVL-----DAHGLDYDLKWTLSGHPF 295

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
                  L   +  +I       P L T+GGTSD RFI      V+E G V  T+H +NE
Sbjct: 296 LTDK-GTLVKAVVGAIEEVNHQQPELLTTGGTSDGRFIARTGAQVVELGPVNATIHKVNE 354

Query: 363 NASLQDLEDLTCIYENFLQ 381
              + DLE LT +Y+  L+
Sbjct: 355 CVKVADLEKLTDMYQKVLE 373


>gi|330993397|ref|ZP_08317332.1| Succinyl-diaminopimelate desuccinylase [Gluconacetobacter sp.
           SXCC-1]
 gi|329759427|gb|EGG75936.1| Succinyl-diaminopimelate desuccinylase [Gluconacetobacter sp.
           SXCC-1]
          Length = 385

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 173/378 (45%), Positives = 223/378 (58%), Gaps = 8/378 (2%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            +     LI+CPSVTP DG A   L   L+ +GFS+    F   +     NL+AR GT  
Sbjct: 11  VVTLARDLIRCPSVTPDDGCAIKTLAAVLERIGFSVTMLPFGEGSAH-TPNLFARLGTAQ 69

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           PH+ FAGH DVVP GD   W + PF   I +G ++GRG  DMKG IA F+AAV  ++ K 
Sbjct: 70  PHICFAGHTDVVPVGDAAQWCHDPFGGEIHDGILFGRGACDMKGGIAAFVAAVRLYLHKV 129

Query: 125 K-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
               GSISLLITGDEEGPA NGT ++L W+ +  +  D C+VGEPT    +G+ IKIGRR
Sbjct: 130 GTPPGSISLLITGDEEGPATNGTVRVLEWMAEHDQIPDFCVVGEPTNPAGMGEMIKIGRR 189

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL+  I + G QGHVAYPH  +NP+  L+ LL++LT    D G+  F  +++++T++DV
Sbjct: 190 GSLNARIVVPGTQGHVAYPHRADNPVHRLLALLNELTAAPLDGGSDWFEASSLQVTSLDV 249

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           GN + NVIPAQ +   NIRFNDL     L   +R+   +                     
Sbjct: 250 GNTATNVIPAQAEARLNIRFNDLHTGADLAGWLRTVAARHAPRARVDISI------SGES 303

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNEN 363
           FLT        L  S+   TG++P L T GGTSDARFI  YCPV EFGLVG +MH  +E+
Sbjct: 304 FLTEPGVAVEALRASVRAVTGHVPRLDTGGGTSDARFIARYCPVAEFGLVGASMHKTDEH 363

Query: 364 ASLQDLEDLTCIYENFLQ 381
            SL DL  LT IY  FL+
Sbjct: 364 VSLTDLRQLTAIYTGFLE 381


>gi|134094546|ref|YP_001099621.1| succinyl-diaminopimelate desuccinylase [Herminiimonas
           arsenicoxydans]
 gi|238064755|sp|A4G4Q7|DAPE_HERAR RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|133738449|emb|CAL61494.1| Succinyl-diaminopimelate desuccinylase (SDAP) [Herminiimonas
           arsenicoxydans]
          Length = 375

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 153/383 (39%), Positives = 221/383 (57%), Gaps = 13/383 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L    +LI   SVTP+D G    L+  L  LGF  E  +     +  V NL+AR GT  
Sbjct: 4   TLALTEELIALSSVTPEDKGCQSRLIELLSPLGFVCETIE-----SDGVTNLWARKGTAQ 58

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P L+FAGH DVVP G  + WT PPF  T  +GK+YGRG  DMK SIA  + A   F+  +
Sbjct: 59  PLLVFAGHTDVVPTGPLDQWTSPPFVPTQRDGKLYGRGAADMKTSIAAMVVAAEEFVHAH 118

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
            +  GSI  LIT DEEGPA +GT  + + ++ +GE+ D C+VGEPT + ++GDTIK GRR
Sbjct: 119 PDHKGSIGFLITSDEEGPATDGTVIVCNALKARGEQLDYCVVGEPTSSDVLGDTIKNGRR 178

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS+SG++T+ G QGH+AYP L  NPI    P L +L    +D GN  + PT+ +++ +  
Sbjct: 179 GSMSGKLTVKGIQGHIAYPQLARNPIHQCAPALAELVAEKWDDGNEYYLPTSWQVSNMHG 238

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NVIP  V + FN RF      + L++ + + L K         + + +S    P 
Sbjct: 239 GAGASNVIPGNVVIDFNFRFCTASTVEGLQQRVHAILDKHGLE-----YDLKWSISGYP- 292

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGRTMHALNE 362
           FLT    L+  ++ +I + TG    LST+GGTSD RFI   CP V+EFG    ++H ++E
Sbjct: 293 FLTPKGSLSDAMADAIKSETGVTTELSTTGGTSDGRFIAQICPQVVEFGPPNGSIHKIDE 352

Query: 363 NASLQDLEDLTCIYENFLQNWFI 385
           +  ++ ++ L  IY + ++N  +
Sbjct: 353 HIEVRFIDPLKNIYRHTMENLLL 375


>gi|315126436|ref|YP_004068439.1| succinyl-diaminopimelate desuccinylase [Pseudoalteromonas sp.
           SM9913]
 gi|315014950|gb|ADT68288.1| succinyl-diaminopimelate desuccinylase [Pseudoalteromonas sp.
           SM9913]
          Length = 376

 Score =  239 bits (610), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 156/386 (40%), Positives = 220/386 (56%), Gaps = 13/386 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           MT   +     LI+  SVTP+D G   ++   L  +GF IE   F         N +AR 
Sbjct: 1   MTHPVITLAQALIQRESVTPEDAGCQHMMNERLSAIGFDIESLFFTD-----TLNTWARK 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT++PH  FAGH DVVP G   +W +PPF+  I +G ++GRG  DMKGS+A  I A  RF
Sbjct: 56  GTQSPHFCFAGHTDVVPTGPEKNWQHPPFAGLIEDGLLHGRGAADMKGSLAAMIVATERF 115

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + K+ +  GSIS LIT DEEGP INGT +++  +E++GEK D C+VGEP+   ++GD +K
Sbjct: 116 VTKHPDHKGSISFLITSDEEGPFINGTTRVIDTLEERGEKIDMCLVGEPSSRDVLGDVVK 175

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+G +TI G QGHVAYPHL +NPI    P L +L+   +D GN  F  T+ +I+
Sbjct: 176 NGRRGSLTGFLTIKGVQGHVAYPHLAQNPIHLATPALTELSQTVWDMGNDFFPATSFQIS 235

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  + NVIP ++++ FN RF+     + L++++ + L K   N     + +++   
Sbjct: 236 NINGGTGAGNVIPGELEVQFNFRFSTEVTHQQLQQKVNAILQKHNLN-----YELNWIVN 290

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P        L      +I + TG    L T+GGTSD RFI      VIE G    T+H
Sbjct: 291 GLPFLTD-HGPLVDATVAAIKSVTGLTTNLETTGGTSDGRFIAQTGAKVIELGPRNATIH 349

Query: 359 ALNENASLQDLEDLTCIYENFLQNWF 384
            ++E  S  DL  L  IYE  L++  
Sbjct: 350 KVDECVSTDDLIALADIYEQILEHLL 375


>gi|300717907|ref|YP_003742710.1| N-succinyl-diaminopimelate deacylase [Erwinia billingiae Eb661]
 gi|299063743|emb|CAX60863.1| N-succinyl-diaminopimelate deacylase [Erwinia billingiae Eb661]
          Length = 375

 Score =  239 bits (610), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 150/381 (39%), Positives = 217/381 (56%), Gaps = 14/381 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            +E   QLI+ PS++P D G   IL+  LK LGF+IE  +          N++A  G   
Sbjct: 5   VIELTQQLIRRPSLSPDDAGCQAILIERLKALGFTIEPMNIGD-----TLNVWAWRGQGE 59

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
             L FAGH DVVP GD + W  PPF  TI +G +YGRG  DMKGS+A  I A  RF+   
Sbjct: 60  -TLAFAGHTDVVPTGDASRWINPPFEPTIRDGMLYGRGAADMKGSLAAMIVAAERFVTSN 118

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
            N  G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+   I+GD +K GRR
Sbjct: 119 PNHKGRLAFLITSDEEASATNGTVKVVEALMARKERMDYCLVGEPSSTEIVGDVVKNGRR 178

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GS++  +T+HG QGHVAYPHL +NP+   +P L++L    +D GN  F PT+M+I  +  
Sbjct: 179 GSMTANLTVHGVQGHVAYPHLADNPVHRALPALNELVATEWDQGNEFFPPTSMQIANVQA 238

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  S NVIP +  + FN RF+    +  +K++++  L     +  +L +T+ ++    P 
Sbjct: 239 GTGSNNVIPGECFVQFNFRFSTELTDAMIKQKVQELL-----DRHQLRYTLEWNVSGQP- 292

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
           FLT   KL   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H +NE
Sbjct: 293 FLTSRGKLVDAVVNAVEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIHKINE 352

Query: 363 NASLQDLEDLTCIYENFLQNW 383
                DL+ L+ +Y+  ++  
Sbjct: 353 CVKAADLQLLSRMYQRIMEQL 373


>gi|67459768|ref|YP_247392.1| succinyl-diaminopimelate desuccinylase [Rickettsia felis URRWXCal2]
 gi|75535842|sp|Q4UJR2|DAPE_RICFE RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|67005301|gb|AAY62227.1| Succinyl-diaminopimelate desuccinylase [Rickettsia felis URRWXCal2]
          Length = 381

 Score =  239 bits (610), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 174/382 (45%), Positives = 232/382 (60%), Gaps = 4/382 (1%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            + +L  LI   SVTP+  GA   + + LK  GF  E K F    +    NLYA FG+  
Sbjct: 2   YINYLKDLIGFKSVTPESDGAIEYIDDLLKQHGFKTEIKIFGDSKSEQATNLYAVFGSNE 61

Query: 65  PHLMFAGHIDVVPPGDFNHWTYP-PFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPK 123
           P++ F GH+DVVP G+   W    PF A+  +GKIYGRG VDMKG+IACF+AA   FI  
Sbjct: 62  PNICFVGHVDVVPAGNHELWHNASPFKASHQDGKIYGRGAVDMKGAIACFLAASLDFIKN 121

Query: 124 Y-KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
                GSIS L+T DEEG A +GTK+ML +I  +G K D  IVGEPTC   IGDTIKIGR
Sbjct: 122 NTGFKGSISFLLTSDEEGKAKHGTKEMLQYIYDQGHKMDFAIVGEPTCEKEIGDTIKIGR 181

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGS++ ++ I G  GHVAYPH   NP+  LI +L++LTNI  D G   F  +N+E+T ID
Sbjct: 182 RGSVNFKLNIEGLSGHVAYPHKANNPLPCLIKILNELTNIRLDKGTEFFQSSNLEVTNID 241

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
           VGN + NVIPA  + SFNIRFN+L + +TL +++   + +  +   K+ + + +SS    
Sbjct: 242 VGNNTSNVIPASTEASFNIRFNNLHSAETLAKQVEEIIKRYCKE-YKVDYKLEYSSSADS 300

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCPVIEFGLVGRTMHALNE 362
                + K+    +  +       P  STSGGTSDARF+KDYCP++EFGL+  T H +NE
Sbjct: 301 FIQNPNDKIKD-FADIVERVLKIKPEFSTSGGTSDARFVKDYCPLVEFGLLSETAHKINE 359

Query: 363 NASLQDLEDLTCIYENFLQNWF 384
              + DL+ L  +Y NFL    
Sbjct: 360 YTKISDLQKLYDVYYNFLMEIL 381


>gi|319762956|ref|YP_004126893.1| succinyl-diaminopimelate desuccinylase [Alicycliphilus
           denitrificans BC]
 gi|330825036|ref|YP_004388339.1| succinyl-diaminopimelate desuccinylase [Alicycliphilus
           denitrificans K601]
 gi|317117517|gb|ADV00006.1| succinyl-diaminopimelate desuccinylase [Alicycliphilus
           denitrificans BC]
 gi|329310408|gb|AEB84823.1| succinyl-diaminopimelate desuccinylase [Alicycliphilus
           denitrificans K601]
          Length = 392

 Score =  239 bits (610), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 153/393 (38%), Positives = 214/393 (54%), Gaps = 17/393 (4%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    L    QLI  PSVTP+D G   +L   L  LGF+ E  D     +  V NL+A+ 
Sbjct: 1   MPSPTLLLTEQLIARPSVTPEDAGCLDLLAERLAPLGFACERLDSGPS-SFRVCNLWAKR 59

Query: 61  GTEA--------PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIAC 112
                         ++FAGH DVVP G    W+  PF+ T  +G++YGRG  DMK SIA 
Sbjct: 60  AATPTSQSQAAIKTVVFAGHTDVVPTGPVEQWSSAPFTPTQRDGRLYGRGASDMKTSIAA 119

Query: 113 FIAAVARFI-PKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCN 171
           F+ AV  F+        +I+ L+T DEEGP+++GTK ++  +  +GE+ D CIVGEPT  
Sbjct: 120 FVVAVEEFLAATPAPAIAIAFLLTSDEEGPSVDGTKVVVEQLRARGERLDWCIVGEPTSV 179

Query: 172 HIIGDTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTF 231
              GD IK GRRG+LSG +T+ G QGH+AYPHL  NPI   +P L +L    +D GN  F
Sbjct: 180 QSTGDMIKNGRRGTLSGRLTVRGVQGHIAYPHLARNPIHQAVPALAELAATVWDRGNDFF 239

Query: 232 SPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLS 291
            PT+ +++ I  G  + NVIP +V + FN RF      ++LKE + + L           
Sbjct: 240 PPTSWQMSNIHGGTGATNVIPGEVAIDFNFRFCTESTAESLKERVHAVLDHHGLE----- 294

Query: 292 HTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEF 350
           + + ++    P   T   +L   + ++I+  TG    LST+GGTSD RFI   CP V+E 
Sbjct: 295 YDLAWTLGGQPFLTTP-GELVGAVQQAIHAETGLTTELSTTGGTSDGRFIAQICPQVVEL 353

Query: 351 GLVGRTMHALNENASLQDLEDLTCIYENFLQNW 383
           G    ++H ++EN  L D+E L  IY   L+N 
Sbjct: 354 GPPNDSIHKIDENIRLTDIEPLKNIYRRTLENL 386


>gi|271499688|ref|YP_003332713.1| succinyl-diaminopimelate desuccinylase [Dickeya dadantii Ech586]
 gi|270343243|gb|ACZ76008.1| succinyl-diaminopimelate desuccinylase [Dickeya dadantii Ech586]
          Length = 375

 Score =  239 bits (610), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 145/385 (37%), Positives = 224/385 (58%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLIK PS++P D G   +++  LK +GF IE  DF         N +A  
Sbjct: 1   MSCPVIELAQQLIKRPSLSPDDAGCQALMIERLKAIGFIIEAMDFGDTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   L FAGH DVVP G+ + W  PPF  TI +G ++GRG  DMKGS+A  + A  RF
Sbjct: 56  G-QGKTLAFAGHTDVVPVGNQSQWQTPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  +  + G ++ LIT DEE  A+NGT K++  +  + E+ D C+VGEP+    +GD +K
Sbjct: 115 VATHPNHQGRLAFLITSDEEASAVNGTVKVVEALMARQERLDYCLVGEPSSTERVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++  + +HG QGHVAYPHL +NP+   +  L++L    +D GN  F PT+M+I 
Sbjct: 175 NGRRGSITANLRVHGVQGHVAYPHLADNPVHRAMSALNELVETVWDQGNEFFPPTSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I+ G  S NVIP ++ + FN RF+    ++ +KE++++ L     +  +L++T+ +   
Sbjct: 235 NINAGTGSNNVIPGELFVQFNFRFSTELTDELIKEQVKTLL-----DSHQLNYTLEWQLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   +L   +  ++ + +   P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GHP-FLTGRGELVDAVVNAVEHYSEITPQLLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  +  DL+ L+ +Y+  ++  
Sbjct: 349 KVNECVNAADLQLLSRMYQRIMEQL 373


>gi|88706590|ref|ZP_01104293.1| succinyl-diaminopimelate desuccinylase [Congregibacter litoralis
           KT71]
 gi|88699086|gb|EAQ96202.1| succinyl-diaminopimelate desuccinylase [Congregibacter litoralis
           KT71]
          Length = 390

 Score =  239 bits (610), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 137/389 (35%), Positives = 200/389 (51%), Gaps = 17/389 (4%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L+   +LI+  SVTP+D G   +++  LK LGF      F         N +A++G+  
Sbjct: 13  TLDLACELIRRASVTPEDAGCQALMMERLKALGFHCTPLPFGDTE-----NFWAQWGSSG 67

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P L FAGH DVVPPG    W   PF+ ++ +G +YGRG  DMKGS+A  I A   F+   
Sbjct: 68  PLLAFAGHTDVVPPGPLEKWDSDPFTPSLRDGMLYGRGAADMKGSLAAMITACESFLRTC 127

Query: 125 K-----NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +       G I  LIT DEEGPA +GT +++ W+ ++    D C+VGEP+   ++GDTIK
Sbjct: 128 EAAGNTPRGRIGFLITSDEEGPATHGTVRVMEWLAEQKISIDYCVVGEPSSADVLGDTIK 187

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  + I G+QGHVAYP   +NP+   +P L  L    +D GN  F  T+ +IT
Sbjct: 188 NGRRGSLNAAVKILGRQGHVAYPQHADNPLHRALPALQALATRQWDMGNEYFPATSFQIT 247

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            +  G    NVIP    +  N RF+     + L+E +     +      ++   + ++  
Sbjct: 248 NVHSGTGVTNVIPGHADVLINFRFSTEQTAERLQEAVEQTFAE-----HEVHAEIQWTLS 302

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P        LT    +++ +       LSTSGGTSD RFI      ++E G V  ++H
Sbjct: 303 GKPFITAE-GALTDACREAVKDVADLATTLSTSGGTSDGRFIAPYGAQLVELGPVNASIH 361

Query: 359 ALNENASLQDLEDLTCIYENFLQNWFITP 387
            +NE+    DL  L+ +YE  L      P
Sbjct: 362 RVNEHVKADDLARLSKMYEGILTRLLNAP 390


>gi|260548887|ref|ZP_05823109.1| succinyl-diaminopimelate desuccinylase [Acinetobacter sp. RUH2624]
 gi|260408055|gb|EEX01526.1| succinyl-diaminopimelate desuccinylase [Acinetobacter sp. RUH2624]
          Length = 377

 Score =  239 bits (610), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 158/372 (42%), Positives = 215/372 (57%), Gaps = 13/372 (3%)

Query: 16  PSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPHLMFAGHIDV 75
           PSVTP D     I+ + L   GF IE   F       V NL+AR GTE P   FAGH DV
Sbjct: 17  PSVTPVDHTCQTIMADRLAKAGFHIEPMRFGD-----VDNLWARRGTEGPVFCFAGHTDV 71

Query: 76  VPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKNF-GSISLLI 134
           VP G  + W   PF+  I +GK+YGRG  DMK ++A  + A  RF+ K+ N  GSI+ LI
Sbjct: 72  VPTGRLDAWNSDPFAPEIRDGKLYGRGSADMKTALAAMVVASERFVVKHPNHKGSIAFLI 131

Query: 135 TGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHG 194
           T DEEGPA+NGT K++  +E++ EK   C+VGEP+    +GD +K GRRGSL+G + +HG
Sbjct: 132 TSDEEGPAVNGTVKVIETLEERNEKITWCLVGEPSSTSKLGDIVKNGRRGSLNGVLHVHG 191

Query: 195 KQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQ 254
           KQGHVAYPHL  NPI      L +L    +D GN  F  T+ +I+ I  G  + NVIP  
Sbjct: 192 KQGHVAYPHLARNPIHEASAALAELCQTVWDNGNEYFPATSFQISNIHSGTGATNVIPGT 251

Query: 255 VKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSL 314
           ++++FN R++     + LK+ +   L K       L + + ++    P FLT   +L + 
Sbjct: 252 LEVTFNFRYSTEVTAEQLKQRVHEILDK-----HGLQYEIDWNLSGLP-FLTPVGELVNA 305

Query: 315 LSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNENASLQDLEDLT 373
              +I N TG    LSTSGGTSD RFI      V+E G++  T+H +NE+  + DL+ LT
Sbjct: 306 AQTAILNVTGTETELSTSGGTSDGRFIAPTGAQVLELGVLNATIHQINEHVDVHDLDPLT 365

Query: 374 CIYENFLQNWFI 385
            IYE  L+N   
Sbjct: 366 DIYEQILENLLA 377


>gi|88812373|ref|ZP_01127623.1| succinyl-diaminopimelate desuccinylase [Nitrococcus mobilis Nb-231]
 gi|88790380|gb|EAR21497.1| succinyl-diaminopimelate desuccinylase [Nitrococcus mobilis Nb-231]
          Length = 378

 Score =  239 bits (610), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 149/383 (38%), Positives = 218/383 (56%), Gaps = 14/383 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            ++   +LI+ PS+TP+D G   +L   L+ LGF  E   F       VKNL+AR+G   
Sbjct: 6   TIDLACELIRRPSLTPEDAGCQTLLATRLEALGFRCEHLAFGE-----VKNLWARYGNSG 60

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFI--P 122
           P L F GH DVVP G    WT PPF  ++ +G++YGRG  DMKGS+A F+ A  RF+   
Sbjct: 61  PLLTFVGHTDVVPSGPEMQWTTPPFEPSLRQGQLYGRGAADMKGSLAAFVTACERFLGDN 120

Query: 123 KYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGR 182
           +    GS++LLIT DEEG AI+GT +++  +  +GE+ D C+VGEP+   +IGDTIKIGR
Sbjct: 121 RGPLRGSVALLITSDEEGDAIDGTARVVRALRARGERIDMCLVGEPSSEVVIGDTIKIGR 180

Query: 183 RGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTID 242
           RGSL G +T+ G QGHVAYP    NPI    P L +LT+  +D GN +F PT M+I+ I 
Sbjct: 181 RGSLHGHLTVRGIQGHVAYPQRASNPIHQFAPALLELTSRRWDNGNASFPPTTMQISNIH 240

Query: 243 VGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSP 302
            G  + NVIP  ++   N R+      + ++ E+     +         + + +     P
Sbjct: 241 AGTGATNVIPGSLQADINFRYCTELTAEDIRFEVEHTFERHDLE-----YQIDWRLSAQP 295

Query: 303 VFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALN 361
            FLT    L      ++++ TG     ST+GGTSD RF+      VIE G + +T+H ++
Sbjct: 296 -FLTEQGPLLDAALAAVHDVTGRHARTSTAGGTSDGRFVASTGAQVIELGPINQTIHQVD 354

Query: 362 ENASLQDLEDLTCIYENFLQNWF 384
           E+A + +L  ++ +YE+ L    
Sbjct: 355 EHAGIAELNTISAVYEHILNRLL 377


>gi|300704246|ref|YP_003745849.1| N-succinyl-diaminopimelate deacylase [Ralstonia solanacearum
           CFBP2957]
 gi|299071910|emb|CBJ43239.1| N-succinyl-diaminopimelate deacylase [Ralstonia solanacearum
           CFBP2957]
          Length = 383

 Score =  239 bits (609), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 159/389 (40%), Positives = 216/389 (55%), Gaps = 14/389 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYA-- 58
           M+P  L     LI+  SVTP+D G   +L+  L   GF+ E       +   V NL+A  
Sbjct: 1   MSP-TLALTEDLIRRRSVTPEDKGCQDVLIERLSAAGFACETVVSGPDHF-RVTNLWAVK 58

Query: 59  --RFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAA 116
             R GT+   L+FAGH DVVP G    W   PF  T  +GK+YGRG  DMK SIA F+ A
Sbjct: 59  RGRAGTDGKLLVFAGHTDVVPTGPVEQWRSDPFEPTHRDGKLYGRGAADMKTSIAGFVVA 118

Query: 117 VARFIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIG 175
              F+ ++ +  GSI  LIT DEEGPA +GT K+   +  +GE+ D C+VGEPT    +G
Sbjct: 119 SEEFVARHPDHAGSIGFLITSDEEGPAHDGTIKVCDLLRARGERLDYCVVGEPTSVSTLG 178

Query: 176 DTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTN 235
           D +K GRRGSLSG++T++G QGH+AYPHL +NPI    P L  L    +D GN  F PT 
Sbjct: 179 DMVKNGRRGSLSGKLTVNGVQGHIAYPHLAKNPIHLAAPALAALVAEKWDDGNAYFPPTT 238

Query: 236 MEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVH 295
            +++ I  G  + NVIP QV + FN RF+       LK  + + L     +   L +T+ 
Sbjct: 239 WQMSNIHGGTGATNVIPGQVTIDFNFRFSTASTPDGLKARVHALL-----DAHGLDYTLA 293

Query: 296 FSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVG 354
           ++    P FLT    L+  LS +I    G    LST+GGTSD RFI   CP VIEFG   
Sbjct: 294 WTLGGEP-FLTERGALSEALSSAIQAECGVATELSTTGGTSDGRFIAKLCPQVIEFGPPN 352

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNW 383
            ++H ++E+  +  +E L  +Y   L+  
Sbjct: 353 ASIHKIDEHVDVAFIEPLKNVYRRVLETL 381


>gi|253687563|ref|YP_003016753.1| succinyl-diaminopimelate desuccinylase [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|251754141|gb|ACT12217.1| succinyl-diaminopimelate desuccinylase [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 375

 Score =  239 bits (609), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 145/385 (37%), Positives = 217/385 (56%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLIK PS++P D G   +++  L  +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELAQQLIKRPSLSPNDEGCQALMIERLTAMGFTVEAMDFGDTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT    L FAGH DVVP GD + W +PPF   I +G +YGRG  DMKGS+A  + A  RF
Sbjct: 56  GT-GKTLAFAGHTDVVPSGDESQWQHPPFEPIIRDGMLYGRGAADMKGSLAAMVIAAERF 114

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  +  + G ++ LIT DEE  A+NGT K++  +  + E+ D C+VGEP+  H++GD +K
Sbjct: 115 VAAHPSHQGRLAFLITSDEEASAVNGTVKVVEALMARNERLDYCLVGEPSSTHVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++  + +HG QGHVAYPHL +NP+    P L++L    +D GN  F PT M+I 
Sbjct: 175 NGRRGSITANLRVHGVQGHVAYPHLADNPVHRAAPALNELIATEWDRGNDFFPPTTMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    +  +++ +   L +   N     +T+ +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDVLIQQRVAELLDRHQLN-----YTIDWKLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   +L   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGELVDAVVNAVKHYNEVTPELLTNGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            ++E  S  DL+ L+ +Y+  ++  
Sbjct: 349 KVDECVSAADLQLLSRMYQRIMEQL 373


>gi|194289806|ref|YP_002005713.1| succinyl-diaminopimelate desuccinylase [Cupriavidus taiwanensis LMG
           19424]
 gi|238064729|sp|B3R2D1|DAPE_CUPTR RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|193223641|emb|CAQ69648.1| N-succinyl-diaminopimelate deacylase [Cupriavidus taiwanensis LMG
           19424]
          Length = 383

 Score =  239 bits (609), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 157/389 (40%), Positives = 217/389 (55%), Gaps = 14/389 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYA-- 58
           M P  L     LI+  SVTP D G   IL   LK +GF  E       +   V NL+A  
Sbjct: 1   MNP-TLALTEDLIRRRSVTPADEGCQAILETRLKAIGFDCEALVSGPDDF-RVTNLWAVK 58

Query: 59  --RFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAA 116
               G +   L+FAGH DVVP G    W   PF+ T  +GK+YGRG  DMK SIA F+ A
Sbjct: 59  RGTQGKDGKLLVFAGHTDVVPTGPLEQWHSDPFAPTHRDGKLYGRGAADMKTSIAGFVVA 118

Query: 117 VARFIPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIG 175
           V  F+  +  + GSI  LIT DEEGPA +GT K++  +  +GE+ D C++GEPT  + +G
Sbjct: 119 VEEFVKAHPAHAGSIGFLITSDEEGPAHDGTIKVVEALSARGERLDYCVIGEPTSVNALG 178

Query: 176 DTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTN 235
           D +K GRRGSLSG++T+ G Q H+AYPHL  NPI    P L +L    +D GN  F PT+
Sbjct: 179 DMVKNGRRGSLSGKLTVKGIQCHIAYPHLGRNPIHDAAPALAELAAEVWDAGNEYFPPTS 238

Query: 236 MEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVH 295
            +++ I  G  + NVIP  V + FN RF+     + LK  + + L +   +     +T+ 
Sbjct: 239 WQMSNIHGGTGATNVIPGHVTIDFNFRFSTASTPEGLKARVHAILDRHSLD-----YTLD 293

Query: 296 FSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVG 354
           ++    P FLT   +L+  LS +I   TG    LST+GGTSD RFI   CP VIEFG   
Sbjct: 294 WTLGGEP-FLTPRGELSEALSSAIKAETGFDTELSTTGGTSDGRFIARICPQVIEFGPPN 352

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNW 383
            ++H ++E+  ++ +E L  +Y   L+  
Sbjct: 353 ASIHKIDEHVEVRFIEPLKNVYRGVLERL 381


>gi|328474420|gb|EGF45225.1| succinyl-diaminopimelate desuccinylase [Vibrio parahaemolyticus
           10329]
          Length = 378

 Score =  239 bits (609), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 158/388 (40%), Positives = 216/388 (55%), Gaps = 14/388 (3%)

Query: 1   MTPD-CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYAR 59
           MT    L     LI   SVTP+D G   +++  LK LGF IE   F+        N +AR
Sbjct: 1   MTDSPVLALAKDLISRQSVTPEDAGCQDLMIERLKALGFEIEVMVFED-----TTNFWAR 55

Query: 60  FGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVAR 119
            G EAP   FAGH DVVP G    W  PPF  TI +G ++GRG  DMKGS+A  + AV R
Sbjct: 56  RGNEAPLFAFAGHTDVVPAGKLEQWDTPPFEPTIIDGYLHGRGAADMKGSLAAMVVAVER 115

Query: 120 FIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTI 178
           FI K+ +  GSI  LIT DEEGP INGT +++  + ++GE  D CIVGEP+   I+GD +
Sbjct: 116 FIAKHPDHKGSIGFLITSDEEGPFINGTVRVVEALMERGENIDMCIVGEPSSTEIVGDIV 175

Query: 179 KIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEI 238
           K GRRGS++G++T+ G QGHVAYPHL  NP+   +  +H+L    +D GN  F PT+ +I
Sbjct: 176 KNGRRGSITGDLTVKGTQGHVAYPHLANNPVHASLLAIHELATTEWDKGNDYFPPTSFQI 235

Query: 239 TTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSS 298
             +  G  + NVIP +  + FN+RF+   N  T+ + +   L K   N     + +H++ 
Sbjct: 236 PNVSAGTGASNVIPGEFNVQFNLRFSTELNNDTIVQRVTETLNKHDLN-----YDLHWTF 290

Query: 299 PVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTM 357
              P        L   +  ++       P L T+GGTSD RFI      V+E G V  T+
Sbjct: 291 NGDPFLTD-TGALLDAVVAAVAEVNNTKPALLTTGGTSDGRFIARMGGQVVELGPVNATI 349

Query: 358 HALNENASLQDLEDLTCIYENFLQNWFI 385
           H +NE   + DLE LT +YEN L++   
Sbjct: 350 HKVNECVKVDDLEKLTDMYENTLKHLLA 377


>gi|197334990|ref|YP_002156742.1| succinyl-diaminopimelate desuccinylase [Vibrio fischeri MJ11]
 gi|238055240|sp|B5FGX0|DAPE_VIBFM RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|197316480|gb|ACH65927.1| succinyl-diaminopimelate desuccinylase [Vibrio fischeri MJ11]
          Length = 377

 Score =  239 bits (609), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 153/383 (39%), Positives = 212/383 (55%), Gaps = 13/383 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L     L+   S+TP+D G   +++  L+ LGF+IE   F+        N +AR G EA
Sbjct: 6   TLALAKDLLSRQSITPEDAGCQELMIKRLEALGFTIEIMVFED-----TTNFWARRGNEA 60

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P   FAGH DVVP GD  HW   PF  TI +G +Y RG  DMKGS+AC + AV RF+ ++
Sbjct: 61  PLFTFAGHTDVVPTGDLTHWNTNPFEPTIIDGMLYARGAADMKGSLACMVVAVERFVGEH 120

Query: 125 KNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
            N  GSIS LIT DEEGP INGT +++  ++++ E  D CIVGEP+    +GD +K GRR
Sbjct: 121 PNHKGSISFLITSDEEGPFINGTTRVVDTLQERNEIIDMCIVGEPSSTSHVGDVVKNGRR 180

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL+G +T+ G QGHVAYPH+  NPI   +P L +L    +D GN  F PT+ +I  ++ 
Sbjct: 181 GSLTGNLTVKGIQGHVAYPHIARNPIHQAMPALSELATTVWDNGNDYFPPTSFQIPNMNG 240

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NVIP  V + FN RF+       L++ +   L K         + + +     P 
Sbjct: 241 GTGASNVIPGTVDIMFNFRFSTESTVDELQQRVVEILDKHDLE-----YDLDWIINGLPF 295

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
                  L + +  ++       P L T+GGTSD RFI      VIE G V  T+H +NE
Sbjct: 296 LTD-TGDLLTAVVNAVDTVNQQKPQLLTTGGTSDGRFIAQMGSQVIELGPVNATIHKVNE 354

Query: 363 NASLQDLEDLTCIYENFLQNWFI 385
             +++DLE LT +Y+  L N   
Sbjct: 355 CVNVEDLEKLTDMYQEVLNNLLA 377


>gi|239815695|ref|YP_002944605.1| succinyl-diaminopimelate desuccinylase [Variovorax paradoxus S110]
 gi|259595049|sp|C5CLT2|DAPE_VARPS RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|239802272|gb|ACS19339.1| succinyl-diaminopimelate desuccinylase [Variovorax paradoxus S110]
          Length = 391

 Score =  239 bits (609), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 149/389 (38%), Positives = 217/389 (55%), Gaps = 17/389 (4%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L+   QLI  PSVTP D G   IL   L  LGF++E  +    +   V NL+A      
Sbjct: 4   TLQLAEQLISRPSVTPDDAGCQQILGERLARLGFTLETIESGPADF-RVTNLWAVRRPAG 62

Query: 65  ----PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
                 L+FAGH DVVP G    WT  PF+ T   GK+YGRG  DMK S+A F+ ++  F
Sbjct: 63  TAPTKTLVFAGHTDVVPTGPVEQWTSHPFTPTHRGGKLYGRGACDMKTSVAAFVVSIEEF 122

Query: 121 IPKYKNFG-SISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +    +   +++LL+T DEEGP ++GT  + + +  +GE  D CIVGEPT     GD IK
Sbjct: 123 LAATPDPRLTLALLLTSDEEGPGVDGTVIVCNALAARGETIDYCIVGEPTAVERCGDMIK 182

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNI----GFDTGNTTFSPTN 235
            GRRG++SG++T+HG QGH+AYPHL +NP+  + P L +L  I    G+D GN  F PT+
Sbjct: 183 NGRRGTMSGKLTVHGVQGHIAYPHLAKNPVHAVAPALAELVAINAAGGWDAGNAYFQPTS 242

Query: 236 MEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVH 295
            +I+    G  + NVIP    + FN RF+     ++L++ + + L     +   +  T+ 
Sbjct: 243 WQISNFHAGTGASNVIPGSAVIDFNFRFSTESTPESLQKRVHAVL-----DAHGVDCTLA 297

Query: 296 FSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVG 354
           ++    P   T   +L S +  +I + TG    LSTSGGTSDARFI   C  V+E G V 
Sbjct: 298 WTIGGLPFLTTP-GELVSAVQAAIADETGIATELSTSGGTSDARFIAKICKQVVELGPVN 356

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNW 383
            ++H ++E+  + ++E L  IY+  L+  
Sbjct: 357 ASIHKIDEHIDVAEIETLKNIYKRTLERL 385


>gi|145589640|ref|YP_001156237.1| succinyl-diaminopimelate desuccinylase [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|238064771|sp|A4SYV9|DAPE_POLSQ RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|145048046|gb|ABP34673.1| succinyldiaminopimelate desuccinylase [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 383

 Score =  239 bits (609), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 151/385 (39%), Positives = 208/385 (54%), Gaps = 13/385 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYA----RF 60
            LE    LI C SVTP DGG   ++   L+ +GF  E      +N   V NL+A    + 
Sbjct: 4   TLELTEALIACHSVTPADGGCQDLIAKRLQAIGFHTESVVSGPENF-QVTNLWAIKKGKA 62

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   LMFAGH DVVP G    WT  PF+ TI +G +YGRG  DMK S+A F+ A   F
Sbjct: 63  GDQGKVLMFAGHTDVVPTGPLEKWTSDPFTPTIRDGMLYGRGAADMKTSLAAFVVATEEF 122

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  +  + G+I+ LIT DEEGPA +GT  M   ++K  ++ D C++GEPT    +GD IK
Sbjct: 123 VTMHPDHQGAIAFLITSDEEGPANDGTVIMCERLQKHQQRLDYCVIGEPTSVDQLGDMIK 182

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSLSG++ I G Q H+AYPHL +NPI    P +  L    +D GN  F PT+ +++
Sbjct: 183 NGRRGSLSGKLKIKGIQAHIAYPHLGKNPIHLSAPAITALVETEWDKGNEYFQPTSFQMS 242

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  + NVIP ++ + FN RF+     + L+E + S L     +       +++   
Sbjct: 243 NIHAGTGANNVIPGELTIDFNFRFSTESKPEQLRERLESILKNAGLD-----FEINWVLG 297

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMH 358
            SP     D  L   L K+I   T     LST+GGTSD RFI   C  V+EFG +  T H
Sbjct: 298 GSPFITG-DGDLAGALRKAIKTETQIDTELSTTGGTSDGRFIAKICKEVVEFGPLNVTSH 356

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            ++E   + D+  L  IY   L+  
Sbjct: 357 KIDECVIVDDVVPLKNIYRKTLEQL 381


>gi|171463264|ref|YP_001797377.1| succinyl-diaminopimelate desuccinylase [Polynucleobacter
           necessarius subsp. necessarius STIR1]
 gi|238064770|sp|B1XTT6|DAPE_POLNS RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|171192802|gb|ACB43763.1| succinyl-diaminopimelate desuccinylase [Polynucleobacter
           necessarius subsp. necessarius STIR1]
          Length = 383

 Score =  239 bits (609), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 150/385 (38%), Positives = 207/385 (53%), Gaps = 13/385 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYA----RF 60
            L+    LI C SVTP DGG   ++   L+ +GF  E      +N   V NL+A    + 
Sbjct: 4   TLKLTEALIACHSVTPADGGCQDLIAKRLQAIGFHAESVVSGPENF-QVTNLWAIKKGKA 62

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G +   LMFAGH DVVP G    WT  PF+ TI +G +YGRG  DMK S+A F+ A   F
Sbjct: 63  GDQGKVLMFAGHTDVVPTGPLEKWTSDPFTPTIRDGMLYGRGAADMKTSLASFVVATEEF 122

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  +  + GSI+ LIT DEEGPA +GT  M   ++K G++ D C++GEPT  + +GD IK
Sbjct: 123 VTTHPDHQGSIAFLITSDEEGPANDGTVIMCERLQKHGQRLDYCVIGEPTSVNTLGDMIK 182

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSLSG++ + G Q H+AYPHL +NPI    P +  L    +D GN  F PT+ +I+
Sbjct: 183 NGRRGSLSGKLRVKGIQAHIAYPHLGQNPIHLSAPAISALVETQWDKGNEYFQPTSFQIS 242

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            +  G  + NVIP ++ + FN RF+     + L+E +   L             + +   
Sbjct: 243 NVHAGTGANNVIPGKLVVDFNFRFSTESKPEQLRERLEKILKDAGLE-----FEIDWVLG 297

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYC-PVIEFGLVGRTMH 358
            SP     D  L   L K+I   T     LST+GGTSD RFI   C  V+EFG +  T H
Sbjct: 298 GSPFITG-DGDLAGALRKAIKAETKIDTELSTTGGTSDGRFIAKICKEVVEFGPLNATSH 356

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            ++E   + D+  L  IY   L+  
Sbjct: 357 KIDECVIVDDVVPLKNIYRKTLEQL 381


>gi|309782151|ref|ZP_07676881.1| succinyl-diaminopimelate desuccinylase [Ralstonia sp. 5_7_47FAA]
 gi|308919217|gb|EFP64884.1| succinyl-diaminopimelate desuccinylase [Ralstonia sp. 5_7_47FAA]
          Length = 383

 Score =  239 bits (609), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 157/389 (40%), Positives = 214/389 (55%), Gaps = 14/389 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYA-- 58
           M P  L     LI+  SVTP+D G   +L+  L   GF  E       +   V NL+A  
Sbjct: 1   MQP-TLALTEDLIRRRSVTPEDKGCQDVLIERLTAAGFECETVISGPDHF-RVTNLWAIK 58

Query: 59  --RFGTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAA 116
             R GT+   L+FAGH DVVP G    W   PF  T  +GK+Y RG  DMK SIA F+ A
Sbjct: 59  RGRAGTDGKLLVFAGHTDVVPTGPVEQWHSDPFEPTHRDGKLYARGAADMKTSIAGFVVA 118

Query: 117 VARFIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIG 175
              F+ K+ +  GSI  LIT DEEGPA +GT K+   +  +GE+ D C+VGEPT    +G
Sbjct: 119 SEEFVAKHPDHAGSIGFLITSDEEGPAHDGTVKVCDLLRARGERLDYCVVGEPTSVSTLG 178

Query: 176 DTIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTN 235
           D +K GRRGSLSG++T++G QGH+AYPHL +NPI    P L +L    +D GN  F PT 
Sbjct: 179 DMVKNGRRGSLSGKLTVNGVQGHIAYPHLAKNPIHLAAPALAELAATKWDDGNAYFPPTT 238

Query: 236 MEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVH 295
            +++ I  G  + N+IP  V + FN RF+       LK  + S L     +   L +T+ 
Sbjct: 239 WQMSNIHGGTGATNIIPGHVTIDFNFRFSTASTPDGLKARVHSIL-----DAHGLDYTLD 293

Query: 296 FSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVG 354
           ++    P FLT   +L+  L+ +I    G    LST+GGTSD RFI   CP VIEFG   
Sbjct: 294 WTLGGEP-FLTERGELSDALASAIQAECGVTTELSTTGGTSDGRFIAKICPQVIEFGPPN 352

Query: 355 RTMHALNENASLQDLEDLTCIYENFLQNW 383
            ++H ++E+  +  +E L  +Y   L+  
Sbjct: 353 ASIHKIDEHVEVAFIEPLKNVYRRVLETL 381


>gi|255021223|ref|ZP_05293273.1| N-succinyl-L,L-diaminopimelate desuccinylase [Acidithiobacillus
           caldus ATCC 51756]
 gi|254969338|gb|EET26850.1| N-succinyl-L,L-diaminopimelate desuccinylase [Acidithiobacillus
           caldus ATCC 51756]
          Length = 382

 Score =  239 bits (608), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 137/386 (35%), Positives = 205/386 (53%), Gaps = 13/386 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            L +   L+  PSVTP+DGG    +   L+ +GF++            V+N +A  G   
Sbjct: 7   VLRYAQTLMARPSVTPEDGGCQTWMAERLQQIGFTVTPLPA-----GGVENFWAIRGESG 61

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P   FAGH DVVPPG    W   PF+  + +G +YGRG  DMKGS+A  + AV  F+  +
Sbjct: 62  PIFCFAGHTDVVPPGPREAWATDPFTPELRDGVLYGRGAADMKGSLAAMLVAVEDFVGAH 121

Query: 125 K-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
             + G I+ LIT DEEG A +GT+ ++ ++  +  + D C+VGEP+    +GD +K GRR
Sbjct: 122 PRHPGRIAFLITSDEEGVATHGTRHVVDYLAARQIRPDYCLVGEPSSAERLGDVVKNGRR 181

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL+  + I G+QGHVAYP L +NPI   +  L +L    +D G   F PT ++I+ I  
Sbjct: 182 GSLNARLRILGQQGHVAYPELADNPIHRALRPLTELVEKEWDDGYPDFPPTRLQISNIHA 241

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G    NVIP Q+++ FN RF+   + ++L++ +   L     +   L + + +     P 
Sbjct: 242 GTGVTNVIPGQLELQFNFRFSPASSLESLQKAVVDLL-----DRHGLHYELDWQFSGPPF 296

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
           +     KL +   + +    G    LST GGTSD RFI      V+E G    T+H +NE
Sbjct: 297 YTPP-GKLVAATQRVLQRRLGREAQLSTGGGTSDGRFIAQLGGEVLELGPRNATIHKVNE 355

Query: 363 NASLQDLEDLTCIYENFLQNWFITPS 388
              L +LEDL  IY+  L+   +  +
Sbjct: 356 CVELAELEDLAAIYQGLLEELLVGTA 381


>gi|227329727|ref|ZP_03833751.1| succinyl-diaminopimelate desuccinylase [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 375

 Score =  239 bits (608), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 146/385 (37%), Positives = 218/385 (56%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M+   +E   QLIK PS++P D G   +++  L  +GF++E  DF         N +A  
Sbjct: 1   MSCPVIELAQQLIKRPSLSPNDEGCQALMIERLTAIGFTVEAMDFGDTQ-----NFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT    L FAGH DVVP GD +HW +PPF   I +G +YGRG  DMKGS+A  + A  RF
Sbjct: 56  GT-GKTLAFAGHTDVVPSGDESHWQHPPFEPIIRDGMLYGRGAADMKGSLAAMVIAAERF 114

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +  +  + G ++ LIT DEE  A+NGT K++  +  + E+ D C+VGEP+  H++GD +K
Sbjct: 115 VAAHPNHQGRLAFLITSDEEASAVNGTVKVVEALMARNERLDYCLVGEPSSTHVVGDVVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGS++  + +HG QGHVAYPHL +NP+    P L++L    +D GN  F PT M+I 
Sbjct: 175 NGRRGSITANLRVHGVQGHVAYPHLADNPVHRAAPALNELIATEWDQGNDFFPPTTMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    +  +++ +   L +   N     +T+ +   
Sbjct: 235 NIQAGTGSNNVIPGELFVQFNFRFSTELTDVLIQQRVAELLDRHQLN-----YTIDWKLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   +L   +  ++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGELVDAVVNAVKHYNEVTPELLTTGGTSDGRFIARMGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            ++E  S  DL+ L+ +Y+  ++  
Sbjct: 349 KVDECVSAADLQLLSRMYQRIMEQL 373


>gi|124266994|ref|YP_001020998.1| succinyl-diaminopimelate desuccinylase [Methylibium petroleiphilum
           PM1]
 gi|238064791|sp|A2SGS4|DAPE_METPP RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|124259769|gb|ABM94763.1| succinyldiaminopimelate desuccinylase [Methylibium petroleiphilum
           PM1]
          Length = 386

 Score =  239 bits (608), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 153/388 (39%), Positives = 224/388 (57%), Gaps = 12/388 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYA-R 59
           + P  L    QLI   SVTP+D G   ++V  L+  GF     +    +   V NL+A R
Sbjct: 4   LPPTALALAEQLIARASVTPEDAGCQALVVQRLQAQGFDCHTLESGPDDF-RVTNLWAVR 62

Query: 60  FGT--EAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAV 117
            G   +   L+FAGH DVVP G    WT  PF  +  +G++YGRG  DMK SIAC + A+
Sbjct: 63  RGRSADGFTLVFAGHTDVVPTGPLERWTSDPFVPSHRDGRLYGRGAADMKTSIACMVVAI 122

Query: 118 ARFIPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGD 176
             F+  Y    GSI+LL+T DEEGPA++GT +++ W++ +GE+ D CIVGEPT  + +GD
Sbjct: 123 EEFVAAYPRHAGSIALLLTSDEEGPALDGTTQVVRWLQARGERLDGCIVGEPTSVNAVGD 182

Query: 177 TIKIGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNM 236
            IK GRRGSLSG + + G QGH+AYPHL +NPI  + P L +L  + +D GN  F PT+ 
Sbjct: 183 MIKNGRRGSLSGRLVVQGVQGHIAYPHLAKNPIHAVAPALAELVQVVWDGGNEHFPPTSW 242

Query: 237 EITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHF 296
           +++ +  G  + NVIP +  + FN RF+     +TL++ + + L     +   L +T+ +
Sbjct: 243 QVSNLHAGTGASNVIPGEAVVDFNFRFSTESTPETLQQRLAAVL-----DRHGLQYTIDW 297

Query: 297 SSPVSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDYCP-VIEFGLVGR 355
           +    P        LT  L  +I   TG    LST+GGTSD RFI   CP V+E G V  
Sbjct: 298 TLGGRPFLTRPGS-LTEALGSAILQVTGRTTELSTTGGTSDGRFIATVCPQVVECGPVNA 356

Query: 356 TMHALNENASLQDLEDLTCIYENFLQNW 383
           ++H ++E+ ++ ++E L  IY + L+  
Sbjct: 357 SIHQIDEHVAVAEIEPLKEIYRSTLERL 384


>gi|290475597|ref|YP_003468485.1| N-succinyl-diaminopimelate deacylase [Xenorhabdus bovienii SS-2004]
 gi|289174918|emb|CBJ81719.1| N-succinyl-diaminopimelate deacylase [Xenorhabdus bovienii SS-2004]
          Length = 375

 Score =  239 bits (608), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 151/385 (39%), Positives = 207/385 (53%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    +E   QLIK PSV+P D G   IL+  L+  GF+IE   F         N +A  
Sbjct: 1   MICPVIELAQQLIKHPSVSPDDQGCQDILIQRLQDTGFTIERMPFGD-----TLNFWAYH 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           GT      FAGH DVVP GD + W  PPF   I +G +YGRG  DMKGS+A  I A  RF
Sbjct: 56  GTGT-TFAFAGHTDVVPAGDTSEWQTPPFDPVIRDGMLYGRGAADMKGSLAAMIVAAERF 114

Query: 121 IPKYK-NFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           +     + G ++ LIT DEE  A NGT K++  +  + E+ D C+VGEP+    +GD IK
Sbjct: 115 VKDNPDHPGRLAFLITSDEEASATNGTVKVVETLMSRHERLDYCLVGEPSSQQRLGDIIK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  +TIHG QGHVAYP L +NPI   +P L +L N  +D GN  F  T+M+I 
Sbjct: 175 NGRRGSLTASLTIHGIQGHVAYPQLADNPIHHSLPFLQELVNTQWDNGNEFFPATSMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    +  +++ +   L K         + + +   
Sbjct: 235 NIQAGTGSNNVIPGKLWVQFNFRFSTELTDTEIRQRVEDMLKKHNLK-----YDIDWWLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P       +L   + +SI    G  P +S SGGTSD RFI      V+E G +  T+H
Sbjct: 290 GQPFLTCK-GELVDAVVESIEQCCGYKPEISMSGGTSDGRFIAKMGAQVVELGPINATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  S+ DL+ L+ IY+  ++  
Sbjct: 349 KVNEGISVSDLQKLSLIYQRIMEQL 373


>gi|85059696|ref|YP_455398.1| succinyl-diaminopimelate desuccinylase [Sodalis glossinidius str.
           'morsitans']
 gi|123519112|sp|Q2NS82|DAPE_SODGM RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|84780216|dbj|BAE74993.1| succinyl-diaminopimelate desuccinylase [Sodalis glossinidius str.
           'morsitans']
          Length = 375

 Score =  239 bits (608), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 144/385 (37%), Positives = 211/385 (54%), Gaps = 14/385 (3%)

Query: 1   MTPDCLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF 60
           M    LE   QLIK PS++P D G   ++   L+ LGF+IE+  F         N +A  
Sbjct: 1   MPCPVLELTQQLIKRPSLSPDDAGCQALIAARLQALGFTIEQMSFGD-----TLNFWAWR 55

Query: 61  GTEAPHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARF 120
           G  +  L FAGH DVVP GD   W  PPF  T+ +G +YGRG  DMKGS+A  + A  RF
Sbjct: 56  GQGS-TLAFAGHTDVVPAGDLQLWDNPPFEPTLCDGMLYGRGAADMKGSLAAMVVAAERF 114

Query: 121 IPKYKNF-GSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIK 179
           + ++    G ++ LIT DEE  A +GT K++  +  + E+ D C+VGEP+ +  +GD +K
Sbjct: 115 VAQHPQHEGRLAFLITSDEEADAQDGTVKVVDALMARQERLDYCLVGEPSSSRQVGDIVK 174

Query: 180 IGRRGSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEIT 239
            GRRGSL+  + + G QGHVAYPHL +NP    +  L +L    +D GN+ F PT M+I 
Sbjct: 175 NGRRGSLTANLVVQGVQGHVAYPHLADNPFHRAMAALKELVETQWDEGNSFFPPTTMQIA 234

Query: 240 TIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSP 299
            I  G  S NVIP ++ + FN RF+    +  +++ + + L         L + + +S  
Sbjct: 235 NIHAGTGSNNVIPGELLVQFNFRFSTELTDVIIRQRVEALLQH-----HGLRYRIDWSLS 289

Query: 300 VSPVFLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMH 358
             P FLT   +L     +++ +     P L T+GGTSD RFI      V+E G V  T+H
Sbjct: 290 GQP-FLTARGELVDAAVRAVEHYQELTPRLETTGGTSDGRFIARLGAQVVELGPVNATIH 348

Query: 359 ALNENASLQDLEDLTCIYENFLQNW 383
            +NE  S  DL+ L+ +Y+  ++  
Sbjct: 349 KVNECVSAADLQLLSRMYQRIMEQL 373


>gi|77165591|ref|YP_344116.1| succinyl-diaminopimelate desuccinylase [Nitrosococcus oceani ATCC
           19707]
 gi|254434310|ref|ZP_05047818.1| succinyl-diaminopimelate desuccinylase [Nitrosococcus oceani AFC27]
 gi|123593836|sp|Q3J9B0|DAPE_NITOC RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|76883905|gb|ABA58586.1| succinyldiaminopimelate desuccinylase [Nitrosococcus oceani ATCC
           19707]
 gi|207090643|gb|EDZ67914.1| succinyl-diaminopimelate desuccinylase [Nitrosococcus oceani AFC27]
          Length = 376

 Score =  239 bits (608), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 153/382 (40%), Positives = 215/382 (56%), Gaps = 13/382 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEA 64
            LE   +LI C S+TP+D G   +L   L  LGF  E+ +F       V N++ R G + 
Sbjct: 4   TLELAKRLIACASITPRDAGCQGLLAQRLLALGFQGEQMNFGE-----VDNIWLRRGQKP 58

Query: 65  PHLMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKY 124
           P  +FAGH DVVPPG  + W   PF+  +  G +YGRG  DMKGS+A  + A   FI  +
Sbjct: 59  PLFVFAGHTDVVPPGPPDKWLTDPFTPEVRNGLLYGRGAADMKGSLAAMVTACEHFINVH 118

Query: 125 -KNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRR 183
             + GSI+ L+T DEEGPAINGT K++  ++ +GEK D C+VGEPT    +GD IK GRR
Sbjct: 119 SDHAGSIAFLLTSDEEGPAINGTIKVVETLQARGEKIDYCLVGEPTSQKQVGDMIKNGRR 178

Query: 184 GSLSGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDV 243
           GSL G + + G QGHVAYPHL +NPI  L P L  L    +D GN  F PT  +I+ I  
Sbjct: 179 GSLGGRLIVRGIQGHVAYPHLADNPIHSLAPALAVLCAQTWDQGNKDFPPTTFQISNIQG 238

Query: 244 GNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPV 303
           G  + NVIP +V++ FN R++     + L++++   L +   N     + + ++    P 
Sbjct: 239 GTGATNVIPGEVEILFNFRYSTEVTHQQLQQQMEEILSQQRLN-----YELEWTLSGKPF 293

Query: 304 FLTHDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKD-YCPVIEFGLVGRTMHALNE 362
                  L + +S+++   TG     ST+GGTSD RFI      V+E G V  T+H +NE
Sbjct: 294 LTAPGS-LMTAVSQAVRGITGIDAEFSTTGGTSDGRFIAPTGAQVVELGPVNATIHKVNE 352

Query: 363 NASLQDLEDLTCIYENFLQNWF 384
             ++ DLE L+ IY   L+   
Sbjct: 353 CVAVADLEILSRIYSRILEILL 374


>gi|160899051|ref|YP_001564633.1| succinyl-diaminopimelate desuccinylase [Delftia acidovorans SPH-1]
 gi|238064730|sp|A9BZY6|DAPE_DELAS RecName: Full=Succinyl-diaminopimelate desuccinylase; Short=SDAP
           desuccinylase; AltName:
           Full=N-succinyl-LL-2,6-diaminoheptanedioate
           amidohydrolase
 gi|160364635|gb|ABX36248.1| succinyl-diaminopimelate desuccinylase [Delftia acidovorans SPH-1]
          Length = 386

 Score =  239 bits (608), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 149/384 (38%), Positives = 216/384 (56%), Gaps = 12/384 (3%)

Query: 5   CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARF---G 61
            L+   QLI  PSVTP+D G   +L + L+ +GF+ E  D     +  V+NL+AR    G
Sbjct: 4   TLQLTEQLISLPSVTPEDAGCLELLADALQPMGFACERIDSGPD-SFRVRNLWARRSGTG 62

Query: