RPSBLAST alignment of GI: 254780782 and protein with PDBid: 1q7l

>1q7l_A Aminoacylase-1; catalysis, enzyme dimerization, site- directed mutagenesis, structure comparison, zinc, hydrolase; 1.40A {Homo sapiens} SCOP: c.56.5.4 Length = 198
 Score =  122 bits (307), Expect = 1e-28
 Identities = 41/192 (21%), Positives = 69/192 (35%), Gaps = 13/192 (6%)

Query: 6   LEHLIQLIKCPSVTPQD--GGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTE 63
           +    Q ++  +V P+   G A      T + LG   ++ +        V   +      
Sbjct: 13  VTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTV-LTWPGTNPT 71

Query: 64  APHLMFAGHIDVVPPGDFNHWTYPPFSAT-IAEGKIYGRGIVDMKGSIACFIAAVARFIP 122
              ++   H DVVP     HW++ PF A   +EG IY RG  DMK     ++ AV R   
Sbjct: 72  LSSILLNSHTDVVPV-FKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKV 130

Query: 123 -KYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACI---VGEPTCNHIIGDTI 178
             ++   +I +    DEE     G +  +   E    +    +   +  PT       T+
Sbjct: 131 EGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTD----AFTV 186

Query: 179 KIGRRGSLSGEI 190
               R      +
Sbjct: 187 FYSERSPWWVRV 198