RPSBLAST alignment of GI: 254780782 and protein with PDBid: 2qyv

>2qyv_A XAA-His dipeptidase; YP_718209.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 2.11A {Haemophilus somnus 129PT} Length = 487
 Score = 65.1 bits (157), Expect = 2e-11
 Identities = 18/165 (10%), Positives = 39/165 (23%), Gaps = 10/165 (6%)

Query: 221 NIGFDTGNTTFSPTNMEITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRL 280
                 G    S     +    +           V+ +  +R      +  +   ++S  
Sbjct: 326 LNVLPNGVVRNSDVIENVVETSLSIGVLKTEDNFVRSTMLVRSLIESGKSYVASLLKSLA 385

Query: 281 IKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLSKSIYNTTGNIP-LLSTSGGTSDAR 339
                        ++ S             +  L         G  P +     G     
Sbjct: 386 -------SLAQGNINLSGDYPGWEPQSHSDILDLTKTIYAQVLGTDPEIKVIHAGLECGL 438

Query: 340 FIKDY--CPVIEFGLVGRTMHALNENASLQDLEDLTCIYENFLQN 382
             K Y    ++  G   R  H+ +E   +  +E    +    L +
Sbjct: 439 LKKIYPTIDMVSIGPTIRNAHSPDEKVHIPAVETYWKVLTGILAH 483