RPSBLAST alignment of GI: 254780782 and protein with PDBid: 3isx

>3isx_A Endoglucanase; TM1050, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.40A {Thermotoga maritima} Length = 343
 Score = 91.0 bits (224), Expect = 4e-19
 Identities = 35/378 (9%), Positives = 93/378 (24%), Gaps = 53/378 (14%)

Query: 7   EHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGTEAPH 66
           E + +L +    + ++     I++  L+                    NL    G+    
Sbjct: 15  ELIRKLTEAFGPSGREEEVRSIILEELEGHIDGHRIDGLG--------NLIVWKGSGEKK 66

Query: 67  LMFAGHIDVVPPGDFNHWTYPPFSATIAEGKIYGRGIVDMKGSIACFIAAVARFIPKYKN 126
           ++   HID +                +      G   ++  G ++ ++    R       
Sbjct: 67  VILDAHIDEIGVV-------------VTNVDDKGFLTIEPVGGVSPYMLLGKRIR----- 108

Query: 127 FGSISLLITGDEEGPAINGTKKMLSWIEKKGEKWDACIVGEPTCNHIIGDTIKIGRRGSL 186
                    G      + G          +   +D   +     +      +       +
Sbjct: 109 ------FENGTIGVVGMEGETTEERQENVRKLSFDKLFIDIGANSREEAQKMCPIGSFGV 162

Query: 187 SGEITIHGKQGHVAYPHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNMEITTIDVGNP 246
                +     +V+           ++ +  +               +  E   +   + 
Sbjct: 163 YDSGFVEVSGKYVSKAMDDRIGCAVIVEVFKR----IKPAVTLYGVFSVQEEVGLVGASV 218

Query: 247 SKNVIPAQVKMSFNIRF-NDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFL 305
           +   +PA   ++ ++    D            S              +      +  +  
Sbjct: 219 AGYGVPADEAIAIDVTDSADTPKAIKRHAMRLSGGPALKVKDRASISSKRILENLIEIAE 278

Query: 306 THDRKLTSLLSKSIYNTTGNIPLLSTSGGTSDARFIKDY--CPVIEFGLVGRTMHALNEN 363
             D K                  + T GGT+   + +     P     +  R +H+ +E 
Sbjct: 279 KFDIKYQ--------------MEVLTFGGTNAMGYQRTREGIPSATVSIPTRYVHSPSEM 324

Query: 364 ASLQDLEDLTCIYENFLQ 381
            +  D+E    +   +L 
Sbjct: 325 IAPDDVEATVDLLIRYLG 342