RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780783|ref|YP_003065196.1| transcription regulator protein [Candidatus Liberibacter asiaticus str. psy62] (149 letters) >gnl|CDD|147562 pfam05443, ROS_MUCR, ROS/MUCR transcriptional regulator protein. This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti. This gene encodes a 15.5-kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid and is necessary for succinoglycan production. Sinorhizobium meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of alfalfa nodules. MucR from Sinorhizobium meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan. Length = 130 Score = 190 bits (486), Expect = 1e-49 Identities = 68/131 (51%), Positives = 91/131 (69%), Gaps = 1/131 (0%) Query: 8 DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67 +S LE+T DIV+AYVSN+ VP ++ LI VH+AL + + A + E+ PA Sbjct: 1 MASSDLLELTADIVSAYVSNNSVPAEELPGLIQSVHAALAGLGAPAAAPA-AEEEKPTPA 59 Query: 68 VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127 VPI+KS+ + CLEDG +FK+LKRHL+THH +TP+EYR KW L +DYPMV+ YA R Sbjct: 60 VPIKKSVTPDYIICLEDGKKFKTLKRHLRTHHGLTPEEYRAKWGLPADYPMVAPNYAAAR 119 Query: 128 SKLAKNMGLGR 138 S+LAK +GLGR Sbjct: 120 SELAKKIGLGR 130 >gnl|CDD|34565 COG4957, COG4957, Predicted transcriptional regulator [Transcription]. Length = 148 Score = 174 bits (442), Expect = 9e-45 Identities = 75/148 (50%), Positives = 98/148 (66%), Gaps = 2/148 (1%) Query: 1 MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60 M + S +S++ +E+T DIV+AYVSN+ VP++++ LI VH+AL A V Sbjct: 1 MMTETSDESNDLLIELTADIVSAYVSNNPVPVSELPDLIAQVHAALAGTGGPAEPP--VP 58 Query: 61 PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120 E+ KPAVPI+KS+ + CLEDG +FKSLKRHL TH+ +TPDEYR KW L DYPMV+ Sbjct: 59 VEKQKPAVPIKKSVTPDYIICLEDGKKFKSLKRHLTTHYGLTPDEYRAKWGLPPDYPMVA 118 Query: 121 REYATTRSKLAKNMGLGRGRKKRVLTSK 148 YA RS+LAK MGLGR RK + Sbjct: 119 PNYAAARSQLAKAMGLGRKRKAGAPAKR 146 >gnl|CDD|38829 KOG3623, KOG3623, KOG3623, Homeobox transcription factor SIP1 [Transcription]. Length = 1007 Score = 28.2 bits (62), Expect = 0.99 Identities = 11/43 (25%), Positives = 14/43 (32%) Query: 64 LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEY 106 P S C YC + SLK H+K H + Sbjct: 199 AMQGTPDAFSQLLTCPYCDRGYKRLTSLKEHIKYRHEKNEPNF 241 >gnl|CDD|133109 cd06252, M14_ASTE_ASPA_like_2, A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases. ASTE catalyzes the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway, and aspartoacylase (ASPA, also known as aminoacylase 2, and ACY-2; EC:3.5.1.15) cleaves N-acetyl L-aspartic acid (NAA) into aspartate and acetate. NAA is abundant in the brain, and hydrolysis of NAA by ASPA may help maintain white matter. ASPA is an NAA scavenger in other tissues. Mutations in the gene encoding ASPA cause Canavan disease (CD), a fatal progressive neurodegenerative disorder involving dysmyelination and spongiform degeneration of white matter in children. This enzyme binds zinc which is necessary for activity. Measurement of elevated NAA levels in urine is used in the diagnosis of CD. Length = 316 Score = 27.2 bits (61), Expect = 1.7 Identities = 8/25 (32%), Positives = 16/25 (64%), Gaps = 3/25 (12%) Query: 20 IVAAYVSNHVVPMADIGSLITDVHS 44 ++A Y++ ++P AD + D+HS Sbjct: 110 MIAHYLTTELLPRAD---YVIDLHS 131 >gnl|CDD|35125 COG5566, COG5566, Uncharacterized conserved protein [Function unknown]. Length = 137 Score = 26.9 bits (59), Expect = 2.2 Identities = 16/77 (20%), Positives = 29/77 (37%), Gaps = 17/77 (22%) Query: 37 SLITDVHSALQRVVSRAPCQDNVQPERLKPAV-----------------PIRKSIENGCL 79 SL+++VH + A +DN +P LK IR ++ N + Sbjct: 37 SLLSEVHEVFLAELEDAGIEDNGKPLALKLVFKLMEYGGGRSFYLPKGDSIRATLRNKQI 96 Query: 80 YCLEDGMQFKSLKRHLK 96 + DG + L + + Sbjct: 97 FSDFDGSNYVELAKKYR 113 >gnl|CDD|35782 KOG0562, KOG0562, KOG0562, Predicted hydrolase (HIT family) [General function prediction only]. Length = 184 Score = 26.9 bits (59), Expect = 2.6 Identities = 9/27 (33%), Positives = 12/27 (44%) Query: 78 CLYCLEDGMQFKSLKRHLKTHHNMTPD 104 C C G F LK HL+ ++ D Sbjct: 156 CWRCQTFGPHFPKLKAHLREEYDQWLD 182 >gnl|CDD|100033 cd02197, HypE, HypE (Hydrogenase expression/formation protein). HypE is involved in Ni-Fe hydrogenase biosynthesis. HypE dehydrates its own carbamoyl moiety in an ATP-dependent process to yield the enzyme thiocyanate. The N-terminal domain of HypE is related to the ATP-binding domains of the AIR synthases, selenophosphate synthetase (SelD), and FGAM synthase and is thought to bind ATP.. Length = 293 Score = 25.9 bits (58), Expect = 4.0 Identities = 12/43 (27%), Positives = 16/43 (37%), Gaps = 12/43 (27%) Query: 1 MDDDASFDSSERFLEMTVDIVAAYVSNHVV-----PMADIGSL 38 ++D A+ L T D + VV P DIG L Sbjct: 26 LEDAAALLVGGGRLAFTTD-------SFVVSPLFFPGGDIGKL 61 >gnl|CDD|36695 KOG1482, KOG1482, KOG1482, Zn2+ transporter [Inorganic ion transport and metabolism]. Length = 379 Score = 25.6 bits (56), Expect = 5.2 Identities = 10/32 (31%), Positives = 17/32 (53%) Query: 13 FLEMTVDIVAAYVSNHVVPMADIGSLITDVHS 44 + M ++V Y +N + M D L++DV S Sbjct: 83 LVFMIGEVVGGYKANSLAIMTDAAHLLSDVAS 114 >gnl|CDD|31690 COG1501, COG1501, Alpha-glucosidases, family 31 of glycosyl hydrolases [Carbohydrate transport and metabolism]. Length = 772 Score = 25.7 bits (56), Expect = 5.4 Identities = 11/46 (23%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Query: 86 MQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131 QF + + H N R W + + REY R +L Sbjct: 527 YQFGAFSPIFRLHGNDN--IPREPWAFGEETEEIVREYIQLRYRLL 570 >gnl|CDD|37996 KOG2785, KOG2785, KOG2785, C2H2-type Zn-finger protein [General function prediction only]. Length = 390 Score = 25.4 bits (55), Expect = 6.9 Identities = 20/84 (23%), Positives = 31/84 (36%), Gaps = 10/84 (11%) Query: 73 SIENGCLYCLEDGMQFKSL---------KRHLKTHHNMTPD-EYRIKWNLASDYPMVSRE 122 I CL+C E G F SL K H K ++ E ++ +S YP ++ Sbjct: 215 GIGFICLFCNELGRPFSSLEAVRAHMRDKGHCKLPYDGEERLELAEFYDFSSSYPDIAEN 274 Query: 123 YATTRSKLAKNMGLGRGRKKRVLT 146 ++ L G + LT Sbjct: 275 QDPDSAEEDPTDELEGGDELYELT 298 >gnl|CDD|30697 COG0349, Rnd, Ribonuclease D [Translation, ribosomal structure and biogenesis]. Length = 361 Score = 25.3 bits (55), Expect = 6.9 Identities = 17/67 (25%), Positives = 23/67 (34%) Query: 74 IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133 G L ED + +R K E +I +L V RE A R + A+ Sbjct: 167 AREGRLEWAEDEFRLLPTRRTYKVLPEDAWREIKIAHSLDPRELAVLRELAAWREREARE 226 Query: 134 MGLGRGR 140 L R Sbjct: 227 RDLARNF 233 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.132 0.386 Gapped Lambda K H 0.267 0.0809 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,716,739 Number of extensions: 80620 Number of successful extensions: 188 Number of sequences better than 10.0: 1 Number of HSP's gapped: 186 Number of HSP's successfully gapped: 17 Length of query: 149 Length of database: 6,263,737 Length adjustment: 85 Effective length of query: 64 Effective length of database: 4,426,972 Effective search space: 283326208 Effective search space used: 283326208 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (24.0 bits)