BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780783|ref|YP_003065196.1| transcription regulator protein [Candidatus Liberibacter asiaticus str. psy62] (149 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780783|ref|YP_003065196.1| transcription regulator protein [Candidatus Liberibacter asiaticus str. psy62] Length = 149 Score = 313 bits (802), Expect = 9e-88, Method: Compositional matrix adjust. Identities = 149/149 (100%), Positives = 149/149 (100%) Query: 1 MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60 MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ Sbjct: 1 MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60 Query: 61 PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120 PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS Sbjct: 61 PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120 Query: 121 REYATTRSKLAKNMGLGRGRKKRVLTSKV 149 REYATTRSKLAKNMGLGRGRKKRVLTSKV Sbjct: 121 REYATTRSKLAKNMGLGRGRKKRVLTSKV 149 >gi|254780823|ref|YP_003065236.1| double-strand break repair protein AddB [Candidatus Liberibacter asiaticus str. psy62] Length = 1040 Score = 23.9 bits (50), Expect = 1.2, Method: Composition-based stats. Identities = 9/29 (31%), Positives = 18/29 (62%) Query: 99 HNMTPDEYRIKWNLASDYPMVSREYATTR 127 H + ++Y + W LA+D+ ++ +Y T R Sbjct: 170 HALKNEKYGMWWLLAADFLKIASKYWTER 198 >gi|254780941|ref|YP_003065354.1| GTP-binding protein Era [Candidatus Liberibacter asiaticus str. psy62] Length = 311 Score = 23.1 bits (48), Expect = 2.1, Method: Compositional matrix adjust. Identities = 29/115 (25%), Positives = 43/115 (37%), Gaps = 5/115 (4%) Query: 19 DIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS---IE 75 DIV V +H +I L+ ++ R++ D V+PERL I IE Sbjct: 103 DIVCLVVDSHRELKVNIHDLLKEIAKRSSRLILILNKIDCVKPERLLEQAEIANKLVFIE 162 Query: 76 NGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130 + G + +L + + P Y + SD PM TR KL Sbjct: 163 KTFMVSATKGHGCDDVLNYLCSTLPLAPWVYSA--DQISDLPMFHFTAEITREKL 215 >gi|254780634|ref|YP_003065047.1| NOL1/NOP2/SUN family signature protein [Candidatus Liberibacter asiaticus str. psy62] Length = 429 Score = 22.3 bits (46), Expect = 4.1, Method: Compositional matrix adjust. Identities = 14/47 (29%), Positives = 24/47 (51%) Query: 25 VSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIR 71 +S+ +D S+ VH L++ +S A D+ PE L AV ++ Sbjct: 33 MSHRFAGSSDRASISNIVHDVLRKYLSSAYIMDSDDPESLVYAVIMK 79 >gi|254780399|ref|YP_003064812.1| DNA mismatch repair protein [Candidatus Liberibacter asiaticus str. psy62] Length = 594 Score = 21.2 bits (43), Expect = 8.5, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 17/31 (54%) Query: 27 NHVVPMADIGSLITDVHSALQRVVSRAPCQD 57 N+++ G +I D H+A +R++ QD Sbjct: 416 NYIISQTTDGLVIVDQHAAHERLIFEKMRQD 446 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.132 0.386 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 88,820 Number of Sequences: 1233 Number of extensions: 3211 Number of successful extensions: 9 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 7 length of query: 149 length of database: 328,796 effective HSP length: 66 effective length of query: 83 effective length of database: 247,418 effective search space: 20535694 effective search space used: 20535694 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 34 (17.7 bits)