HHsearch alignment for GI: 254780784 and conserved domain: KOG1067

>KOG1067 consensus.
Probab=100.00  E-value=0  Score=1691.16  Aligned_cols=684  Identities=40%  Similarity=0.650  Sum_probs=663.6

Q ss_pred             CEEEEEEEECCEEEEEEECEECCCCCCEEEEEECCCEEEEEEEECCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCC
Q ss_conf             20899999899899999140045467289999789489999972788887777354068665232013367888735789
Q gi|254780784|r    3 DVHTVEIEWAGRPLKLETGRIARQSDGAVLATYGETVVLATVVYDRSLKDGQDFFPLTVNYQERTYAVGKIPGGYLRRES   82 (699)
Q Consensus         3 ~~~~~~~~~ggr~i~~ETGklArqA~GsV~v~~G~T~VLaTv~~~~~~~~~~dFfPLtVdY~Ek~yAaGkIPGgF~kREg   82 (699)
T Consensus        45 ~~vsVeipfGnR~i~~eTG~maRfAngsvvv~~GeT~V~ttv~~a~~PSp~~-FlPL~VdYqek~aA~GRip~~f~rREg  123 (760)
T KOG1067          45 NAVSVEIPFGNREILFETGKLARFANGSVVVQMGETAVMTTVVLADKPSPPQ-FLPLVVDYQEKFAAVGRIPGNFMRREG  123 (760)
T ss_pred             CCEEEEECCCCEEEEEECCHHHHHCCCCEEECCCCEEEEEEEEECCCCCCCC-CCEEEEEHHHHHHHHCCCCCCHHHCCC
T ss_conf             6504650569747999614334212785797048758999988517899644-403798756544441567763100147


Q ss_pred             CCCHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEECCCCEE
Q ss_conf             88714531111232126776746886883789999821888877899999999998732688235411235520477324
Q gi|254780784|r   83 RPTENEILISRMIDRSIRPLFSKCYKNETQVIINVMQHDLESSPHVVSMVAASAALMLSGLPFEGPVVGAQVDYINGQYV  162 (699)
Q Consensus        83 rpsd~EiL~sRlIDR~lRPLFPkgf~~evQIv~~VLS~D~~~dpdvlAi~aASaAL~ISdIPf~GPVaaVRVG~idge~V  162 (699)
T Consensus       124 ~tkd~Eil~~rLidrsirplfp~g~~~etqi~~n~Ls~dG~~~pdvlainaas~Al~lsdvpw~gpig~vRigLi~Ge~v  203 (760)
T KOG1067         124 RTKDKEILTGRLIDRPIRPLFPKGFYHETQILCNVLSSDGVHDPDVLAINAASAALSLSDVPWNGPIGAVRIGLIDGEFV  203 (760)
T ss_pred             CCCCCEEEEEECCCCCCCCCCCCCCHHHHHHHHHHEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEEEEECCEEE
T ss_conf             88550146642137655667755205378887665111465580288776777776431487778421168623343388


Q ss_pred             ECCCCCCC-CCCCEEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCC--CHHH
Q ss_conf             36850002-22101355305443233312444324899998875316889999999999999838898644743--1257
Q gi|254780784|r  163 LNPRLDED-QGSLDLFVSGTQDAVLMVELEANQLSEDVVLDAIIFGHNECKPVIEAISKLAKMCAKEPIVIDSK--DFSK  239 (699)
Q Consensus       163 iNPt~ee~-esdLDLvVAGT~d~IlMIE~~A~EVsEe~mleAI~~Ahe~Ik~iI~~Q~eL~~~~Gk~K~~~~~~--~~~~  239 (699)
T Consensus       204 VNPT~kEmssS~Lnlvvagt~~~~vmle~~s~~i~qqdl~~Aikvg~~~~q~~i~~i~~L~k~~Gk~Kr~~~~~~~p~pe  283 (760)
T KOG1067         204 VNPTRKEMSSSQLNLVVAGTKSQTVMLEGSSNNILQQDLLHAIKVGVKEAQQIIQGIERLAKKYGKQKREPQKLFLPDPE  283 (760)
T ss_pred             ECCCHHHHHHCCCEEEEEECCCEEEEEECCCCCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCCCHHHHCCCCHH
T ss_conf             67516654015300588714652899970024220899999997430889999999999999858662432444289878


Q ss_pred             HHHHHHHHHHHHHHHHHHCC--HHHHHHHHHHHHHHHHHHCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             99999999898888874100--0122489999999999730223100000267889999999999999987288665886
Q gi|254780784|r  240 LEEEMSQMIKEDLRVSCFIP--EKYVRCKQIDDLKKKMVSYFSSEHSSWNEGEIVSVFEDIQAKVVRTVMLDKKVRMDGR  317 (699)
Q Consensus       240 ~~~~v~~~~~~~l~~a~~i~--~K~eR~~ai~~l~~ei~e~l~ee~~~~~~~~i~~af~~l~k~ivR~~ILeeg~R~DGR  317 (699)
T Consensus       284 l~K~v~~la~erl~~vftd~shdK~sR~eAvn~i~~~~e~k~~e~~pe~e~~~i~~~fn~vskkv~Rs~i~~~gkR~DGR  363 (760)
T KOG1067         284 LVKHVHKLAMERLYAVFTDYSHDKISRDEAVNKIRLDDEDKVKEEFPEQEPSEIIESFNTVSKKVFRSRILEEGKRCDGR  363 (760)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHCCCHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             99999999999999985253445101566775532004777776468866789999999999999999997136556783


Q ss_pred             CCCCEEEEEEEECCCCCCCCEEEEEECCCEEEEEEEECCCCCCCCCCCCCCCCE-EEEEEEECCCCCCCCCCCCCCCCCC
Q ss_conf             775337879984475466700899987976899998168652122334454420-3587740588754453345567650
Q gi|254780784|r  318 DSETVRDISAQVGLLQRTHGSSLFIRGDTQAIVVVTLGTREDEQYVDSLSGTQR-NDFMMHYNFLPCATGEVSRMGAPSR  396 (699)
Q Consensus       318 ~~dEIRpIs~EvgvLPrvHGSALFtRGETQaL~tvTLG~~~d~Q~iD~l~~~~~-k~fmlHYNFPpfsvGE~~~~~~~~R  396 (699)
T Consensus       364 ~ldelR~I~ce~~m~~~lHGSaLFqRGqTQvlctVtl~s~e~a~klD~l~~~~~~~~FmLhY~FPPyat~Evgkig~~nR  443 (760)
T KOG1067         364 DLDELRNISCEVDMLKTLHGSALFQRGQTQVLCTVTLDSLESAQKLDSLIGPDNGINFMLHYEFPPYATNEVGKIGGLNR  443 (760)
T ss_pred             CHHHHCCCCEECCCCCCCCCHHHHHCCCEEEEEEEECCCHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCCCCCCCCC
T ss_conf             33341354100173222441145526760599999838978843455302576675389996159754564301468760


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEEEECC-----
Q ss_conf             246799999998741078644687389998531102785223566777798762595022541213320044088-----
Q gi|254780784|r  397 REIGHGRLARRAIHPVLPQTAQFPYTLRIVSEITESDGSSSMATVCGSSLALMDAGVPISKPVAGIAMGLVKDGD-----  471 (699)
Q Consensus       397 REiGHg~la~ral~~~~P~~~~~p~tirv~~evl~sngsssma~vc~~slal~dagvp~~~~VaGiamGLi~~~~-----  471 (699)
T Consensus       444 RE~GhgaLAEkaL~~vlP--~dfPftIRv~SeVleSnGSsSMASvCGGslALmDaGvPv~a~vAGVaiGlvt~td~e~g~  521 (760)
T KOG1067         444 RELGHGALAEKALLPVLP--EDFPFTIRVTSEVLESNGSSSMASVCGGSLALMDAGVPVSAHVAGVAIGLVTKTDPEKGE  521 (760)
T ss_pred             CCCCCHHHHHHHHHCCCC--CCCCEEEEEEEEEEECCCCCHHHHHHCCHHHHHHCCCCCCCCCCEEEEEEEECCCCCCCC
T ss_conf             004751676644302385--458637997536640589516776635216554169842132130578767614755477


Q ss_pred             --EEEEEEECCCCCCCCCCCCEEEEECCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             --289986314422013655100100556512443245365568899999999999999999999984356674332244
Q gi|254780784|r  472 --DFIILSDISGDEDHLGHMDFKVAGTDSGITAMQMDMKIGGISENIMVMALQQAKRGRLHILNEMSKVLSESRLQLGEF  549 (699)
Q Consensus       472 --~~~iLtDI~G~ED~~GdMDFKvaGT~~GiTa~QmDiK~~gi~~~il~~al~~A~~gr~~il~~m~~~~~~~~~~~~~~  549 (699)
T Consensus       522 i~dyriltDIlGiEd~~GDMDFKiAGt~dGvTA~-------gi~l~Iv~eal~~a~~ar~~Il~~m~k~i~~Pr~s~~~y  594 (760)
T KOG1067         522 IEDYRILTDILGIEDYNGDMDFKIAGTNDGVTAL-------GIPLKIVMEALQKAREARLQILDIMEKNINSPRGSDKEY  594 (760)
T ss_pred             CCCCEEEHHHCCHHHHCCCCCEEECCCCCCCEEC-------CCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             6661431033044541687420320456761132-------774899999987616889999999985268866675345


Q ss_pred             CCEEEEEEECCCCEEEEECCCCHHHHHHHHHHCCEEEEECCEEEEEEECCHHHHHHHHHHHHHHCCC-----CCCCCEEE
Q ss_conf             8757999977115000037860779989998688899808808999968989999999999985247-----54686789
Q gi|254780784|r  550 TPRVEIMAIPPDQIRNVIGMGGKVIRGIVEQTGAKVNIDDDGTVKIASSSLAEIEAAREMIRSITDV-----PEVNKIYK  624 (699)
Q Consensus       550 ap~~~~~~i~~~ki~~~iG~gG~~ik~i~~~~~~~i~i~d~g~v~i~~~~~~~~~~a~~~i~~~~~~-----~e~g~~y~  624 (699)
T Consensus       595 ~P~~~tlkv~~sk~~~lIGp~G~~~kki~~EtG-ai~~vDe~t~~i~A~~~~am~~Ak~~I~~i~~~~~~~~l~~g~vyt  673 (760)
T KOG1067         595 SPVLETLKVSPSKRATLIGPGGVLKKKIEVETG-AISQVDEGTFSIFAPTQAAMEEAKEFIDGIIKDDQVQDLEFGGVYT  673 (760)
T ss_pred             CCEEEEEEECCHHHHEEECCCCCEEEEEEEECC-CEEEECCCEEEEEECCHHHHHHHHHHHHHHHCCCCCCCEEEEEEEE
T ss_conf             750357862603421021676512346764035-2244427557997068889999999988773476535258601777


Q ss_pred             EEEEEEEECCEEEECCCCCCEEEEEEECCCCCCCCHHHHCCCCCEEEEEEEEECCCCCEEEEEEECCCCCCCC
Q ss_conf             9999994153699828797104886631444547855603259889999997868998666873047787899
Q gi|254780784|r  625 GQVVKVMDFGAFVHFCGARDGLVHISQLSTERVAKTSDVVKEGDTVWVKLLDFDDRGKIKLSMKVVDQNTGKP  697 (699)
Q Consensus       625 ~~v~~i~~fGafve~~~g~~gl~HiS~l~~~~v~~~~d~~~~Gd~i~vk~~~~d~~g~i~lSrk~~~~~~~~~  697 (699)
T Consensus       674 ~tIte~rd~G~~V~l~p~~~~Llh~sqL~~e~iakpsd~levGq~I~vk~ie~d~~g~~~ls~ralLp~p~~~  746 (760)
T KOG1067         674 ATITEIRDTGVMVELYPMQQGLLHNSQLDQEKIAKPSDLLEVGQEIQVKYIERDPRGGIMLSSRALLPDPATK  746 (760)
T ss_pred             EEEEEECCCCEEEEECCCCHHHCCCHHCCCCCCCCHHHHHHHCCEEEEEEEEECCCCCEEEHHHHHCCCCCCC
T ss_conf             8886641563599956874100000011512005857887520406889986657666210126526895447