HHsearch alignment for GI: 254780784 and conserved domain: KOG1067

>KOG1067 consensus.
Probab=99.64  E-value=5e-15  Score=140.89  Aligned_cols=194  Identities=21%  Similarity=0.385  Sum_probs=160.2

Q ss_pred             EEEEEEECEECCCCCCEEEEEECCCEEEEEEEECCC-----------CCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCC
Q ss_conf             899999140045467289999789489999972788-----------887777354068665232013367888735789
Q gi|254780784|r   14 RPLKLETGRIARQSDGAVLATYGETVVLATVVYDRS-----------LKDGQDFFPLTVNYQERTYAVGKIPGGYLRRES   82 (699)
Q Consensus        14 r~i~~ETGklArqA~GsV~v~~G~T~VLaTv~~~~~-----------~~~~~dFfPLtVdY~Ek~yAaGkIPGgF~kREg   82 (699)
T Consensus       369 R~I~ce~~m~~~-lHGSaLFqRGqTQvlctVtl~s~e~a~klD~l~~~~~~~~F---mLhY~FPPyat~Evg-----kig  439 (760)
T KOG1067         369 RNISCEVDMLKT-LHGSALFQRGQTQVLCTVTLDSLESAQKLDSLIGPDNGINF---MLHYEFPPYATNEVG-----KIG  439 (760)
T ss_pred             CCCCEECCCCCC-CCCHHHHHCCCEEEEEEEECCCHHHHHHHHHHCCCCCCCEE---EEEECCCCCCCCCCC-----CCC
T ss_conf             354100173222-44114552676059999983897884345530257667538---999615975456430-----146


Q ss_pred             CCCHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEEC---CC
Q ss_conf             887145311112321267767468868837899998218888778999999999987326882354112355204---77
Q gi|254780784|r   83 RPTENEILISRMIDRSIRPLFSKCYKNETQVIINVMQHDLESSPHVVSMVAASAALMLSGLPFEGPVVGAQVDYI---NG  159 (699)
Q Consensus        83 rpsd~EiL~sRlIDR~lRPLFPkgf~~evQIv~~VLS~D~~~dpdvlAi~aASaAL~ISdIPf~GPVaaVRVG~i---dg  159 (699)
T Consensus       440 ~~nRRE~GhgaLAEkaL~~vlP~dfPftIRv~SeVleSnGSsS--MASvCGGslALmDaGvPv~a~vAGVaiGlvt~td~  517 (760)
T KOG1067         440 GLNRRELGHGALAEKALLPVLPEDFPFTIRVTSEVLESNGSSS--MASVCGGSLALMDAGVPVSAHVAGVAIGLVTKTDP  517 (760)
T ss_pred             CCCCCCCCCHHHHHHHHHCCCCCCCCEEEEEEEEEEECCCCCH--HHHHHCCHHHHHHCCCCCCCCCCEEEEEEEECCCC
T ss_conf             8760004751676644302385458637997536640589516--77663521655416984213213057876761475


Q ss_pred             C------EEECCC---CCCCCCCCEEEEEECCCCHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             3------243685---000222101355305443233312444324899998875316889999999999999
Q gi|254780784|r  160 Q------YVLNPR---LDEDQGSLDLFVSGTQDAVLMVELEANQLSEDVVLDAIIFGHNECKPVIEAISKLAK  223 (699)
Q Consensus       160 e------~ViNPt---~ee~esdLDLvVAGT~d~IlMIE~~A~EVsEe~mleAI~~Ahe~Ik~iI~~Q~eL~~  223 (699)
T Consensus       518 e~g~i~dyriltDIlGiEd~~GDMDFKiAGt~dGvTA~-----gi~l~Iv~eal~~a~~ar~~Il~~m~k~i~  585 (760)
T KOG1067         518 EKGEIEDYRILTDILGIEDYNGDMDFKIAGTNDGVTAL-----GIPLKIVMEALQKAREARLQILDIMEKNIN  585 (760)
T ss_pred             CCCCCCCCEEEHHHCCHHHHCCCCCEEECCCCCCCEEC-----CCCHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             54776661431033044541687420320456761132-----774899999987616889999999985268