>cd04465 S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain.While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 2 of the Escherichia coli and Homo sapiens RPS1 (ec2 and hs2, respectively). Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.

Probab=98.19 E-value=1e-05 Score=65.16 Aligned_cols=66 Identities=23% Similarity=0.357 Sum_probs=61.8 Q ss_pred CCEEEEEEEEEEECCEEEECCCCCCEEEEEEECCCCCCCCHHHHCCCCCEEEEEEEEECC-CCCEEEEEE Q ss_conf 867899999994153699828797104886631444547855603259889999997868-998666873 Q gi|254780784|r 620 NKIYKGQVVKVMDFGAFVHFCGARDGLVHISQLSTERVAKTSDVVKEGDTVWVKLLDFDD-RGKIKLSMK 688 (699) Q Consensus 620 g~~y~~~v~~i~~fGafve~~~g~~gl~HiS~l~~~~v~~~~d~~~~Gd~i~vk~~~~d~-~g~i~lSrk 688 (699) T Consensus 1 g~~v~g~I~~~~kGG~~v~~-~gv~~FiP~Sq~~~~~~~~~~~~--vG~~i~~~Ii~~d~~~~~ivvSrk 67 (67) T cd04465 1 GEIVEGKVTEKVKGGLIVDI-EGVRAFLPASQVDLRPVEDLDEY--VGKELKFKIIEIDRERNNIVLSRR 67 (67) T ss_pred CCEEEEEEEEEECCCEEEEE-CCEEEEEECHHCCCCCCCCHHHH--CCCEEEEEEEEEECCCCEEEEECC T ss_conf 99999999999857199999-99999988025255456896897--899899999999278899999879

HHsearch alignment for GI: 254780784 and conserved domain: cd04465