HHsearch alignment for GI: 254780784 and conserved domain: cd05684

>cd05684 S1_DHX8_helicase S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide. The DEAH-box RNA helicases are thought to play key roles in pre-mRNA splicing and DHX8 facilitates nuclear export of spliced mRNA by releasing the RNA from the spliceosome. DHX8 is also known as HRH1 (human RNA helicase 1) in Homo sapiens and PRP22 in Saccharomyces cerevisiae.
Probab=99.69  E-value=9.4e-17  Score=154.94  Aligned_cols=75  Identities=63%  Similarity=0.941  Sum_probs=70.5

Q ss_pred             CCEEEEEEEEEEECCEEEECC---CCCCEEEEEEECCCC-CCCCHHHHCCCCCEEEEEEEEECCCCCEEEEEEECCCCCC
Q ss_conf             867899999994153699828---797104886631444-5478556032598899999978689986668730477878
Q gi|254780784|r  620 NKIYKGQVVKVMDFGAFVHFC---GARDGLVHISQLSTE-RVAKTSDVVKEGDTVWVKLLDFDDRGKIKLSMKVVDQNTG  695 (699)
Q Consensus       620 g~~y~~~v~~i~~fGafve~~---~g~~gl~HiS~l~~~-~v~~~~d~~~~Gd~i~vk~~~~d~~g~i~lSrk~~~~~~~  695 (699)
T Consensus         1 G~i~~G~V~~i~~fGaFV~l~~~~~~~~GLvHiSeis~~~~~~~~~~~~~~G~~V~vkVi~id-~~ki~LS~K~~~~~~G   79 (79)
T cd05684           1 GKIYKGKVTSIMDFGCFVQLEGLKGRKEGLVHISQLSFEGRVANPSDVVKRGQKVKVKVISIQ-NGKISLSMKDVDQDTG   79 (79)
T ss_pred             CCEEEEEEEEEEEEEEEEEEECCCCCCEEEEEHHHCCCCCCCCCHHHHCCCCCEEEEEEEEEE-CCEEEEEEEECCCCCC
T ss_conf             999999998997533999996788980678995681575555898893679999999999986-9988872261346799