>cd05690 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 5 (ec5) of the Escherichia coli RPS1. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.

Probab=99.48 E-value=1.1e-13 Score=130.14 Aligned_cols=66 Identities=39% Similarity=0.655 Sum_probs=62.5 Q ss_pred CCEEEEEEEEEEECCEEEECCCCCCEEEEEEECCC-CCCCCHHHHCCCCCEEEEEEEEECC-CCCEEE Q ss_conf 86789999999415369982879710488663144-4547855603259889999997868-998666 Q gi|254780784|r 620 NKIYKGQVVKVMDFGAFVHFCGARDGLVHISQLST-ERVAKTSDVVKEGDTVWVKLLDFDD-RGKIKL 685 (699) Q Consensus 620 g~~y~~~v~~i~~fGafve~~~g~~gl~HiS~l~~-~~v~~~~d~~~~Gd~i~vk~~~~d~-~g~i~l 685 (699) T Consensus 1 G~~v~G~V~~i~~fG~FV~l~~gieGLvHiselsw~~~~~~~~~~~~~Gd~V~vkVl~iD~e~~risL 68 (69) T cd05690 1 GTVVSGKIKSITDFGIFVGLDGGIDGLVHISDISWTQRVRHPSEIYKKGQEVEAVVLNIDVERERISL 68 (69) T ss_pred CCEEEEEEEEECCCEEEEEECCCCEEEEEHHHHCCCCCCCCHHHCCCCCCEEEEEEEEEECCCCEECC T ss_conf 99999999999131899997699659999488245666679768258999999999999798688638

HHsearch alignment for GI: 254780784 and conserved domain: cd05690