>cd05691 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 6 (ec6) of the Escherichia coli RPS1. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.

Probab=99.49 E-value=1e-13 Score=130.24 Aligned_cols=72 Identities=32% Similarity=0.469 Sum_probs=69.3 Q ss_pred CCEEEEEEEEEEECCEEEECCCCCCEEEEEEECCCCCCCCHHHHCCCCCEEEEEEEEECC-CCCEEEEEEECC Q ss_conf 867899999994153699828797104886631444547855603259889999997868-998666873047 Q gi|254780784|r 620 NKIYKGQVVKVMDFGAFVHFCGARDGLVHISQLSTERVAKTSDVVKEGDTVWVKLLDFDD-RGKIKLSMKVVD 691 (699) Q Consensus 620 g~~y~~~v~~i~~fGafve~~~g~~gl~HiS~l~~~~v~~~~d~~~~Gd~i~vk~~~~d~-~g~i~lSrk~~~ 691 (699) T Consensus 1 G~iV~G~V~~i~~~G~fV~l~~~v~G~ih~sels~~~~~~~~~~~~vGd~v~akIi~iD~~~~ri~LSiKalE 73 (73) T cd05691 1 GSIVTGKVTEVDAKGATVKLGDGVEGFLRAAELSRDRVEDATERFKVGDEVEAKITNVDRKNRKISLSIKAKE 73 (73) T ss_pred CCEEEEEEEEEECCCEEEEECCCCEEEEEHHHCCCCHHHCHHHCCCCCCEEEEEEEEEECCCCEEEEEEEECC T ss_conf 9999999999977868999289969999989978211329254389999999999999788999986742459

HHsearch alignment for GI: 254780784 and conserved domain: cd05691