>cd05693 S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 1 (hs1) and S. cerevisiae S1 repeat 1 (sc1). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.

Probab=96.59 E-value=0.0064 Score=42.42 Aligned_cols=71 Identities=23% Similarity=0.393 Sum_probs=59.1 Q ss_pred CCCCEEEEEEEEEEECCEEEECCCCCCEEEEEEECCCCCC-------------------CCHHHHCCCCCEEEEEEEEEC Q ss_conf 4686789999999415369982879710488663144454-------------------785560325988999999786 Q gi|254780784|r 618 EVNKIYKGQVVKVMDFGAFVHFCGARDGLVHISQLSTERV-------------------AKTSDVVKEGDTVWVKLLDFD 678 (699) Q Consensus 618 e~g~~y~~~v~~i~~fGafve~~~g~~gl~HiS~l~~~~v-------------------~~~~d~~~~Gd~i~vk~~~~d 678 (699) T Consensus 2 ~~G~lvLG~V~~I~~~~l~isLP~~L~G~V~it~ISd~~t~~le~~~~~~~~~~~~~e~~~L~~lF~vGq~vr~~V~s~~ 81 (100) T cd05693 2 SEGMLVLGQVKEITKLDLVISLPNGLTGYVPITNISDAYTERLEELDEESEEEDDEEELPDLEDLFSVGQLVRCKVVSLD 81 (100) T ss_pred CCCCEEEEEEEEECCCCEEEECCCCCEEEEEHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHCCCCCEEEEEEEECC T ss_conf 88989999998984663899858985899887885299999999987300236763234587884768989999999845 Q ss_pred CC--C--CEEEEEE Q ss_conf 89--9--8666873 Q gi|254780784|r 679 DR--G--KIKLSMK 688 (699) Q Consensus 679 ~~--g--~i~lSrk 688 (699) T Consensus 82 ~~~~~~krI~LSl~ 95 (100) T cd05693 82 KSKSGKKRIELSLE 95 (100) T ss_pred CCCCCCEEEEEECC T ss_conf 88778548999828

HHsearch alignment for GI: 254780784 and conserved domain: cd05693