>cd05694 S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 2 (hs2) and S. cerevisiae S1 repeat 2 (sc2). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.

Probab=95.56 E-value=0.1 Score=32.72 Aligned_cols=67 Identities=18% Similarity=0.234 Sum_probs=55.2 Q ss_pred CCCCCCEEEEEEEEEEECCEEEEC-CCCCCEEEEEEECCCCCCCCHHHHCCCCCEEEEEEEEECCCCCE-EEEEE Q ss_conf 754686789999999415369982-87971048866314445478556032598899999978689986-66873 Q gi|254780784|r 616 VPEVNKIYKGQVVKVMDFGAFVHF-CGARDGLVHISQLSTERVAKTSDVVKEGDTVWVKLLDFDDRGKI-KLSMK 688 (699) Q Consensus 616 ~~e~g~~y~~~v~~i~~fGafve~-~~g~~gl~HiS~l~~~~v~~~~d~~~~Gd~i~vk~~~~d~~g~i-~lSrk 688 (699) T Consensus 1 dl~~g~~l~a~V~SvEDHGyild~Gi~~~~gFl~~k~~~~~------~~l~~G~v~~c~V~~v~~~g~vv~ls~~ 69 (74) T cd05694 1 DLVEGMVLSGCVSSVEDHGYILDIGIPGTTGFLPKKDAGNF------SKLKVGQLLLCVVEKVKDDGRVVSLSAD 69 (74) T ss_pred CCCCCCEEEEEEEEEECCEEEEECCCCCCEEEEEHHHCCCC------CCCCCCCEEEEEEEEEECCCEEEEEECC T ss_conf 96678299999856714418998477772667301334755------6334887899999999289609999668

HHsearch alignment for GI: 254780784 and conserved domain: cd05694