>cd05695 S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 3 (hs3). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.

Probab=95.13 E-value=0.092 Score=33.03 Aligned_cols=65 Identities=26% Similarity=0.401 Sum_probs=55.0 Q ss_pred CCEEEEEEEEEEECCEEEECCCCCCEEEEEEECCCCCCCCHHHHCCCCCEEEEEEEEECCC-CCEEEE Q ss_conf 8678999999941536998287971048866314445478556032598899999978689-986668 Q gi|254780784|r 620 NKIYKGQVVKVMDFGAFVHFCGARDGLVHISQLSTERVAKTSDVVKEGDTVWVKLLDFDDR-GKIKLS 686 (699) Q Consensus 620 g~~y~~~v~~i~~fGafve~~~g~~gl~HiS~l~~~~v~~~~d~~~~Gd~i~vk~~~~d~~-g~i~lS 686 (699) T Consensus 1 GmlV~a~V~kV~~~Gl~~~fl~~F~G~Vd~~HL~~~~--~~~~~Y~~~~~v~ArIL~Vdp~tK~V~Ls 66 (66) T cd05695 1 GMLVNARVKKVLSNGLILDFLSSFTGTVDFLHLDPEK--SSKSTYKEGQKVRARILYVDPSTKVVGLS 66 (66) T ss_pred CCEEEEEEEEECCCCEEEEEECCEEEEEEHHHCCCCC--CCCCCCCCCCEEEEEEEEECCCCCEEECC T ss_conf 9559999999817948999651289998876768776--87000467988999999998874788539

HHsearch alignment for GI: 254780784 and conserved domain: cd05695