HHsearch alignment for GI: 254780784 and conserved domain: cd05697

>cd05697 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 5 (hs5) and S. cerevisiae S1 repeat 5 (sc5). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=99.34  E-value=3.1e-12  Score=118.16  Aligned_cols=68  Identities=25%  Similarity=0.404  Sum_probs=65.8

Q ss_pred             CCEEEEEEEEEEECCEEEECCCCCCEEEEEEECCCCCCCCHHHHCCCCCEEEEEEEEECC-CCCEEEEE
Q ss_conf             867899999994153699828797104886631444547855603259889999997868-99866687
Q gi|254780784|r  620 NKIYKGQVVKVMDFGAFVHFCGARDGLVHISQLSTERVAKTSDVVKEGDTVWVKLLDFDD-RGKIKLSM  687 (699)
Q Consensus       620 g~~y~~~v~~i~~fGafve~~~g~~gl~HiS~l~~~~v~~~~d~~~~Gd~i~vk~~~~d~-~g~i~lSr  687 (699)
T Consensus         1 G~iv~G~V~~i~~fG~fV~l~~~i~Glv~~s~lsd~~v~~p~~~fk~G~~Vk~rVl~vD~~~~ri~LSl   69 (69)
T cd05697           1 GQVVKGTIRKLRPSGIFVKLSDHIKGLVPPMHLADVRLKHPEKKFKPGLKVKCRVLSVEPERKRLVLTL   69 (69)
T ss_pred             CCEEEEEEEEECCCEEEEEECCCEEEEEEHHHHCCCCCCCHHHCCCCCCEEEEEEEEEECCCCEEEEEC
T ss_conf             999999999973842799957990699878990865206988908999999999999948879988659