>cd05708 S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes S. cerevisiae S1 repeat 12 (sc12). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.

Probab=99.60 E-value=3.7e-15 Score=142.02 Aligned_cols=73 Identities=34% Similarity=0.574 Sum_probs=69.9 Q ss_pred CCCCEEEEEEEEEEECCEEEECC-CCCCEEEEEEECCCCCCCCHHHHCCCCCEEEEEEEEECC-CCCEEEEEEEC Q ss_conf 46867899999994153699828-797104886631444547855603259889999997868-99866687304 Q gi|254780784|r 618 EVNKIYKGQVVKVMDFGAFVHFC-GARDGLVHISQLSTERVAKTSDVVKEGDTVWVKLLDFDD-RGKIKLSMKVV 690 (699) Q Consensus 618 e~g~~y~~~v~~i~~fGafve~~-~g~~gl~HiS~l~~~~v~~~~d~~~~Gd~i~vk~~~~d~-~g~i~lSrk~~ 690 (699) T Consensus 1 kVG~~v~G~V~~i~~fG~FV~l~g~~i~GLvHiSels~~~~~~~~~~~~~Gd~V~vkVl~iD~e~~rI~LSiKa~ 75 (77) T cd05708 1 KVGQKIDGTVRRVEDYGVFIDIDGTNVSGLCHKSEISDNRVADASKLFRVGDKVRAKVLKIDAEKKRISLGLKAS 75 (77) T ss_pred CCCCEEEEEEEEEECEEEEEEECCCCEEEEEEHHHHCCCCCCCHHHHCCCCCEEEEEEEEEECCCCEEEEEEECC T ss_conf 998999999999964178999678980799887881756568988916899999999999989999999898415

HHsearch alignment for GI: 254780784 and conserved domain: cd05708