>pfam03725 RNase_PH_C 3' exoribonuclease family, domain 2. This family includes 3'-5' exoribonucleases. Ribonuclease PH contains a single copy of this domain, and removes nucleotide residues following the -CCA terminus of tRNA. Polyribonucleotide nucleotidyltransferase (PNPase) contains two tandem copies of the domain. PNPase is involved in mRNA degradation in a 3'-5' direction. The exosome is a 3'-5' exoribonuclease complex that is required for 3' processing of the 5.8S rRNA. Three of its five protein components contain a copy of this domain. A hypothetical protein from S. pombe appears to belong to an uncharacterized subfamily. This subfamily is found in both eukaryotes and archaebacteria.

Probab=97.08 E-value=0.00094 Score=49.22 Aligned_cols=65 Identities=29% Similarity=0.468 Sum_probs=55.6 Q ss_pred CCCCEEEEEEEEECCEEEEEEECCCCCCCCC--CCCEEEEECCCCCEEEECCCCCCCCCHHHHHHHHHHHHHH Q ss_conf 5412133200440882899863144220136--5510010055651244324536556889999999999999 Q gi|254780784|r 457 KPVAGIAMGLVKDGDDFIILSDISGDEDHLG--HMDFKVAGTDSGITAMQMDMKIGGISENIMVMALQQAKRG 527 (699) Q Consensus 457 ~~VaGiamGLi~~~~~~~iLtDI~G~ED~~G--dMDFKvaGT~~GiTa~QmDiK~~gi~~~il~~al~~A~~g 527 (699) T Consensus 1 ~~v~avtvg~i---~~~-~i~dpt~~Ee~~~~~~l~v~~~~~~~~v~~~~~g~~--~l~~~~l~~~l~~a~~~ 67 (67) T pfam03725 1 GPVAAVTVGKI---DGE-LVLDPTLEEESLADSDLTIVVAGTGDIVALMKEGGG--GLTEEELLEALELAHKG 67 (67) T ss_pred CCEEEEEEEEE---CCE-EEECCCHHHHHHHCCEEEEEEECCCCEEEEECCCCC--CCCHHHHHHHHHHHCCC T ss_conf 98899999999---999-999989678633147368999689999999918997--85999999999987079

HHsearch alignment for GI: 254780784 and conserved domain: pfam03725