RPSBLAST alignment for GI: 254780784 and conserved domain: TIGR00717

>gnl|CDD|162009 TIGR00717, rpsA, ribosomal protein S1. This model provides trusted hits to most long form (6 repeat) examples of RpsA. Among homologs with only four repeats are some to which other (perhaps secondary) functions have been assigned. Length = 516
 Score = 47.4 bits (113), Expect = 1e-05
 Identities = 25/72 (34%), Positives = 40/72 (55%), Gaps = 2/72 (2%)

Query: 619 VNKIYKGQVVKVMDFGAFVHFCGARDGLVHISQLSTERVAKTSDVVKE-GDTVWVKLLDF 677
           V     G++ K+ DFGAFV   G  DGL+H+S +S ++  + +D + + GD +   +L  
Sbjct: 359 VGDRVTGKIKKITDFGAFVELEGGIDGLIHLSDISWDKDGREADHLYKKGDEIEAVVLAV 418

Query: 678 DDRGK-IKLSMK 688
           D   K I L +K
Sbjct: 419 DKEKKRISLGVK 430