RPSBLAST alignment for GI: 254780784 and conserved domain: COG1098

>gnl|CDD|31295 COG1098, VacB, Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis]. Length = 129
 Score = 75.3 bits (185), Expect = 6e-14
 Identities = 30/81 (37%), Positives = 47/81 (58%)

Query: 617 PEVNKIYKGQVVKVMDFGAFVHFCGARDGLVHISQLSTERVAKTSDVVKEGDTVWVKLLD 676
            +V    KG++  +  +GAFV   G + GLVHIS+++   V    D +K G  V VK+LD
Sbjct: 3   MKVGSKLKGKITGITPYGAFVELEGGKTGLVHISEIADGFVKDIHDHLKVGQEVKVKVLD 62

Query: 677 FDDRGKIKLSMKVVDQNTGKP 697
            D+ GKI LS++ +++   K 
Sbjct: 63  IDENGKISLSIRKLEEEPEKQ 83