RPSBLAST alignment for GI: 254780784 and conserved domain: cd05689
>gnl|CDD|88444 cd05689, S1_RPS1_repeat_ec4, S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 4 (ec4) of the Escherichia coli RPS1. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.. Length = 72
Score = 41.2 bits (96), Expect = 0.001
Identities = 27/71 (38%), Positives = 41/71 (57%), Gaps = 3/71 (4%)
Query: 617 PEVNKIYKGQVVKVMDFGAFVHFCGARDGLVHISQLS-TERVAKTSDVVKEGDTVWVKLL 675
PE +++ G+V + D+G FV +GLVH+S++ T + S VV GD V V +L
Sbjct: 2 PEGTRLF-GKVTNLTDYGCFVELEEGVEGLVHVSEMDWTNKNIHPSKVVSLGDEVEVMVL 60
Query: 676 DFD-DRGKIKL 685
D D +R +I L
Sbjct: 61 DIDEERRRISL 71