RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780786|ref|YP_003065199.1| ribosome-binding factor A [Candidatus Liberibacter asiaticus str. psy62] (128 letters) >gnl|CDD|145292 pfam02033, RBFA, Ribosome-binding factor A. Length = 104 Score = 81.0 bits (201), Expect = 8e-17 Identities = 36/98 (36%), Positives = 54/98 (55%), Gaps = 5/98 (5%) Query: 11 RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS-LPLDVSPD 69 R RV E ++ L ++ E +D + ++++EV +S DL A VY+S L + + Sbjct: 1 RTERVAELIQRELAEILQR-ELKDPRLGL--VTVTEVEVSPDLSHAKVYVSVLGDEEEKE 57 Query: 70 RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSL 107 + ALN FIR + + LR LRY PELRF YD S+ Sbjct: 58 ETLKALNKAAGFIRSELAKRLR-LRYTPELRFVYDDSI 94 >gnl|CDD|31199 COG0858, RbfA, Ribosome-binding factor A [Translation, ribosomal structure and biogenesis]. Length = 118 Score = 69.5 bits (170), Expect = 3e-13 Identities = 41/112 (36%), Positives = 65/112 (58%), Gaps = 6/112 (5%) Query: 7 KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS-LPLD 65 S RA RV E+++ L IL E +D + +++++V +S DL A VY++ L + Sbjct: 2 AKSTRAKRVAEQIQKELA-EILQREIKDPRLGL--VTVTDVEVSKDLSHAKVYVTVLGDE 58 Query: 66 VSP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL 116 S +++ALN FIR +G+ LR LR PEL F YD S+++ K++AL Sbjct: 59 ESSKAEILAALNKAKGFIRSELGKRLR-LRKTPELHFVYDDSIENGNKIDAL 109 >gnl|CDD|132860 cd07221, Pat_PNPLA3, Patatin-like phospholipase domain containing protein 3. PNPLA3 is a triacylglycerol lipase that mediates triacylglycerol hydrolysis in adipocytes and is an indicator of the nutritional state. PNPLA3 is also known as adiponutrin (ADPN) or iPLA2-epsilon. Human adiponutrins are bound to the cell membrane of adipocytes and show transacylase, TG hydrolase, and PLA2 activity. This family includes patatin-like proteins: ADPN (adiponutrin) from mammals, PNPLA3 (Patatin-like phospholipase domain-containing protein 3), and iPLA2-epsilon (Calcium-independent phospholipase A2) from Homo sapiens. Length = 252 Score = 28.2 bits (63), Expect = 0.67 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Query: 67 SPDRVISALNCN--IKFIRGRIGRSLRNLRYV 96 S D V+ AL C+ I F G I S R +RYV Sbjct: 127 SKDEVVDALVCSCFIPFFSGLIPPSFRGVRYV 158 >gnl|CDD|143435 cd07117, ALDH_StaphAldA1, Uncharacterized Staphylococcus aureus AldA1 (SACOL0154) aldehyde dehydrogenase-like. Uncharacterized aldehyde dehydrogenase from Staphylococcus aureus (AldA1, locus SACOL0154) and other similar sequences are present in this CD. Length = 475 Score = 27.8 bits (62), Expect = 0.81 Identities = 10/26 (38%), Positives = 14/26 (53%) Query: 7 KNSRRALRVGEEVRSALMWVILNNEF 32 K+ RALRV V + +WV N+ Sbjct: 414 KDINRALRVARAVETGRVWVNTYNQI 439 >gnl|CDD|143412 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogenase family 8 member A1-like. In humans, the aldehyde dehydrogenase family 8 member A1 (ALDH8A1) protein functions to convert 9-cis-retinal to 9-cis-retinoic acid and has a preference for NAD+. Also included in this CD is the 2-hydroxymuconic semialdehyde dehydrogenase (HMSADH) which catalyzes the conversion of 2-hydroxymuconic semialdehyde to 4-oxalocrotonate, a step in the meta cleavage pathway of aromatic hydrocarbons in bacteria. Such HMSADHs seen here are: XylG of the TOL plasmid pWW0 of Pseudomonas putida, TomC of Burkholderia cepacia G4, and AphC of Comamonas testosterone. Length = 455 Score = 26.4 bits (59), Expect = 2.4 Identities = 6/19 (31%), Positives = 10/19 (52%) Query: 8 NSRRALRVGEEVRSALMWV 26 + RA RV + + +WV Sbjct: 397 DLGRAHRVARRLEAGTVWV 415 >gnl|CDD|143471 cd07559, ALDH_ACDHII_AcoD-like, Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II and Staphylococcus aureus AldA1 (SACOL0154)-like. Included in this CD is the NAD+-dependent, acetaldehyde dehydrogenase II (AcDHII, AcoD, EC=1.2.1.3) from Ralstonia (Alcaligenes) eutrophus H16 involved in the catabolism of acetoin and ethanol, and similar proteins, such as, the dimeric dihydrolipoamide dehydrogenase of the acetoin dehydrogenase enzyme system of Klebsiella pneumonia. Also included are sequences similar to the NAD+-dependent chloroacetaldehyde dehydrogenases (AldA and AldB) of Xanthobacter autotrophicus GJ10 which are involved in the degradation of 1,2-dichloroethane, as well as, the uncharacterized aldehyde dehydrogenase from Staphylococcus aureus (AldA1, locus SACOL0154) and other similar sequences. Length = 480 Score = 25.8 bits (57), Expect = 3.8 Identities = 7/20 (35%), Positives = 13/20 (65%) Query: 7 KNSRRALRVGEEVRSALMWV 26 ++ RALRV +++ +WV Sbjct: 419 RDINRALRVARGIQTGRVWV 438 >gnl|CDD|111092 pfam02160, Peptidase_A3, Cauliflower mosaic virus peptidase (A3). Length = 201 Score = 25.2 bits (55), Expect = 5.9 Identities = 7/32 (21%), Positives = 19/32 (59%) Query: 25 WVILNNEFQDRLISRDVISISEVCMSVDLRVA 56 W + ++ + +I+I++VC ++ L++A Sbjct: 44 WENAKKPIEVKIANGSIITITKVCSNLFLKIA 75 >gnl|CDD|31374 COG1181, DdlA, D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane]. Length = 317 Score = 24.9 bits (54), Expect = 7.5 Identities = 13/44 (29%), Positives = 20/44 (45%), Gaps = 7/44 (15%) Query: 61 SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYD 104 PL V P R S++ + + G +L+ EL F+YD Sbjct: 142 GFPLFVKPAREGSSVGRSPVNVEG-------DLQSALELAFKYD 178 >gnl|CDD|143432 cd07114, ALDH_DhaS, Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like. Uncharacterized aldehyde dehydrogenase from Candidatus pelagibacter (DhaS) and other related sequences are present in this CD. Length = 457 Score = 24.4 bits (54), Expect = 8.5 Identities = 6/20 (30%), Positives = 11/20 (55%) Query: 7 KNSRRALRVGEEVRSALMWV 26 ++ RA RV + + +WV Sbjct: 398 RDLARAHRVARAIEAGTVWV 417 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.325 0.138 0.406 Gapped Lambda K H 0.267 0.0637 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,527,456 Number of extensions: 70366 Number of successful extensions: 237 Number of sequences better than 10.0: 1 Number of HSP's gapped: 234 Number of HSP's successfully gapped: 16 Length of query: 128 Length of database: 6,263,737 Length adjustment: 83 Effective length of query: 45 Effective length of database: 4,470,190 Effective search space: 201158550 Effective search space used: 201158550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.0 bits)