HHsearch alignment for GI: 254780787 and conserved domain: PRK10463

>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional.
Probab=96.26  E-value=0.0046  Score=38.88  Aligned_cols=149  Identities=21%  Similarity=0.223  Sum_probs=83.5

Q ss_pred             CCCEEEEEECCCCCHHHHHHHHHHH-------HHHHCC------CCCCE-ECCCEEE--------------------EEC
Q ss_conf             5303898623685044677788642-------221001------23100-0121499--------------------951
Q gi|254780787|r  382 RPPVVTIMGHVDHGKTSLLDAIRKA-------DVAKGE------IGGIT-QHIGAYQ--------------------VAY  427 (884)
Q Consensus       382 R~pvv~v~ghvd~GKt~lld~~r~~-------~~~~~e------~ggit-q~iga~~--------------------~~~  427 (884)
T Consensus       103 gv~~lNl~sSPGSGKTtLLe~ti~~L~~~~~~aVIeGD~~T~~DA~RI~~~Gv~avQInTG~~CHLDA~MV~~al~~l~l  182 (290)
T PRK10463        103 KQLVLNLVSSPGSGKTTLLTETLMRLKDSVPCAVIEGDQQTVNDAARIRATGTPAIQVNTGKGCHLDAQMIADAAPRLPL  182 (290)
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHCCC
T ss_conf             91899930699878899999999987336757999604235667999997699589954799767599999999984898


Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHH
Q ss_conf             78438888516615789998666420680599998366740235777898997099415612331244332000221000
Q gi|254780787|r  428 QGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVSIIVAINKIDKLGADPQKVRMSLL  507 (884)
Q Consensus       428 ~~~~~~~iDtPGh~~f~~~r~rg~~~~d~~ilvv~~~~g~~~qt~e~~~~~~~~~~p~iva~nk~d~~~~~~~~~~~~~~  507 (884)
T Consensus       183 ~~~dllfIENVGNLVCPA~FDLGE---~~kVvvlSVtEGeDKP----lKYP~mF~~ad~vlinKiDLlp~~dFD~~----  251 (290)
T PRK10463        183 DDNGILFIENVGNLVCPASFDLGE---KHKVAVLSVTEGEDKP----LKYPHMFAAASLMLLNKVDLLPYLNFDVE----  251 (290)
T ss_pred             CCCCEEEEECCCCCCCCCCCCCCC---CEEEEEEEECCCCCCC----CCCHHHHHHCCEEEEEHHHHHHHCCCCHH----
T ss_conf             779899981278843551203677---6179999706888864----44766764257899865651220288999----


Q ss_pred             CCCCCCCCCCCCCEEEEEEECCCCCCCCCCCCHH
Q ss_conf             0132000123474036311002477411221000
Q gi|254780787|r  508 KHDVFVESMGGDILDVEISAKNNLNLDKLLDAIL  541 (884)
Q Consensus       508 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  541 (884)
T Consensus       252 ~~~~~~~~vNp~~~v~~vSa~tGeGld~W~~WL~  285 (290)
T PRK10463        252 KCIACAREVNPEIEIILISATSGEGMDQWLNWLE  285 (290)
T ss_pred             HHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHH
T ss_conf             9999999869898589975688878999999999