>cd00154 Rab Rab family. Rab GTPases form the largest family within the Ras superfamily. There are at least 60 Rab genes in the human genome, and a number of Rab GTPases are conserved from yeast to humans. Rab GTPases are small, monomeric proteins that function as molecular switches to regulate vesicle trafficking pathways. The different Rab GTPases are localized to the cytosolic face of specific intracellular membranes, where they regulate distinct steps in membrane traffic pathways. In the GTP-bound form, Rab GTPases recruit specific sets of effector proteins onto membranes. Through their effectors, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide di

Probab=99.31 E-value=2.1e-11 Score=95.93 Aligned_cols=146 Identities=23% Similarity=0.320 Sum_probs=96.6 Q ss_pred EEEEECCCCCHHHHHHHHHHHHHHHCCCCCCEECCCEEEEECCC--CEEEEEECCCHHHHHHHHHHHHHCCCCEEEEEEC Q ss_conf 89862368504467778864222100123100012149995178--4388885166157899986664206805999983 Q gi|254780787|r 386 VTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGAYQVAYQG--KNITFLDTPGHAAFYEMRARGARVTDIAVLVLAA 463 (884) Q Consensus 386 v~v~ghvd~GKt~lld~~r~~~~~~~e~ggitq~iga~~~~~~~--~~~~~iDtPGh~~f~~~r~rg~~~~d~~ilvv~~ 463 (884) T Consensus 3 i~vvG~~~vGKTsli~~~~~~~f~~~~~~Tig~d~~~~~~~~~~~~~~l~iwDt~G~e~~~~l~~~~~~~~d~~ilv~d~ 82 (159) T cd00154 3 IVLIGDSGVGKTSLLLRFVDGKFDENYKSTIGVDFKSKTIEIDGKTVKLQIWDTAGQERFRSITPSYYRGAHGAILVYDI 82 (159) T ss_pred EEEECCCCCCHHHHHHHHHHCCCCCCCCCCCCEEEEEEEEEECCEEEEEEEEECCCCHHHHHHHHHHHHHCCEEEEECCC T ss_conf 99999699689999999970999998488666479999999999999999997898265778899997541275672448 Q ss_pred CCCCCHHHHHHHH----HHHH---CCCCEEEECCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCEEEEEEECCCCCCCCC Q ss_conf 6674023577789----8997---09941561233124433200022100001320001234740363110024774112 Q gi|254780787|r 464 DEEIMPQAIESIN----HAKA---ADVSIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKL 536 (884) Q Consensus 464 ~~g~~~qt~e~~~----~~~~---~~~p~iva~nk~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 536 (884) T Consensus 83 ~~---~~Sf~~~~~~~~~i~~~~~~~~~iilvgnK~DL~~~~~--v~~~~~~--~~a~~~--~~~~~e~SAk~~~~i~~~ 153 (159) T cd00154 83 TN---RESFENLDKWLKELKEYAPENIPIILVGNKIDLEDQRQ--VSTEEAQ--QFAKEN--GLLFFETSAKTGENVEEL 153 (159) T ss_pred CC---HHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCHHCCC--CCHHHHH--HHHHHC--CCEEEEECCCCCCCHHHH T ss_conf 98---89999999999999986898882699997456301168--9999999--999986--997999876888198999 Q ss_pred CCCH Q ss_conf 2100 Q gi|254780787|r 537 LDAI 540 (884) Q Consensus 537 ~~~~ 540 (884) T Consensus 154 F~~i 157 (159) T cd00154 154 FQSL 157 (159) T ss_pred HHHH T ss_conf 9998

HHsearch alignment for GI: 254780787 and conserved domain: cd00154