>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases. Arf proteins are activators of phospholipase D isoforms. Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated. Arfs are N-terminally myristoylated. Members of the Arf family are regulators of vesicle formation in intracellular traffic that interact reversibly with membranes of the secretory and endocytic compartments in a GTP-dependent manner. They depart from other small GTP-binding proteins by a unique structural device, interswitch toggle, that implements front-back communication from N-terminus to the nucleotide binding site. Arf-like (Arl) proteins are close relatives of the Arf, but only Arl1 has been shown to function in membrane traffic like the Arf proteins. Arl2 has an unrelated function in the folding of native tubulin, and Arl4 may function in the nucleus. Most other Arf family proteins are so far relatively poorly characterized. Thu

Probab=99.61 E-value=3.7e-15 Score=121.67 Aligned_cols=150 Identities=21% Similarity=0.230 Sum_probs=104.5 Q ss_pred EEEEECCCCCHHHHHHHHHHHHHHHCCCCCCEECCCEEEEECCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEEECCC Q ss_conf 89862368504467778864222100123100012149995178438888516615789998666420680599998366 Q gi|254780787|r 386 VTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGAYQVAYQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAADE 465 (884) Q Consensus 386 v~v~ghvd~GKt~lld~~r~~~~~~~e~ggitq~iga~~~~~~~~~~~~iDtPGh~~f~~~r~rg~~~~d~~ilvv~~~~ 465 (884) T Consensus 2 i~ilG~~~vGKTsll~~l~~~~~~~~~---pTig~~~~~i~~~~~~l~iwDt~G~~~~~~~~~~y~~~a~~~i~V~D~t~ 78 (158) T cd00878 2 ILILGLDGAGKTTILYKLKLGEVVTTI---PTIGFNVETVEYKNVSFTVWDVGGQDKIRPLWKHYYENTNGIIFVVDSSD 78 (158) T ss_pred EEEECCCCCCHHHHHHHHHCCCCCCCC---CEECCCEEEEEECCEEEEEEECCCCCCCCHHHHHHHCCCCEEEEEEECCC T ss_conf 999999999889999999539988744---56074089998488999999889972214489987276877689983798 Q ss_pred CC-CHHHHHHHH----HHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCCH Q ss_conf 74-023577789----8997099415612331244332000221000013200012347403631100247741122100 Q gi|254780787|r 466 EI-MPQAIESIN----HAKAADVSIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLDAI 540 (884) Q Consensus 466 g~-~~qt~e~~~----~~~~~~~p~iva~nk~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 540 (884) T Consensus 79 ~~s~~~~~~~~~~~~~~~~~~~~piliv~NK~Dl~~~~~~~ei~~~l~---~~~~~~~~~~~~~~SAktg~gI~e~f~~L 155 (158) T cd00878 79 RERIEEAKEELHKLLNEEELKGVPLLIFANKQDLPGALSVSELIEKLG---LEKILGRRWHIQPCSAVTGDGLDEGLDWL 155 (158) T ss_pred HHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCHHHHHHHHH---HHHHCCCCCEEEEEECCCCCCHHHHHHHH T ss_conf 889999999999998660557653898760547665789999999985---87510799899999888792989999999 Q ss_pred H Q ss_conf 0 Q gi|254780787|r 541 L 541 (884) Q Consensus 541 ~ 541 (884) T Consensus 156 ~ 156 (158) T cd00878 156 L 156 (158) T ss_pred H T ss_conf 5

HHsearch alignment for GI: 254780787 and conserved domain: cd00878