>cd01863 Rab18 Rab18 subfamily. Mammalian Rab18 is implicated in endocytic transport and is expressed most highly in polarized epithelial cells. However, trypanosomal Rab, TbRAB18, is upregulated in the BSF (Blood Stream Form) stage and localized predominantly to elements of the Golgi complex. In human and mouse cells, Rab18 has been identified in lipid droplets, organelles that store neutral lipids. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of mos

Probab=99.23 E-value=4.8e-11 Score=93.54 Aligned_cols=149 Identities=19% Similarity=0.228 Sum_probs=98.9 Q ss_pred EEEEECCCCCHHHHHHHHHHHHHHHCCCCCCE--ECCCEEEEECCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEEEC Q ss_conf 89862368504467778864222100123100--0121499951784388885166157899986664206805999983 Q gi|254780787|r 386 VTIMGHVDHGKTSLLDAIRKADVAKGEIGGIT--QHIGAYQVAYQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAA 463 (884) Q Consensus 386 v~v~ghvd~GKt~lld~~r~~~~~~~e~ggit--q~iga~~~~~~~~~~~~iDtPGh~~f~~~r~rg~~~~d~~ilvv~~ 463 (884) T Consensus 3 ivvvG~~~vGKTsli~r~~~~~f~~~~~~ti~~~~~~~~~~~~~~~~~l~iwDt~g~~~~~~~~~~~~~~a~~~ilvfd~ 82 (161) T cd01863 3 ILLIGDSGVGKSSLLLRFTDDTFDPDLAATIGVDFKVKTLTVDGKKVKLAIWDTAGQERFRTLTSSYYRGAQGVILVYDV 82 (161) T ss_pred EEEECCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEEECCEEEEEEEEECCCCCCCCCCHHHHHHHCCEEEEEEEC T ss_conf 99999799579999999963999998487313342389999999999999999999842353422441321534899767 Q ss_pred CCCCCHHHHHHHH-HHH----HCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCEEEEEEECCCCCCCCCCC Q ss_conf 6674023577789-899----70994156123312443320002210000132000123474036311002477411221 Q gi|254780787|r 464 DEEIMPQAIESIN-HAK----AADVSIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLD 538 (884) Q Consensus 464 ~~g~~~qt~e~~~-~~~----~~~~p~iva~nk~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 538 (884) T Consensus 83 ~~~~Sf~~i~~~~~~i~~~~~~~~~~~ilVgnK~D~~~~~---v~~~~~~~--~a~~~--~~~y~e~Sak~g~nV~~~F~ 155 (161) T cd01863 83 TRRDTFTNLETWLNELETYSTNNDIVKMLVGNKIDKENRE---VTREEGLK--FARKH--NMLFIETSAKTRDGVQQAFE 155 (161) T ss_pred CCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCC---CCHHHHHH--HHHHC--CCEEEEECCCCCCCHHHHHH T ss_conf 8265699999999999985688887378873104400068---99999999--99986--99999971586815999999 Q ss_pred CHH Q ss_conf 000 Q gi|254780787|r 539 AIL 541 (884) Q Consensus 539 ~~~ 541 (884) T Consensus 156 ~l~ 158 (161) T cd01863 156 ELV 158 (161) T ss_pred HHH T ss_conf 999

HHsearch alignment for GI: 254780787 and conserved domain: cd01863