>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in every eukaryote and is a key regulatory component for the transport of vesicles from the ER to the Golgi apparatus. Studies on mutations of Ypt1, the yeast homolog of Rab1, showed that this protein is necessary for the budding of vesicles of the ER as well as for their transport to, and fusion with, the Golgi apparatus. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to t

Probab=99.05 E-value=4.3e-10 Score=87.02 Aligned_cols=146 Identities=18% Similarity=0.236 Sum_probs=95.4 Q ss_pred EEEEECCCCCHHHHHHHHHHHHHHHCCCCCCEECCCE------EEEECCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEE Q ss_conf 8986236850446777886422210012310001214------9995178438888516615789998666420680599 Q gi|254780787|r 386 VTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGA------YQVAYQGKNITFLDTPGHAAFYEMRARGARVTDIAVL 459 (884) Q Consensus 386 v~v~ghvd~GKt~lld~~r~~~~~~~e~ggitq~iga------~~~~~~~~~~~~iDtPGh~~f~~~r~rg~~~~d~~il 459 (884) T Consensus 5 iv~vGd~~vGKTsli~r~~~~~f~~~y----~~Tig~~~~~~~i~~~~~~~~l~iwDtaG~e~~~~~~~~~~~~a~~~il 80 (166) T cd01869 5 LLLIGDSGVGKSCLLLRFADDTYTESY----ISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIII 80 (166) T ss_pred EEEECCCCCCHHHHHHHHHCCCCCCCC----CCCCCEEEEEEEEEECCEEEEEEEEECCCCCCCCCCHHHHHHHCCEEEE T ss_conf 999999997899999999439999874----7854404899999999999999999899982346267888563267799 Q ss_pred EEECCCCCCHHHHHHH-HHH---HHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCEEEEEEECCCCCCCC Q ss_conf 9983667402357778-989---970994156123312443320002210000132000123474036311002477411 Q gi|254780787|r 460 VLAADEEIMPQAIESI-NHA---KAADVSIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDK 535 (884) Q Consensus 460 vv~~~~g~~~qt~e~~-~~~---~~~~~p~iva~nk~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 535 (884) T Consensus 81 vfdit~~~Sf~~i~~w~~~i~~~~~~~~~~ilvgNK~DL~~~r--~v~~~~~~--~~a~~~--~~~~~E~SAk~g~nI~e 154 (166) T cd01869 81 VYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTDKR--VVDYSEAQ--EFADEL--GIPFLETSAKNATNVEQ 154 (166) T ss_pred EECCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCCC--CCCHHHHH--HHHHHC--CCEEEEECCCCCCCHHH T ss_conf 7117998999999999999998678777448861320113146--67999999--999983--99699987687806899 Q ss_pred CCCCHH Q ss_conf 221000 Q gi|254780787|r 536 LLDAIL 541 (884) Q Consensus 536 ~~~~~~ 541 (884) T Consensus 155 ~F~~l~ 160 (166) T cd01869 155 AFMTMA 160 (166) T ss_pred HHHHHH T ss_conf 999999

HHsearch alignment for GI: 254780787 and conserved domain: cd01869