>cd03699 lepA_II lepA_II: This subfamily represents the domain II of LepA, a GTP-binding protein localized in the cytoplasmic membrane. The N-terminal domain of LepA shares regions of homology to translation factors. In terms of interaction with the ribosome, EF-G, EF-Tu and IF2 have all been demonstrated to interact at overlapping sites on the ribosome. Chemical protection studies demonstrate that they all include the universally conserved alpha-sarcin loop as part of their binding site. These data indicate that LepA may bind to this location on the ribosome as well. LepA has never been observed in archaea, and eukaryl LepA is organellar. LepA is therefore a true bacterial GTPase, found only in the bacterial lineage.

Probab=96.28 E-value=0.0094 Score=36.80 Aligned_cols=75 Identities=17% Similarity=0.268 Sum_probs=54.7 Q ss_pred EEECCCCCCEEEEEEEEEEEECCCEEEEEECCEEEEEEEEHHHHHCCHHHHHHHCCCEEE--EEEECCEEEEECCEEE Q ss_conf 873389870789998521784698079966998998226257664460066872797669--9972841100589899 Q gi|254780787|r 798 VFAVTKLGNVAGCKVSEGKVERGSGVRLIRNSTVIYEGKLKTLKRFKDEVSEVHAGQDCG--MAFEKYDNIQAGDMIE 873 (884) Q Consensus 798 vF~~~k~~~i~G~~V~~G~i~~~~~~~v~r~~~~i~~g~i~sl~~~k~~v~ev~~g~ecg--i~~~~~~~~~~gD~i~ 873 (884) T Consensus 9 ~yD-~y~Gvv~~vRV~~G~lk~gd~i~~~~t~~~~~v~evG~~~P~~~~~~~L~aGeVGyii~gik~~~d~~vGDTit 85 (86) T cd03699 9 WYD-PYRGVIALVRVFDGTLKKGDKIRFMSTGKEYEVEEVGIFRPEMTPTDELSAGQVGYIIAGIKTVKDARVGDTIT 85 (86) T ss_pred EEC-CCCCEEEEEEEECCEECCCCEEEHHHCCCCCEEEEEEECCCCCCCCCEECCCCCCEEEECCCCCCCCCCCCEEE T ss_conf 722-78878999999799991798522334899638559887179976388494784048997342015573447875

HHsearch alignment for GI: 254780787 and conserved domain: cd03699