>cd04089 eRF3_II eRF3_II: domain II of the eukaryotic class II release factor (eRF3). In eukaryotes, translation termination is mediated by two interacting release factors, eRF1 and eRF3, which act as class I and II factors, respectively. eRF1 functions as an omnipotent release factor, decoding all three stop codons and triggering the release of the nascent peptide catalyzed by the ribsome. eRF3 is a GTPase, which enhances the termination efficiency by stimulating the eRF1 activity in a GTP-dependent manner. Sequence comparison of class II release factors with elongation factors shows that eRF3 is more similar to eEF1alpha whereas prokaryote RF3 is more similar to EF-G, implying that their precise function may differ. Only eukaryote RF3s are found in this group. Saccharomyces cerevisiae eRF3 (Sup35p) is a translation termination factor which is divided into three regions N, M and a C-terminal eEF1a-like region essential for translation termination. Sup35NM is a non-pathogenic prion-li

Probab=97.63 E-value=0.00014 Score=49.30 Aligned_cols=77 Identities=17% Similarity=0.325 Sum_probs=66.8 Q ss_pred EEEEEEEEECCCCCCEEEEEEEEEEEECCCEEEEEECCEEEEEEEEHHHHHCCHHHHHHHCCCEEEEEEEC--CEEEEEC Q ss_conf 89997887338987078999852178469807996699899822625766446006687279766999728--4110058 Q gi|254780787|r 792 NAEVLEVFAVTKLGNVAGCKVSEGKVERGSGVRLIRNSTVIYEGKLKTLKRFKDEVSEVHAGQDCGMAFEK--YDNIQAG 869 (884) Q Consensus 792 ~a~v~~vF~~~k~~~i~G~~V~~G~i~~~~~~~v~r~~~~i~~g~i~sl~~~k~~v~ev~~g~ecgi~~~~--~~~~~~g 869 (884) T Consensus 3 R~pi~dv~k-g-~G~vV~G~vesG~v~~Gd~v~i~P~~~~---~~Vk~I~~~~~~v~~A~aGd~V~l~L~gvd~~~i~rG 77 (82) T cd04089 3 RLPIIDKYK-D-MGTVVLGKVESGTIKKGDKLLVMPNKTQ---VEVLSIYNEDVEVRYARPGENVRLRLKGIEEEDISPG 77 (82) T ss_pred EEEEEEEEE-C-CCEEEEEEEEEEEECCCCEEEEECCCCE---EEEEEEEECCEEECEECCCCCEEEEECCCCHHHCCCC T ss_conf 826878992-8-9889999993677829999999589988---9999999999795888699732688848888844788 Q ss_pred CEEE Q ss_conf 9899 Q gi|254780787|r 870 DMIE 873 (884) Q Consensus 870 D~i~ 873 (884) T Consensus 78 ~vlc 81 (82) T cd04089 78 FVLC 81 (82) T ss_pred CEEC T ss_conf 7995

HHsearch alignment for GI: 254780787 and conserved domain: cd04089