>cd04140 ARHI_like ARHI subfamily. ARHI (A Ras homolog member I) is a member of the Ras family with several unique structural and functional properties. ARHI is expressed in normal human ovarian and breast tissue, but its expression is decreased or eliminated in breast and ovarian cancer. ARHI contains an N-terminal extension of 34 residues (human) that is required to retain its tumor suppressive activity. Unlike most other Ras family members, ARHI is maintained in the constitutively active (GTP-bound) state in resting cells and has modest GTPase activity. ARHI inhibits STAT3 (signal transducers and activators of transcription 3), a latent transcription factor whose abnormal activation plays a critical role in oncogenesis. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Ras proteins. Due to

Probab=99.05 E-value=7.4e-10 Score=85.40 Aligned_cols=146 Identities=21% Similarity=0.223 Sum_probs=95.3 Q ss_pred EEEEECCCCCHHHHHHHHHHHHHHHCCCCCCEECCCEEE---EECC--CCEEEEEECCCHHHHHHHHHHHHHCCCCEEEE Q ss_conf 898623685044677788642221001231000121499---9517--84388885166157899986664206805999 Q gi|254780787|r 386 VTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGAYQ---VAYQ--GKNITFLDTPGHAAFYEMRARGARVTDIAVLV 460 (884) Q Consensus 386 v~v~ghvd~GKt~lld~~r~~~~~~~e~ggitq~iga~~---~~~~--~~~~~~iDtPGh~~f~~~r~rg~~~~d~~ilv 460 (884) T Consensus 4 ivllGd~~VGKTsli~r~~~~~F~~~y----~~Ti~~~~~~~i~~~~~~~~l~iwDtaG~e~~~~l~~~~~~~a~~~ilv 79 (165) T cd04140 4 VVVFGAGGVGKSSLVLRFVKGTFRESY----IPTIEDTYRQVISCSKNICTLQITDTTGSHQFPAMQRLSISKGHAFILV 79 (165) T ss_pred EEEECCCCCCHHHHHHHHHHCCCCCCC----CCCCCCEEEEEEEECCEEEEEEEEECCCCCCCCCCHHHHHCCCCEEEEE T ss_conf 999899997699999999649699986----8845420558999999999999998999846542324450688579998 Q ss_pred EECCCCCCHHHHHH----HHHHHH---CCCCEEEECCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCEEEEEEECCCCCC Q ss_conf 98366740235777----898997---09941561233124433200022100001320001234740363110024774 Q gi|254780787|r 461 LAADEEIMPQAIES----INHAKA---ADVSIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNL 533 (884) Q Consensus 461 v~~~~g~~~qt~e~----~~~~~~---~~~p~iva~nk~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 533 (884) T Consensus 80 ydit~~~Sf~~~~~~~~~i~~~~~~~~~~~piilVgNK~Dl~~~r--~V~~~e~~--~~a~~~--~~~~~E~SAk~~~nV 153 (165) T cd04140 80 YSVTSKQSLEELKPIYELICEIKGNNIEKIPIMLVGNKCDESHKR--EVSSNEGA--ACATEW--NCAFMETSAKTNHNV 153 (165) T ss_pred ECCCCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCC--CCCHHHHH--HHHHHC--CCEEEEECCCCCCCH T ss_conf 138987899999999999999961588888789986424640027--88999999--999986--988999744779487 Q ss_pred CCCCCCHH Q ss_conf 11221000 Q gi|254780787|r 534 DKLLDAIL 541 (884) Q Consensus 534 ~~~~~~~~ 541 (884) T Consensus 154 ~e~F~~l~ 161 (165) T cd04140 154 QELFQELL 161 (165) T ss_pred HHHHHHHH T ss_conf 99999998

HHsearch alignment for GI: 254780787 and conserved domain: cd04140