>cd04149 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 6) proteins localize to the plasma membrane, where they perform a wide variety of functions. In its active, GTP-bound form, Arf6 is involved in cell spreading, Rac-induced formation of plasma membrane ruffles, cell migration, wound healing, and Fc-mediated phagocytosis. Arf6 appears to change the actin structure at the plasma membrane by activating Rac, a Rho family protein involved in membrane ruffling. Arf6 is required for and enhances Rac formation of ruffles. Arf6 can regulate dendritic branching in hippocampal neurons, and in yeast it localizes to the growing bud, where it plays a role in polarized growth and bud site selection. In leukocytes, Arf6 is required for chemokine-stimulated migration across endothelial cells. Arf6 also plays a role in down-regulation of beta2-adrenergic receptors and luteinizing hormone receptors by facilitating the release of sequestered arrestin to allow endocytosis. Arf6 is believed t

Probab=99.47 E-value=3.2e-13 Score=108.37 Aligned_cols=152 Identities=16% Similarity=0.107 Sum_probs=106.6 Q ss_pred CEEEEEECCCCCHHHHHHHHHHHHHHHCCCCCCEECCCEEEEECCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEEEC Q ss_conf 03898623685044677788642221001231000121499951784388885166157899986664206805999983 Q gi|254780787|r 384 PVVTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGAYQVAYQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAA 463 (884) Q Consensus 384 pvv~v~ghvd~GKt~lld~~r~~~~~~~e~ggitq~iga~~~~~~~~~~~~iDtPGh~~f~~~r~rg~~~~d~~ilvv~~ 463 (884) T Consensus 10 ~kililG~~~sGKTsil~~l~~~~~~~~---~pTvg~~~~~~~~~~~~l~iwD~~Gqe~~r~l~~~y~~~~~~iifVvDs 86 (168) T cd04149 10 MRILMLGLDAAGKTTILYKLKLGQSVTT---IPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDS 86 (168) T ss_pred EEEEEECCCCCCHHHHHHHHHCCCCCCC---CCCCCCEEEEEEECCEEEEEEECCCCCCCCCHHHHHCCCCCEEEEEEEC T ss_conf 8999999999998999999966998760---2626700799998988999998999974660657643788668999837 Q ss_pred CCCC-CHHHHH----HHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCEEEEEEECCCCCCCCCCC Q ss_conf 6674-023577----78989970994156123312443320002210000132000123474036311002477411221 Q gi|254780787|r 464 DEEI-MPQAIE----SINHAKAADVSIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKLLD 538 (884) Q Consensus 464 ~~g~-~~qt~e----~~~~~~~~~~p~iva~nk~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 538 (884) T Consensus 87 td~~~~~~~~~~l~~~l~~~~~~~~pilI~~NK~Dl~~~~~~~ei~~~l~---l~~~~~~~~~i~~~SA~tG~Gv~e~f~ 163 (168) T cd04149 87 ADRDRIDEARQELHRIINDREMRDALLLVFANKQDLPDAMKPHEIQEKLG---LTRIRDRNWYVQPSCATSGDGLYEGLT 163 (168) T ss_pred CCHHHHHHHHHHHHHHHHCHHHCCCEEEEEEECCCCCCCCCHHHHHHHHC---HHHHHCCCCEEEEEECCCCCCHHHHHH T ss_conf 76789999999999997145227986999997566777889999999978---765517980999806878969799999 Q ss_pred CHH Q ss_conf 000 Q gi|254780787|r 539 AIL 541 (884) Q Consensus 539 ~~~ 541 (884) T Consensus 164 WL~ 166 (168) T cd04149 164 WLS 166 (168) T ss_pred HHH T ss_conf 986

HHsearch alignment for GI: 254780787 and conserved domain: cd04149