>cd04157 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a subfamily of the Arf family of small GTPases. Arl6 expression is limited to the brain and kidney in adult mice, but it is expressed in the neural plate and somites during embryogenesis, suggesting a possible role for Arl6 in early development. Arl6 is also believed to have a role in cilia or flagella function. Several proteins have been identified that bind Arl6, including Arl6 interacting protein (Arl6ip), and SEC61beta, a subunit of the heterotrimeric conducting channel SEC61p. Based on Arl6 binding to these effectors, Arl6 is also proposed to play a role in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation. At least three specific homozygous Arl6 mutations in humans have been found to cause Bardet-Biedl syndrome, a disorder characterized by obesity, retinopathy, polydactyly, renal and cardiac malformations, learning disabilities, and hypogenitalism. Older literature suggests that A

Probab=99.44 E-value=1.1e-12 Score=104.76 Aligned_cols=149 Identities=14% Similarity=0.173 Sum_probs=104.1 Q ss_pred EEEEECCCCCHHHHHHHHHHHHHHHCCCCCCEECCC--EEEEECCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEEEC Q ss_conf 898623685044677788642221001231000121--499951784388885166157899986664206805999983 Q gi|254780787|r 386 VTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIG--AYQVAYQGKNITFLDTPGHAAFYEMRARGARVTDIAVLVLAA 463 (884) Q Consensus 386 v~v~ghvd~GKt~lld~~r~~~~~~~e~ggitq~ig--a~~~~~~~~~~~~iDtPGh~~f~~~r~rg~~~~d~~ilvv~~ 463 (884) T Consensus 2 Il~lGl~~sGKTtil~~l~~~~~~~~---~~~pT~G~~~~~~~~~~~~~~iwD~~G~~~~r~lw~~y~~~~~~iI~VvDs 78 (162) T cd04157 2 ILVVGLDNSGKTTIINQLKPENAQSQ---IIVPTVGFNVESFEKGNLSFTAFDMSGQGKYRGLWEHYYKNIQGIIFVIDS 78 (162) T ss_pred EEEECCCCCCHHHHHHHHHCCCCCCC---CCCCCCCEEEEEEEECCEEEEEEECCCCCCCCHHHHHHHCCCCEEEEEEEC T ss_conf 99999999988999999972898756---416850757899983998899998588744205589870567448999707 Q ss_pred CCCC-CHHHHHHHHHHH------HCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCEEEEEEECCCCCCCCC Q ss_conf 6674-023577789899------709941561233124433200022100001320001234740363110024774112 Q gi|254780787|r 464 DEEI-MPQAIESINHAK------AADVSIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDKL 536 (884) Q Consensus 464 ~~g~-~~qt~e~~~~~~------~~~~p~iva~nk~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 536 (884) T Consensus 79 sd~~~~~~~~~~l~~ll~~~~~~~~~~PiLI~~NK~D~~~~~~~~ei~~~l~l~---~~~~~~~~i~~~SA~tG~Gi~e~ 155 (162) T cd04157 79 SDRLRLVVVKDELELLLNHPDIKHRRVPILFFANKMDLPDALTAVKITQLLGLE---NIKDKPWHIFASNALTGEGLDEG 155 (162) T ss_pred CCHHHHHHHHHHHHHHHHCHHHCCCCCEEEEEEECCCCCCCCCHHHHHHHHCHH---HHCCCCEEEEEEECCCCCCHHHH T ss_conf 638889999999999971765517984599998147788999999999885866---52489649999789789798999 Q ss_pred CCCH Q ss_conf 2100 Q gi|254780787|r 537 LDAI 540 (884) Q Consensus 537 ~~~~ 540 (884) T Consensus 156 f~WL 159 (162) T cd04157 156 VQWL 159 (162) T ss_pred HHHH T ss_conf 9998

HHsearch alignment for GI: 254780787 and conserved domain: cd04157