>cd04465 S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain.While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 2 of the Escherichia coli and Homo sapiens RPS1 (ec2 and hs2, respectively). Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.

Probab=97.76 E-value=0.00019 Score=51.88 Aligned_cols=62 Identities=29% Similarity=0.495 Sum_probs=53.8 Q ss_pred CCEEEEEEEECCCCEEEEEECCCEEEEEHHHCCCC-----CCCCCCCEEEEEEEEECCCCCEEEEEEECC Q ss_conf 83899999840576389995793587447874887-----511527669999976113587028987159 Q gi|254780788|r 139 GEIISGTVKRVEYGNVIVDLGNSDGVIRRDETISR-----ENLRPGDRVKSYIYDVRREQRGPQVLLSRT 203 (526) Q Consensus 139 Geiv~G~V~r~e~~~iiVdlg~~ea~Lp~~e~ip~-----E~~~~Gdrika~i~~V~~~~rgpqi~lSRt 203 (526) T Consensus 1 g~~v~g~I~~~~kGG~~v~~~gv~~FiP~Sq~~~~~~~~~~~~-vG~~i~~~Ii~~d~~~~--~ivvSrk 67 (67) T cd04465 1 GEIVEGKVTEKVKGGLIVDIEGVRAFLPASQVDLRPVEDLDEY-VGKELKFKIIEIDRERN--NIVLSRR 67 (67) T ss_pred CCEEEEEEEEEECCCEEEEECCEEEEEECHHCCCCCCCCHHHH-CCCEEEEEEEEEECCCC--EEEEECC T ss_conf 9999999999985719999999999988025255456896897-89989999999927889--9999879

HHsearch alignment for GI: 254780788 and conserved domain: cd04465