>cd05688 S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 3 (ec3) of the Escherichia coli RPS1. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.

Probab=97.81 E-value=7.5e-05 Score=54.89 Aligned_cols=58 Identities=28% Similarity=0.517 Sum_probs=53.1 Q ss_pred CCCEEEEEEEECCCCEEEEEECCCEEEEEHHHCC------CCCCCCCCCEEEEEEEEECCCCCE Q ss_conf 0838999998405763899957935874478748------875115276699999761135870 Q gi|254780788|r 138 VGEIISGTVKRVEYGNVIVDLGNSDGVIRRDETI------SRENLRPGDRVKSYIYDVRREQRG 195 (526) Q Consensus 138 ~Geiv~G~V~r~e~~~iiVdlg~~ea~Lp~~e~i------p~E~~~~Gdrika~i~~V~~~~rg 195 (526) T Consensus 1 eG~iv~g~V~~i~~fG~FV~l~gi~Glihisels~~~~~~~~~~~k~Gd~v~~kVi~iD~~k~r 64 (68) T cd05688 1 EGDVVEGTVKSITDFGAFVDLGGVDGLLHISDMSWGRVKHPSEVVNVGDEVEVKVLKIDKERKR 64 (68) T ss_pred CCCEEEEEEEEEECCEEEEEECCEEEEEECHHHCCCCCCCHHHHCCCCCEEEEEEEEEECCCCE T ss_conf 9999999999995638899979989999843646666689889147999999999999999798

HHsearch alignment for GI: 254780788 and conserved domain: cd05688