>cd05692 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 4 (hs4) of the H. sapiens RPS1 homolog. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.

Probab=97.44 E-value=0.00082 Score=47.26 Aligned_cols=61 Identities=30% Similarity=0.543 Sum_probs=53.1 Q ss_pred CCEEEEEEEECCCCEEEEEEC-CCEEEEEHHHC------CCCCCCCCCCEEEEEEEEECCCCCEEEEEEEC Q ss_conf 838999998405763899957-93587447874------88751152766999997611358702898715 Q gi|254780788|r 139 GEIISGTVKRVEYGNVIVDLG-NSDGVIRRDET------ISRENLRPGDRVKSYIYDVRREQRGPQVLLSR 202 (526) Q Consensus 139 Geiv~G~V~r~e~~~iiVdlg-~~ea~Lp~~e~------ip~E~~~~Gdrika~i~~V~~~~rgpqi~lSR 202 (526) T Consensus 1 G~vv~G~V~~I~~fGaFV~l~~g~~GL~HiSeis~~~v~~~~~~~~~Gd~v~vkVi~id~--~~-ri~LS~ 68 (69) T cd05692 1 GSVVEGTVTRLKPFGAFVELGGGISGLVHISQIAHKRVKDVKDVLKEGDKVKVKVLSIDA--RG-RISLSI 68 (69) T ss_pred CCEEEEEEEEEECCEEEEEECCCCEEEEEHHHHCCCCCCCHHHHCCCCCEEEEEEEEECC--CC-CEEECC T ss_conf 999999999998538999968998899996983456557988917899999999999999--99-668015

HHsearch alignment for GI: 254780788 and conserved domain: cd05692