RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780789|ref|YP_003065202.1| hypothetical protein CLIBASIA_03400 [Candidatus Liberibacter asiaticus str. psy62] (192 letters) >1ib8_A Conserved protein SP14.3; nucleic acid binding protein, ribosomal protein, essential gene, structural genomics; NMR {Streptococcus pneumoniae} (A:1-91) Length = 91 Score = 74.4 bits (183), Expect = 1e-14 Identities = 29/85 (34%), Positives = 49/85 (57%), Gaps = 5/85 (5%) Query: 20 GLAGDISSVIQPVIEEMSFRSVQISLLEE-KNLLLQIFVERDDGNMTLRDCEELSQAISP 78 + + V++PVIE F V I + +++L IFV++ +G +TL D +L++ ISP Sbjct: 9 TIVELVREVVEPVIE-APFELVDIEYGKIGSDMILSIFVDKPEG-ITLNDTADLTEMISP 66 Query: 79 ILDVENI--IEGHYRLEVSSPGIDR 101 +LD Y LE++SPG++R Sbjct: 67 VLDTIKPDPFPEQYFLEITSPGLER 91 >1ib8_A Conserved protein SP14.3; nucleic acid binding protein, ribosomal protein, essential gene, structural genomics; NMR {Streptococcus pneumoniae} (A:92-164) Length = 73 Score = 38.5 bits (90), Expect = 5e-04 Identities = 12/73 (16%), Positives = 25/73 (34%), Gaps = 4/73 (5%) Query: 102 PMVRKSDFLRWNGHVVACEIVLSSGDKQKLIGKIMGTSETGFFLEKEKRGEKDMNELQIA 161 P+ K G + + + ++ G ++ E +E + K + Sbjct: 1 PLKTKDAVAGAVGKYIHVGLYQAIDKQKVFEGTLLAFEEDELTMEYMDKTRKK----TVQ 56 Query: 162 ISFDSLLSARLIV 174 I + + ARL V Sbjct: 57 IPYSLVSKARLAV 69 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (B:1772-1800,B:1916-2006) Length = 120 Score = 31.3 bits (71), Expect = 0.084 Identities = 7/25 (28%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Query: 36 MSFRSVQISLLEEKNLLLQIFVERD 60 MS S+ + ++ + + +Q+ V RD Sbjct: 6 MSIESL-VEVVFYRGMTMQVAVPRD 29 >1pv5_A Hypothetical protein YWQG; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.75A {Bacillus subtilis} (A:) Length = 264 Score = 27.4 bits (60), Expect = 1.4 Identities = 11/52 (21%), Positives = 18/52 (34%) Query: 52 LLQIFVERDDGNMTLRDCEELSQAISPILDVENIIEGHYRLEVSSPGIDRPM 103 +LQ ++ D L + Q ++ ENI+E L I Sbjct: 85 ILQFYISVHDDVYGLNFDDRCEQKNFRVIYFENIVENDDELVSDFSFIGTGE 136 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.318 0.137 0.382 Gapped Lambda K H 0.267 0.0640 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,402,558 Number of extensions: 60436 Number of successful extensions: 113 Number of sequences better than 10.0: 1 Number of HSP's gapped: 111 Number of HSP's successfully gapped: 11 Length of query: 192 Length of database: 4,956,049 Length adjustment: 84 Effective length of query: 108 Effective length of database: 2,116,429 Effective search space: 228574332 Effective search space used: 228574332 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.0 bits)